ELF@444 (`@@47x3P zHP tHP pHP lH_HyHP `HP THP ZHP THP PHP LHP HHP DHP @HP HP ?HP @|HP AxHP BtHP CpHP DlHP EhHP FdHP G`HP H\HP IXHP JTHP KPHP LLHP MHHP NDHP O@HP P HP ? HP @ |HP A xHP B tHP C pHP D lHP E hHP F dHP G `HP H \HP I XHP J THP K PHP L LHP M HHP N DHP O @HP P HP ?HP @|HP AxHP BtHP CpHP DlHP EhHP FdHP G`HP H\HP IXHP JTHP KPHP LLHP MHHP NDHP O@HP Pc ;8;;;;; ;(;0H )@`  >c !  >c ;8!7 >cL0+0;"+,+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; >c  9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P->c  %)>c" %"+/> ->c +cP> "`""#t@> ΐ!;x ;"`;" @S/@^Ҋ@@2 @ 0P -@ @ @"P/> P->c  %)>c" %"+/> ->c +cP> "`""#t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @Rt x ``-`؁ @Rؐ tx ρ )>!4@! P->c  %)>c" %"+/> ->c +cP> "`""#t@;x;;>!<!@ ;`#h#l;;;;@%``htx ;`#h#l;;;;@``htxn )>)!,@)>)! P -@ @ @"P/> P->c  %)>c" %"+/> ->c +cP ;`@;h#t;x;;;;;`@;`htx( />S->c +cPۜP -@ @ @"P/> P->c  %)>c" %"+/> ->c +cP ;`@;h#t;x;;;`;;@;`htx၌ -?P -@-P -@ @ @"/>S/> />S6PP->c  %)>c" %"/>S/> />SP;x> "`""@;,/,;@ ;`,)>c#0;h %)> " #pH  p@  "`@ x  +?P`-@-?P- %0P -@ @ @"/>S/> />S6PP->c  %)>c" %"/>S/> />SP;x> "`""@;,/,;@ ;`,)>c#0;h %)> "#pH  p@  "`@  @@e[`x' P -@ @ @"/>S/> />S6PP->c  %)>c" %"/>S/> />SP> "`""?P * * ;`@;h09P -@ @ @"/>S/> />S6PP->c  %)>c" %"/>S/> />SP> "`""?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@P`h ?P `*  P -@ @ @"/>S/> />S6PP->c  %)>c" %"/>S/> />SP> "`""?p " ?P "  ;`@;h@d`h ?p " q @/>  @̀->c  $)>c" %->c +cP->c ZP @ H ,@`#>cb $` (08 @̀=)>c"L0+0;"+2+0 `# @ 05-" % >&u 8 >0-@0=`"-@-@0 `# @ 05-"Y  ->c %- +cP ;`@;h #t;x;`;;;;@c;`htx ->c & 0Ȧ! H,@` !`hpxX (08@HP @̀H,@`%>c $!>c" `8 (0 @̀@ @̀  H ,@`#>cb $` (08@̀<2??@ @̀='>cL0/0?"/2/0 `# @ 05-"$>& 8>0-@0=`"-@-@0 `# @ 05-" ?  H,@`#>cb $`!>c" `8 (0@̀ ->c  @uP->c "/> 4͐  ! H,@` !X (08@HP @̀>c┒ `?* `"" * `@">cⳒ  * `@&* *  ֊@* "``(  cb;c0 c0  c  mt@ >   >  @@   >  @@ #>%>Ԥx  '`@`@ 7  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%b@>c""$ *>c""H!`>c""LH(  /  >[ 4==>cpH >c""P> "> Ԓbx@"@!> v$#H``> v-"c  !>%#!>'!$ $ >%# 2> " > " > "!> "!@>#"">#"">#"#D>#"#l>$""$>$""L>$"">$"">)"">)""0>*"#@P@KFd#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP    "%>c> >c"  ">c>@ >c " >&b4# " >&bP# J@*@ ` `*@ ?"@ 2"# @ `*@ @ `*@  "  ?J*@`8  ?"@ 2"> * >c >@ *>c  >&#@S" >c " >c "   >c 4``6 >Sb >c  ! !`>[ @bu> v#`"#> #`"# > v >c> v!쁈`耒2$j0>'@t >'@q >'@n +switch rqswitch wchanswitch SRUN> v >c : H> v" (o!쁈`j> #(> : >)p"2J "2 J    "2 J  J " > w`+  @ #@"   *@ * lH1 > w"!, `!쀠"I"j > w!`"!j ` *@  ( ! > v!` (08 2㿠@n>cb$` Ъ@@>`€"Т@: H" H*/  h:`>c >'cD" `2 `2`2" " ?" ?>c >'cD" `2*`22`2"" @>'cP" Њ@" " @""@" "`""@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"` 2@"" R"`2@"" "`"@"" R"`2@2J?*>cb >)` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x 0000H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >)p "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@a>cbԔ """"""""""""""""@2?# * 2  bԒc  @ b> ?(( @ 3 >c#p c@  Њb@&""""  > c@ @> vc ``44: " longjmp botch@" `&"`㿠>+@+ 6 0T000008ـ٬8DDָDDDDDDDDDDDDDDDDDDDDDDDxh0H0`,    2     2 㿘 H>Ab4@"Ȁ 2"Ԑ  @c &""Ԁ 2"Ȑ  @c &""Ȁ >"Ԁ 2">@"P0D >i>Ȑ"`@ 0<!,* ">"@"" @o  `.  . "*"@ *`"  *  , @^*  . . `&  @."" 6 f6 j> ` & |& t& @ >c#l*"@ @R*`㿘 ` @!>i!!>Ȑ" @”!  ."`  !! >Ȑ"@! ."   !"` W>>+!<*`     `  "` &"  "` &"   "    &". .    .     `   `   `   `  " @M" `   `   `   `  "  `  㿘 `@>Ȑ"@! >i!!>Ȑ" @!b  ."`  㿐)>i! >"#@!>i! 2"> >Ȑ#c #\ L  @y  $!" 2  & & &  @z" ""?07 ."6" "`, @ߐ Ȥ  "%   $ , "`, @ΐ ,`  " `"  "`, @``,`,   2 ٦@ې!&"&"  "  :    : `!`*"***@`  ."!!>Ȑ" @~!  ."`  0."@㿐`   ,  #>ia  >`/#``I`J@[ ."`  2"`А"@ >c @#>ccl#l @# @`" 2 a!>Ȑ" @1"W  ."`            + " @| ,`"* "@t* &`"    2 "  " 2 "􀌠"?"  "          ` "n`I" T`/`@&"&"'    `  @2 "  ` "  `  " >i!!>Ȑ" @"n  ."`  >i!! >Ȑ"@"q  ."`    ""`@@`/>i!!>Ȑ" A@n"v A ."`  A0ߠ  " "    `  ` .`,`@`,`I`*`J *`@  `..`." q 2p &"&"'    `  @2 "  ` "  `  !>i!!>Ȑ" @ "  ."   `!" @6"."!!>Ȑ" @"  ."`   !!>Ȑ" @"  ."`   `"" @ `@0H @d !>i! >@#!!>Ȑ" C@" C ."`  C0+`!" @6".">i!!>Ȑ" F@"Ő F ."`  F0>i!!>Ȑ" B@"ǐ B ."`  B㿘H /d * % > #@&` H 0㿘> v#쀢  `@? H / * % > @#H 0` L@ڐ>A``t@`  &`  㿘   '>i >@/# >  @# @% *    @,``  Ĕ4$  @_  2@$ > #(<$H /d * %  $"` $  $ ,`` " H 0n 2$ M  $  $ @ $  $ D  /  $ @ $ < $$ D, HH /d4$* %$`$ `"%`  $ b  @NH 02  @ " @Ӑ @   @ʐ 㿘!>i! >@}#Ȁ"!  `@ "`@ ͐` ""  ! >@c#@ #贆2  㿘/>i "">@P "`" >@ސ ``` `*     ` @  ` "`  @  !H /d* % ,     ɐ &> $  @^   H 0@@$  < $  "` $$ , " > #($   "$  `      `  H 0s@:,`I  2 H 0d@ * *@ 2  @  *@ 22 >@/ @ , , * " ,`JH 0 `    , @``& ` @``"`& `@"@` ?$` & 0 "@>` h@]`@`2`㿘``/  *  >i!  >@G x@֒  .`/  * ,`,``  4   #&`@&`<&`D&` &` $,     Ք   2, @ , $  @2 0 &@ " & &  &``  &` " 㿘` *  ,     +>ia > ,@ڐ @``H (2  , `>ɒ*`4  2@˒  , 2 `H, X` @  $ , $ ,`H > 2`D`D$ ([0Q$ ( a `$  (`" ,>@  ,`2>> 4@ @!@7 @2  ," &  ."/ , 2 ` 2  ` 2 4`, " ``"` ` "` ` `"@@^.  `@fu%㿘`  `*  ` 2,``  ,`  2  >>>ɐ!@ǖ2`I*"`I `J*`  "">ɐ!H@ ?*`  ?&` @``"`& @`"㿘!>i! >@!!!>Ȑ" @$  ."   "  $ 㿘``>0"&"""@@i! @€ "` * ,` 6   @€ , &  % `   @€ , @ € "ܠ 6 " @€ , & "ܐ&"!>i!  >ɀ`!>!>ɒ!"@ ! """ܠ : >"> @@t!"ܠ *">@l!"܁㿘!>i! >ɐ!@`!  6 >@>@U! &@>@N!  `@ " 2   `   & 㿘b   bb  b* *@>ɐ"@ `!>i\ ? `.   @, `      `` `    ,bݰ `.@  >ɐ"@@`!>i,b$` ````+`b`@D . "* b@<* & b  ` 2 b b 2 b􀎠"?b  b `  `  `    !>i! >ɐ" @%L!!>Ȑ" @%L` ,b`   bbĐ @ ` @! >ɐ" @r%N!!>Ȑ" @j%N` ,b`   bbĐ @` ,b4b< $bD>$b! >ɐ" @N%W!! >Ȑ"@F%W` ,b`   bbĒ`@ ! >ɐ" @1%[!!>Ȑ" @)%[` ,b`   bbĒ`@ 4b,b 㿘+>ia >"@""܀ 2">ɐ"@ 0a" >ɐ#@ "&"ܐ ."a >" @@#8" a!>Ȑ" @%  ."`  ""> @א#P0"܀` >ɐ" @̔%a!>Ȑ" @Ĕ%  ."`  ""Đ 6"Ē`A0.""2""Ԙ    `  ( `         `  `?`aa!>Ȑ" @%  ."`  0">" @#h@n " &"  >">  "  *  `"K>+!d*` a">@J#" 6  @e8 ">ɐ#@> &" ! " $D" ( ."a">"@)#"€ @"| a"M!2">` #`@ a">@ #a! >Ȑ"@%  ."`  9   ,     +         I  ` J*  ",J" `?*`,J,I *`R"`>`  `@ʒ " ."  ,  "`     `   `  -">`  (`@  ,a">@ P"a">  X@ "a">@ h  $" ." !$ a">@x x"$<"$Da">@m <&"D&"a"> @a " `  " `Fa"> ` `@P " ` N!>i `,"  , ," "   ``|!@d* >@2 "  , ,a >ɐ" @#&Ra!Z>Ȑ" T&Rd @  @!- @*`@*`" "@t ,`"* "@l* &`,`"* "@b* ,@c >ʐ @" 21  "@6 ",   ,  ,a >ɐ" @Д&oa!>Ȑ" &o@  ."`  ""Đ @`."6"Đ ," ."  `+ "a @ ,`"* "@ * &`"    2 "  " 2 ""?"  "          ">ʐ!@g "  2L,  @, +@ " @ ,`"* "@* &`"    2 "  ``" 2 ""?"  "             ,@c >@! !>ia"">@!P@b >@!X!>i! >ɐ" @&!!>Ȑ" @&  ."`  ""Đ @a`" 2>"`2 >! S""  >ʐ!@Ȓ a6"  @"Đ"@ a >ɐ" @&a!>Ȑ" @&  ."`  ""Đ @` >ɐ" @&a!>Ȑ" @&  ."`  ""Đ @` ."6""Ā >i!!>Ȑ" @u&  ."`  >i!!>Ȑ" @d&  ."`  " ."&"܁㿐!>i! >"Đ"@@L"" @" "="!!>Ȑ" @=&  ."   6")&"Ѐ ">! >"Ɛ"@'&!!>Ȑ" @&  ."`  ""Đ @"."@ 6"Đ"p @ &"Ѐ 2""Ě "ƒ    * 6"6"6"€&"@"""Д ƀ""""r  " """     "ȑ* *@"Ȑ *`"Ȥ*` "*  "* " &"  ,  +@ "k @ ,`"* "@* &`"    2 "  ``" 2 ""?"  "          ]"Ȕ     "ȑ* *@"Ȥ*`"*  "* I&"" >ʐ" @Z'  "Ȑ 9*@ >ʐ" @K'   I"* J"* (&"Д  "."*@   *    , , *@   "Ȑ  *@ *@  "."*@"&"" 2""̐">i!!>Ȑ" @'_  ."`  0V"@8 " '"̖ @    `  @2 "  ` "  `  !>i!!>Ȑ" @Ĕ'h  ."`  !! >Ȑ"@'i  ."`    @x>i! >"@" `@ 2   € . @€ " ` .  @€ .  @€  . `$`" @ 2! &"!>i! > #0  @`  <  -& < @€  !! >Ȑ"@K'  ."    " >ʒ @:"^   >ʐ"@Ē  0@Y  @( @€  !! >Ȑ"@'  ."   L "  2  "`,  @"-""  ." ">" "#@" @€   !! >Ȑ"@ߔ'  ."    " ` ." @ "C  `@?2  >ʒ @#X  ` @ 2  2* " "& " 2"" >" #x #\ @  2    ?D#\>"@# B>ː @ " ! >ɐ" @w(3!!>Ȑ" @o(3  ."`  ""Đ @` >ɐ" @[(5!!>Ȑ" @S(5  ."`  ""Đ @`."6" ` !>i6"! >  0 @7 ` @€  !!>Ȑ" @((=  ."`  !!>Ȑ" D@(D  D."`  D"?`q>+"(*`  "`, `*    2  2 4  8 * "@`"  "`  "@ @T  2" ">@^ >@ǐ X  "*  `."  , " 2>ː x@  >@ ѐ>@ @|bN  e"`,h& "`q>+"*` >˒ @  "  >@ >@!b""   € >˔!(@p  ?  € >@d!X ? ` "6"ƀ 6"6".">i! >@M!`@| $ " & &  $  $ & " `.">˒ @0 TI   $"" "" >  !x"#\@ ; ."#>ia >ː!@ ` """ ."a!>Ȑ" @)  ."`   " " "" 2"" ."" >  @ݐ!ؐ Ͱ 0̐ ` 2B>ˀ2>@c" ` * `+>+!*` >i!!>Ȑ" @)1  ."`  ! `2 " I 2">e" >`"8` #>ia >ɐ" @@)@a!>Ȑ" @)@  ."`  ""Đ @`@."6"  F ", , " ." I !>i! >ɐ"!@f)H!!>Ȑ" @^)H  ."`  ""Đ @<a! >ɐ" @I)J!!>Ȑ" @A)J  ."`  ""Đ @`!>i! >ɐ"!@+)M!!>Ȑ" @#)M  ."`  ""Đ @a."6"Đ w&"" " " @€  i @€  `>`"H  #`#\@ !>i!!>Ȑ" @)m  ."`  ! >ɐ" @۔)n!!>Ȑ" @Ӕ)n  ."`  ""Ē`@ 6".">i!!>Ȑ" @)r  ."`  !" !"䀠*  >`"#\#`2 `@ !&"< &"D."w&" " `@ >i!! >Ȑ"@)  ."   칐 " X  `."> #@ @j  "܀>ː#p@` ""ܐ ?,H""Ԑ ?#>ia @>˒ #@N > ! " $D" ( ."#@: &"a!>Ȑ" @1)  ."`  0>ː#Ȕ @#  " 2>ˀ2">@# #>i  5a4|!>i >ɐ "!>i! > > >i! @>@#&"!>i! @" >@  /" ! 2"!!>Ȑ" @Ҕ)  ."`  " ."!! >Ȑ"@)  ."`  $ >" 2 ">  ( @ """@ ߀ ."`?    h @  c&"! @> / @@ @€  !!>Ȑ" @z*  ."`  " W/@ &"&"`'"" @    `  @2 "  ` "  `  !!>Ȑ" @7*  ."`  !! >Ȑ"@'*  ."`    @ @/!!>Ȑ" @ *  ."`    &"!>i! @>"@ !!>Ȑ" @*#  ."   ""@8 " '" @*&" @>@Ր " 2"a!>Ȑ" @ɔ*, ."   ""@8 "' " @ &" >$     `  @2 "  ` "  `  !>i!!>Ȑ" @*9  ."`  !! >Ȁ`"  @o*C   ."   `   @O a @>@T " ."a!>Ȑ" @I*I  ."   &"@= aA+  ."ې% @,ܐ"@| 2В@@@ '"@  ? `@ 2 @,Ő@@$  㿘` 'А @&`&`  @;" !'!>i! >ɐ" @*!!>Ȑ" @*  ."`  ""Ē`@ 6"."А"@@ #@|F'>ccl >c#l鈐'@|;#`@wI0 lp  `` *``@Y   € ` @ >! >̘!0 ">#\ !8#`#d" #h"#l"#p"#t" H#x #|@ DH /d4 * % @  >@}!n 0!>@v!Ȑ $,h   " @YX>@`!`  `*  $ H 0㿘> #(=H /d * %  ̠   "'`@6 2  2 4  8* $@`"  "`  "@ @Nޒ  ֠ @H 0>c#l*"@  H@v*`㿘 @€  . @€ " ` .  @€ .  @€  . `$`" @ 2! &">i! > #0  @ 㿘@   H >D#>E>D?&%H 0c""& & & 6 l& |& 0@'L@/m! 8&!! @!  @ @" !>@ @@@" >̀@ " >        &"&"!@!@/!>̒@s ">"@m"0>m>F"@ @b &!>@"`" *&"" *`&" *  * &"$&"(&"㿘H o*@ g@ H 0h l! 77!!* !!+ !*!@  77ސ 0@7!&""&"@"07&"S&" ?* !" " 70H7?* !7" " 6" "$:!"@!0 , //7Ԑ 77֒П@ " f"  "(, !" @!00 /7̐7/7Βȟ " f㿘!  㿘!   d!`"!@!! l"!  !, 2!4  ѐ d!  a" !€ !"?!€ !! !B l6 j @ ;6 l@u 0!>̐"@k !Ā`@㿈!€  ?L !  !  @   & (  & >̒ @7#`0  >̒ @/#x `&  $>̒ @"# `&  ͐  "" @ 2  >̐"@  a>̐"@ ]  >̐"@ T ,?@"$*` ?퀢%I@   @—   = @7 9   0 $ $ $ ` ',쀢  @>   쀤@µ    쀢 ( ' $ 8 $ ! %$@ج쀤 2    &  \ `&  @@, 0! :/77 "" ", !  h"&""j Q" `@ ;76 l @>̐#@h  @>̐#(@_ 0@Ah !Ȁ`"@@  &  >̐#8 @B   &   & ``  "   &   & " " "?&""  , "  ! `" l 0@&" " "6 j 㿘>̒c @ϔ  \`& \㿐 < $@ @ ",@,(*    `2LH /f * ' T > `*`@ ?2@   @X   "# 8@  <"`< < 8"`8>  $@#  ( $ 0 , @Kt 4 $ 0 ?4 > "@H 0R H /f * ' T > `*`@ ?2@   @   "# 8@  <"`< < 8"`8>  $@ǐ#  ( $ 0 , @K# 4 $ 0 ?4 > "@H 0 2b ;   <" <  6 :0 /77   H "   $ <$'6 < ,@   > <d6 <#@     & & $  ?& 2 ,$㿘H /f * '  0@(ۖ   H 00\a2@a1@5a @a@"<G 0!5@70 !6@3 0<< 4<  @E0.@  2<< ?#4< 2 @0@+@,l 4E  !̀ !@- H 0㿘㿘 xT  >@  03>@ 0@I˒ 0, $  4 %> x>i!l "!l"T@"  @Hv @{ >͔(  @ ۓ,`" $  @ `@ 㿘`@`>i!`&`&`X@w`0 㿘?2  > x"T@2`@6 > x"*` `" `؀ " @O `@  *`(\2` 㿘?2  > x"T 6 6 > x".      @l  ؀   *   ? 0 0> x(    㿘>G>"0!ؚ @K㿘>G>"0!ؚ @KҖ 㿘 D? 2`  2 > x* b@`؀ 6  23 <`& $"` $ E@kK 0A T <* & @`Ԁ   0@"0" 8`Д  0   HO @  HI @" & @ <& @ 0 (& 4& 0H /d * % @ᐐH 0?  2  2`> x"*`    m@T "@Ve e@ 0r "@V  k eg@gf@ e ``؀ _@_ 6!V R`O  @q֖ F e g@B? 2  `@?`4 # @ `* * >Gb0@q,`؀ '& $    `߲   `؀    0  @`@n 㽘%> ̐@y!@y" "$ ($ 0`ԑ2 $ ,$ 4$ 8 d$ 8>͒`P @u  4 >͔ ``@u  ,. (4 H2`  $ <4 J$ X$ $   aW4 $$ , @uH? 2`  ?6  +  *4  >Gb0@p  㿘`>t! @ۧ   & & &   㿘@=`# @@ :$   ` $ $ @$ ԰$ $ Ё㿘 !>͔p @hI Q܀ >i $$ T$ $ <* $ @Ԁ   0@"    " @8  0   H݂  H݂  @"$ @  0$ 4($ 0H /d * % @#H 0܁;<<<<(<>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>PDDDDDDDD㿘 \ @  *@F>i ` !? z  h ? 2: \ 2  3  X* \  * \`* h>i  a?,  \O  h 렄? \ `*   $ \ h @2 h \ `*@&㿘 \ E >i ` !? "  h ? 29& 2  2  X .   \`* h>i  a?,  \  h 렄? \ `*   $& h @2 h&㿘  Ȥ >J$@nc$`8 8  *, $L"@  d  6 :&%L& * \ * `* h* t  h* `@㿘 \ *@࣐! \ * `a*@ d"*@ t @㿘    `@@  @R  @?㿘 `" @   & %P 2   \  ``*`%P &%P@, `@㿘H /d4* %  >@ 0  ` >   @   &  2   $L * *`@"  @H 0㿘    `d>@c!H /d`* %`   >  !8@ ~  >@D!`     Ȗ`8+ $ `?#  4`  `# #   #  $# # #  Đ $ 2$$H @    >@ !H 0㿘 2 >@! 2 >@!؀  @ " >@! ,  $,, 22  `"  #` `>  "  $,   >@2"$,$ & &  $L *`*  &"  > "8 @  $, 2& >@"X $L *`* @" @lǐ $ Đ& `@M$& 㿘  ` @ " >@"p "$H>@"&$H  *"  *     ̒  $L@ - ,   Ȗ 8   Ȁ    `@0& @l "-   x>͒ @" %P 3`, $L"@&    &  `& &%L&%P&%T&%X``0  >͐"@ !$, &%L& & &%P&%T&%X   $  & <&%P 9b !3&%P@2  >͐#@c &  "  "    @& € "   `" @   >c#l@p# @k @I "H 㿐 " h>@#( )>i @!`>]  h ɀ @2T  X   >#p `   *@"  >͐# @ 0.  \ *@!.  h "  \`>͐#@  \>i* h* t h a?   h ֠? >͐#@Œ U 2  > # d* X  />ΐ  @ > ,* $L@0> &  &  &  & @&%L&%P&%T&%X `*  ` $*@   `" @  0*#H@x  0# 8@q    \ & *@ݧ   q &%L&%P@ d * h* t  h* ?& 㿘`  `d*`\*``*H /f * ' `X *@`` *@`\ $`\i `\? @ a `\ @ 2 `\  *@W`\ "```\*``*H 0֐T *`h*H 0` * `X*@`\*0 `\ * *`h @'a?! `h @?  `\*@ `h @2`\`d *@`\ *`` *`h*`t `h*0`\ *` ```` $*@ 㿘   d * \%L ` %p:$@ ?& %h&%p  h @ @ >i ` !? ʐ  h  ?   2   2 l " %P 2   \  ``*ܥ%P  `&%P&  2@ \`$ X%P 2   \  ``*܌%P  `&%P)& = ` `%p*  &%p%h `  (:%h`27%h`%h .`$  \%h 2 \%i @"$%h \* h>i  a? O  h Ǡ? 2 \ *@h%h` 9>I!l*` ]%P  %X \  ``*&%P \5%X "9 H \`   B %  =%  &  8& %j   >ΐ h@ƒ %P>ΐ @ %P 2 %P \  ``*%P \ &%P @ 4( %P ` &  \  ``*%P &%P \* h>i  a? Ȑ  h ܠ? 2 \ *@ޤ㿘 d   * \ @  *@%L` %d%\@z$@%P%T &%P&%T%P%T  *  &%P&%T` 2&%X>I!*`  2 >(  :     2  .%\       .%\ >ΐ!@$  .%\ >ΐ!8@  %]J&%d @M>i!M  h @ ?  2> \ @2   28 \2 %d%P 2 %d \ *@. %d&%d X>i  * \*  h ?  2 \ *@ `4 h%P p` \ *@`"㿐   d*  /  *`// ///    S @` $ , %P ` &  \  ``*%P &%P 㿘 ` @`><!` d*@4  j   `>ia* @ >ΐ!x@d 0[2   @>! 4` ` \  h  h 2  ; >ΐ!@> $ "  d & d @) `*  x  |    @ " $ $ %P ` $  \  ``*K%P  $%P㿐 d  *@    >& @!؁ 㿘 2 >@!2>@z" m  h @ @>@ې"0 $,X` @>i` !?   D>Β -" d h ? h 2   >I",  -/+'0#>Β"@ %P ` &  \  ``*%P &%P>ΐ"`@ `&%L`") l   @ "   &  @ t `" l%P    \  ``*ٙ%P &%P l >ΐ"@P %P    \  ``*ق%P &%P`^`` >Β`& "@3 `ǐ``  `># @" &  $(`2>i h aR  h @" \? >#8@  \ * ` * d`* h* t  h*  &%L&%X& & & & &%P&%TW$W,WWX`㾘> ~b8 > x"X 2 >@~k#"b8@> y 2 `8 @/`H/` /)> ~!0 a ?*a!0 ` `, @q @   ,  , ,!> x"( @ <`C B8 ,$8(H 0#Ho o!0a" a *a"a @ a*a @ B;*@ a*@H 0 >c#l*` *> x"@ "\@e*`> ~ 8㿘wH > ~a0a> x a "a*a @  a*a @ *@ a *@  @ B8H 0 㿘IH > ~a0a> x a "a*a @  a*a @ *@ a *@  @ B8H 0H > ~a0a> x a "a*a @  a*a @ *@ a *@  @ B8H 0H/ /> ~a0a> x a "a*a @  a*a @ *@ a *@  @ B;H 0H/ /> ~a0a> x a "a*a @  a*a @ *@ a *@  @ B;H 0 `,,`(㿘/H > ~a0a> x a "a*a @  a*a @ *@ a *@  @ B8H 0.  㿘#> xbX 0!> y> x>T"tb@d > x>R "\@db> ~  @ @"   $ # > x""@n"> }$@n  > ~!0* ``> ~  $bX? 0     㿐> x"X Ā > ~.  @ . @`  􀢠O@` `" # & & 4 4 :?  :?#: : ::2>i>i!a" :  &  0 > xx`B k:x$`$`$@2 2 H/` />ia> ~ `@:<>iḀ@  #a > x> x" pB: pH 00<"" " " " `+` B ; ` a`B  ;@ḛ. !! @  @8@B B; <@  > y    > x" @cƐ"tH 0㿐> x@c"t#> xbh`B :hH/`0p'` '`H 0  > y `  " 2 c* #  +`g c᜘ *`  *1 # **  c*`  (     >ΐ#*` 3 # Ĉ b @B ~@0"<> ~"@ @.E H/` />i>i!> ~   @ <""Ḓ `2z` &H 0 0 )> y`[ @iH/` / @i2`,"@$$H 0@i@m X耤@/ //@ //  // /҂$ { $ : @lʒ > x" .`@ C : `  `8? 2  @`f>Q#ؓ*` _ !> y  W #> x␄ X> }``C :X>ΐ Ȓ!  @[j B  2 8> x`B :?#I/`&:`&͠?c ?, ,` " ?# d,  0   ?#@Nn ` 2`㿘`A  > y "> ~ @b<`2R`   >i> ~@"`8>i> }"`8> y"` ~@2  @2 H  <" @ H> }਀2  2 H  ?  2  2`{  2`v @8*`2 ?# @MƔ ]?` , * 2`  * , 2 ?#??@> y ` @"  2 c* #  +`g c᜘ *`  *1 # **  c*`  (     >ΐ#*` ?3 # ?Ģ` ?` 2`? 2   > ~""8㿘 "@$ "@ "d8""@H @v  "@  b~@b}@ 0Ho o> y  &H 0o@B 2i Ho o> y    ""H 0Q@B 2K Ho o> y " H 0;@Bq 25 > y ?. #Ho o> ~ ""8H 0@BT  Ho o > x"@j"H 0     `  ``\ ("  `X8 "@ `@ "8 @"" h   @@ '` 'А?'`* '` $`'&   @u`  @  X < @?  @l T'` '`N =`?'܀ ش'Ԁ  ("$ , X$ ,  ' $ , : @a \> ~bH` ' "` X " ,@2 ,  :@E @ H ` ,*r ` t@p'  ! @i7T ? ܑ2  `? U؀ N .@"` 6` M! @nM! k; ,@!   @ T*  ,$'2.$ 0! , @T* $ 0 0@ `2  @k` S  ,̐$ , ,o%$ 0 ,耢 "A:@:@ @̓ :` @  H @#$ , ( '$ , "`@t`@@ёԀ`` }?@$ 0䀢 > ~bH` "` @Ԁ  ,$ (@3@H%В @`$` 0 @ X@ ܖ@  А@ I`*@E$``6 @3А@  "`@ 04&*@ 0  @@@& X@ @ @  @ В @J` $`&`@@ 㿐  `@m `?@ʔ @ '` H @ & '㿘>c#> ~ 9 @KCh> ~> ~"bl"p 㿘> v#> ~"h> ~6` @ bl* @ "  @2 @2  `@3 > ~0 2  㿘> ~ bh3`  > ~ bl* @@> v`#` 2@` 2@ `2``2"`&& " 4 @3    2   " "㿘 >n #    D >ϐ 0@h$  @ x @7  㿘 >n#    D >ϐ P@Lǐ@֐ " @$  @6 :&  㿐  '  6`x6``@     `.  :􀦠< H 26  @`x!6`x @2 `x @6`x  2 `x 6`x  2 `x 6`x  2 `x 6`x  @2 `x 6`x  * @&`|  * @&` `x&`!m6`x&`| @ʯ㿐'􀦠 `@   `*  : 􀦠' H 2! `` =@  @  @`p  ```d&`p&`t @`h  `p`t&`h&`l  `p@ `p`t&`h&`l&``&`d @\㿘 'l '    &`&@H 8X. * "* "`  @a̐* @, : & @a d@a? * @,`,`* :`& *  @a"?. * *" * *" 0*  ``d ,:`*`" *  * "&@&`   * ( Д  㿐 ?/  /  /  / ߒ / ے  //~   ( *  (` (rrr`rrhrrrrprrrrrrrr|rrrrrrrrrrrrrrrrsssssssssssssssssssssssssssssssss (@2 x  *   (@*  |  *   (@*    (@2`"`㿘>@un @5 㿘  `(`$G`0`2 `,6  /,@ ` >Ϩ  ` ! >[#*`   $@ `$@   @j>  H>   x  >@u* `,`,W   @`(&`$2&`0   0`( &`0&` `$" &`$2`  ?&`㿘N >Ϣ `  >\ t*`   >  H>   x   ?>@t `, `(@2*``,2`@  ` ?`(&``$""@&`$2`$`$&`$ `  ?&`㿐`(>``,`$@j͔" N !   !`a`  #\ `( `@`$0`( `( 2@   (  *` (` ( `"`JC  `( x0"`㿘  (  2 "@@`h  @d h  @`` @ h l" `" d  -@ڒ`p.` 2  "@@3`h  @dѐ h  @'`` @ h l" `" d  @`p`@ h l" p" t` ?&` 㿘@P     `( (   `*  *` `( ( ? 02 ?@ ?  0?@ * @(@@ `  `㿘 `? @`@&`!X` ` `*   (* "`  ` *  * * : :`` $ `*  (* "`㿘  2,   `  2% ` 2  >ϒ` @f! 2   2` >ϒa@f  >ϐa@f   `" =&`㿐 `!`' `!a`@ 2`  *`  *` *`L "\`!X  ` )&` `  "`L@L@2 L`L @2 €` 8 ` (`@`: `` .`+ ``# :` B8 2  + ?@Ś   H``@ Ӱ. @  2  €   2 ` '>i''ܔ^X6  !` x`!7'' '''ܐ !@I>i` "LIJ` ?'Đ;`$  7>i'6'''Ĕ') ` "#>&a\a @e      1&a\a @e  2?"'>i'ܐ "? 㿘.     ?.>i#\"  ?* € . 㿐Leג ;) ;Y  А R,`* @ ?Ѐ .@*`@ ;$@    ? +"@ )"@  ! . ; 0 ;   ??? 㿐`\    =. `.X  ;` .F6ttd > v#> > #@ٓ`  >> "#> ~@ًb >@q!08>>ϐ!Ȓa@۔ 0b'@   ?"@׼@0K 0> ""` 2""@"`@ D@נ@    4 p  `<`@{ @  a @'n @&(&&$&&,@ c< "@ڈZ >  b& @~P   `@b @@! @0: @H`<@@2  @0  @Q  `{ Y Z`@@a$ `p Y `@@a{$ aL p@# D0@.㿈  '`< ''   'm @Ր h@ܜ > ~"_ `@  @" T耢   ?@U I0c ?@˚ ('  7 M(?@, > Ha @c  2   " 4 :0 - ''&l '`X>ϒa@b  " >ϒa@b  " >ϐa@bݔ  "  ` 2   @#' c @'? * b> ?   9@-!d@`!d$`P a( P* @ *@ *@ $` "E ` `* * `  *` $aL ` `+  * `@ *@ @ $aP$`2$a`?$`0`%0@&a&`d` `< &`h&`<&`@$`$`$` " l %  ?aL`* ` @h` O- H $aXl l ?&l`0 "`0@×'l  $@` $aT $aTaT #!`֔ "` ` `*  *` * $aL  `*`  * *` $a`$aP0 %0$ @`    @W @R   耢   @!?`@.% 9&a㿘@Ȑ($`D  (`,$`<$`0$`T@cd8$`@@@Ƭ J>`Ha @aΔ  B > c 5? * b ,( (@[z   8@[v *"@"@ !W<  @&&&.6&&&&.&@[6 `0 $`0@ؐ 㿘6` @ a   ?" @ @- @- 9`<*@$`<$a㿘!!(ݐ!T `?@I -㿘! D @ &`&` &`&` &`&`&` `T Z ` Z!Laݔ p&`8  㿐 `` &` x  &@o & F㿘 @ 㿈! &  > ~"x @~  & :@+ @^ >ϒ 4 @)Ș "`$$$  @ל "!2F'6@ @" F>"@`!  @ F>ϐ"8@n-0ْ , ?@Ę  @@>ϐ"`@n0 H @ @ " @ >ϖ "x@n@  F$  @$ 6@$\@Ԑ     @̰0 H    *`  * *` $T  *`  **`  $X  $\"`<T & "'  *  : 'vޒ쀢 " @Ô "x@xx< @>n#X2`  `-" <>` |*` @g -0.> ~"t" 8@Ռ >  $ " a" 8@ּ@U$ 'X:  @ TL@`@ "`@ &  2@ "`\"`㿘!@:`  `0`4&&       `@, `2- ` 2) `$2% `,2! `?2 `2 <`"  < >d(      㿘  `x` /  @`|`   `$ `$ `x /4 `4 `|$ `$ ``$ $`d$ (`h$ ,`l$ 0`p$ 4`t$ 8`$ D`X: < `X .  < 2*   @*:$      $?'''''''''''@g耢 А$ < @+W  $ <$ @`$ `X :< H <$ 㾈   , 6  @V 0  %  @a   @%@8 X @;`b   2 `; { ;  > ˀ "p > "p(* 5 ?;`#\#`@%.@ #*  +` x" `` "   X*@@ +`?#\#`x@ǘ?@&@@%@8 H@>@   X:    `0 "`0@   2j㿘 0"z@"       @ @㿘    @~   㿘``* `  ? 6`#0`@* &#@#D`#H 4"@&#@?#H`?&#D&#H @>V#0 2>#8 㿘"" N" =`?  " !! 2!@^ ""!  # ! 2%.!   # ". "   ?  6"#(!># "  #(>#y" 㿈`#P`  `  @('`  ,!, ,",!, $#0 $#D` 2 / @( $#D$#H $#@`<#(#,@    @)ϒ 0 X#(  @  "#(@#(     H  8#(  @ @ 8 Cm<#( д@ 4q  `!,"  ג$"T* $"#(  B<#(!T """`<,"#(5>ϒbؔ!@` " ` L!  "," 2 !TL! 2!T ,"!` `?!` `#\ ,"!T 2#(#(" #(?`g #,8b#(  !T  ,"ΐ & `` @) #H'"@`" "#8@##8>`` #@@("㿐   `!T " b ?`?2@*@  @  4 `H   ( @ F   $`#$@ @' S    #@( @ΰ 0 @  #  @<@( 0  " $  "" "㿘  @ @ҧ 㿘  @ @ҝ 㿘   @%8 4㿘    ` @%- 4㿘` \<? >@h*" T P@2* T   T@Θ " T 0$ 4($ 0H /d * % @ H 00,?2 T H@Y <$ @ T?2 H /d * % @H 0  >p` $ DH8*` @ 㿘>@i?" 㿘  @$ 4 >d( T     % $ "     㿘` `- @?c *2 *"! "8! !0@ @ @@$ @<`㿘`&a`&a ` &a``  &a`&a$` 2a` a`H  `@ g >@gQ#8@a``@ >p@``>p*`" ``&`* "`$ a$ a $ @xa $ $ $ ``@*`@Ð``* "@` &`*`" ` $ a$ a $ @Za` $ $ $ ``@*`@``>p* "` &`*"@ ` @ "`` a "`"`"`"` "`@㿘`&a`&a `c  2 * &a``  &a`&a$``@ >p@m``>p*`" ``&`* "`$ a$ a $ @a  $ $ $ ``@*`@L``* "@` &`*`" ` $ a$ a $ @a`  $ $ $ a> "t`a  , $@```@ >p@``>p*`" ``&`*"   " " " " " " @㿘`&a&a  &a  &a&a$``@*`@``>p* "@` &`*`"   $ a$ a $ @Ѕa  $ $ $ a'> ːp a  , $@`p``@ >p@``>p*`" ``&`*"   " " " " " " p a *  , &a@>j >j*  > ~b|8"b| >jt㿘@/ 2!@ $!< @SF2  @2  2  2    2  ,   ӄF2+  @2$  >j* 8>j  2  2    2   ,  * 㿘'T?\ &> "t*   " $" &   &> "t*" "@2   '@`'@  `'@9> ˒"p `8 @ "  C@  @ @* @Ȑ >p* "@  & *` " $ $ `$ @`$ @$ $ @"> @* @ >p* "@  & *`Р " $$ $ `$ @>$  @* @ >p* "@  & *` " $ $ `$ @"$ @$ $ "p 8  T @ >p@\ >p*`"  `& *"  &" " " " @" " T"x  #\#`@#d#h#l @ 2`  'T D ''P'L''''@ȏ '`   <   `@L@!   X <  `@@뙒! 2`x  4 2`   w ذ  ,  @#3 2`  > "t.8 @ x"| "  "`@ @@ג @L,@T"!D "@@O;> ːbp .`x8 @ |@ ` `А  'p  " @  @ 'p` @#dp#`#\p@ 2` p#`#d#\p@ "\ p@ bp  *@"@T,@"L"D` @B'h 7'd 3`/ ` `T @'`  " 'lL#\ lhd  h@ l   @ "@L"!$P"`lh 'l`@à @` @ @# lT@Ͳ"x`  ` 3' /    2 a`H " ,`@  >@c@# ,  @",a ސ?&a&a /, >j  2*#ːaq Ð>j2   >j!&a4 . 0`?'>ϖȐ @  (   >j! ,  : " >j!,  ` @ ``2,. 0, SO,  ??'''䀣 C >j"$+  a `#\<䀊  a?&a(&aa  " &a &a" &a",a ?&a&a a  " &a &a" &a , , O   @!l$  @!g $&a@&aD$ *$ ,$ $$ &a8&a@&a$ @"@a@@" @` Pa@aD`'C a8  @"j @"g @`00@ & '  ''  '> "p'   ''''   ''''a<'''P @@"8 @"5    㿘,,   @ aD < ,.0 &. d! @   @ Ɣ a &  `@2 `@U`  `0 .2  * `@! @!ݒ 㿐` 4 a(?`? *a` &>ϒc@XӔ  2, `  @8  @ L  2` ,  @ J@ 2`*@ @*L      J@ "` "` L %  J@    2`J@ "a*@`J@ "` "`J@ " a `J@ *@a` , ` ``@ސ`!@f @Ȕ  ",`a( ">@a#@ sa0 a(  &a(2` >o d"`" (2 `, ?"`,`0?"`0`, "`@C|`0` "` ?" a(  &a(@  ? @ڐ@Xk$  ? @͐$@X] ?$@Ô $a(  >@$   >@` ( a0P @bV$$&` @ 2"`a(  &a(`@@ @ ג a(&a, a&a(`h2`a" d0 a-" " 4a(   &a( ?&a(a0@ 2 ``@@’ `  4@   @  ?  @  ?@/`㿘  >@`^  , >>>А `@`D `, " &  ?@>* , " *  @ @ p ?& 㿘  :    " @   `  & @ R ? && 㿘` @ "  `   2 >@` !  $ € ```"``㿐`> + "t` 2& ` 2"  "`  @m  2` A#@`  #`` #\@`  `@㿀` 0> ˢ"p``c*&`#\`?`   * #`` @? 2'  #`#\` @ #d`  `#h`@#l 2` 2` ` `@  8  @ă @ 㿐`> ˒bp`A`#*&```   * #``#\ ?@?  㿘<&a>&a> "t 4 * &a ``@*```>p* "c` &`*"@ @ aa a" " "`a"`"`"` "`"```@*`ǐ`` * "` &`*"@ a @ "`a a" "`"`"`"` "` 㿀>  > v@F"#@H@l>>ВaP@`r"@5@M@<@Y@@J@5M@#@@@xI> 88`$``"` "8$` > "H$a$> 0@ $`8@`8"`<0"$`<> @ #"H@" " > ""P$`D$`@> ~"  #">j"bl  $`,$`>,`1,aa"T >c`p@F>`l@F`> ~"$`@(k" `"@`@, 2 > ~"$`$@-2@ o > b`$`$` b`+ ?@8  :>c# @ @< @4$!> ˠ"p   :+    P <<`8   !> $> Ԙ  @ȉa>c"ܠ  $` $a,$` @"ǐ @A@@S@@ c>i `    $ @  2 H /f* '@ @@H 0@>>m"8@3D >j!h @ > >@^"   "<  €# "`>@]"8#"``@4 # @抔`@," > #(> #(  > "#4#4"`#4``> ""b@b@" # #`#`#`>s``$`$`#\   @P ">P>@]"P>А <` @- ">s>@]"p>А"t‒ @! ">s>@]">А"\☒ @ ">s>@]">А"DⰒ @  ">P>@]">А!\Ȓ @ >@]"@?@@Ky@>  @"bP>А# @ '''''@y  `>>@^ΐ#(0@^ː#P0@`> ~""'+> bp> "@ '#`#\Ԗ ?@? " >@]@#p>j"aQa> ~"  -/Ԁbpآ@ِ s/ْڦ  *@`"@  $@  'b'@T $@'В W?''АВP ̠?I ?ȒD Ȕ'''@蔒 >А#@^Z 2> ~>@^R#>@\#ȁ㿘> v@#㿘> v@#㿘@P@& J@  '''''ܐ@- ;@V <    @@ , #> b > > " > @? #b  > "@@֒ > ""$b@ @$b 2  $b@’ @> "  ` $ @)0$#?: Ȕ@() @7@7`'H /i * * > c(Ԓc("'`" `'А"@@?''H 0 @a7Ж ̐"?' '?/!''>c#l8>c#p@H" 7``` @Hߐ 7`0 `,@5 7`'` ,` '$  "? l?' ? /@m  #`#\#d#h#l  ( @' @($㿘@QKa . c   6  `  # (.` 6 `.` @.`6 㿘> ##   >t>А#`@ #> b`"!> `< 2 `X  ?@͖ O$b P >l\"@Q dd@1b> >"$b$c"`$> `< 2 `X  ?@੖ +$" P >l\"@Pޒ dd@ ">$b$"`@[ >c"#@ >c#l>lkؖ> >А# (@< #> 㿘 > > "!d@"ah> # `> >c#l ""@H> "c@㿘> v#쀤`)>  @` >c  >c#p@B( 2 @+  >c  >c#p@B > @+ > # > @0> > #H0>c`#p "0> l> c "l" "l > Ѐ> !̐" "И > c(Д b?" ?/!"c( #c(> c4 "?/!"c4 #c4@B >c"$> ϐ *b ޒ 0 㿘H > #(#( "@  "H 0   А"@? &- (c (c& >c, "@*`" * * >ccp?@O  #l%@G>4 >ccp?@Oܐ   #㿘  &- (c`(c& >c. "@*`" * * >ccp?@O  #l%@G4 L>ccp@O   #㿘 , (> #< `& ,`!"#<> # H /m * . > #@> > > #"ad@)"hH 0㿘 , &> #< ߒ& ,`"#<>  H /m * .   > > "ad@"hH 0㿘 @#> > v# , ah @^̐> ah? S"ah L!`B < > c` 1"`> c ,"cah? <"ah > v>S" c쀤 >  ؒ`B < > c`  "`  >  В`B < Д "> c` "`> !d > "!h d> cD ` $ d> a`  "a`@= 㿀>c>c#l>ccp> > 't'#' `' ' @3 <@0؝㿐!>m"> >ѐ `H#\ 8  @P > >#\#L`P!$  @P > " :  ( ("(   6 *  ? * "? @*`2,  㿐@ 2 0(  $ 0(@Z @$  0 ,?`$ 0@;B 0 @@`ݐ@٘@V㿐`@    ` B ` >>c#@ @7 2 0&2  $ 0(@@@ה  0 ,?`$ 0@: 0 @[@Ő@">@Xe @@x@ @` ` 2 0p  $ 0`` a>w ̓*` ` `` T ` (Q 0>c#@J (@@ܰ   @  0 ,?`$ 0@: 0@Đ 2  0ܐ@2  ,?`$ 0@: 0@0#   &`   @ *@ @ ? *@ * :` ?* :  ` & #  34 ` ̒@ 4   `'ؐb~؟ 2 0  `@' b}ذ ߒb~  ?4 '  ؟ 0T 2  ( <& `wذ &T  ` ("`<` "`@` "`D  @[ 2!$  &`   `v` PT  ` (  2 0W W䀒@耢 6 薠 ` ? @ b  @ B ?W "%   h 0 d 0  "`,`%`,   `,`%`,   @@CT =  (`[  26 0W W䀒@耢 6 薠 ` ? @ b  @ B ?W      @˘ @ 2  0`.   0 ,?`$ 0@9_ 0㿘` #@  `0`,?`&`0@9N`0F . `"" `0 $`0"   @ ?*@`  &` `0`,?`&`0@92`0`> +   +@@"   ?2   3 * +@@"  4$ ` ' ,@ @x 㿘.`"  @>`&  * ?2   2*`  * *#  `  * *"  @>@V` XC& 㿘 .` `2`09  $`0"  * @>`$  * ?2   2*`  * *#  `  * *"  @>@V) X2 , $  ,@@ 2@ 㿘 @   (@@0 8` @ 2 0!  $ 0   0 ,?`$ 0@8e 0  @ 2'` `㿘 @ 2 0"  $ 0T "`  -`   "& @ރ ( - 0 ,?`$ 0@8- 0㿘  >c c@8@ @&: <`   <`  , "@ ?2 ?2,  2``  ?, ?2,   , ?8??O `-   <  , "@ ?2 ?2,   , ?8?-  .`@@6$<`+  ` +@@"  ?2 3 * +@@" @4$ @$$ &   㿘  1 2* -` ' @* -` "@@F@F%@ `@  '` :`: ` :`: @7 ,` '@А,` ' @ʐ >  > . p@FȒ$ >  ?. c@F$@ :  :  $ $@ '@ '$$$$$㿐   2v> >c#@0  @;`&  *?2   2*`  * *#   ` * *" @>@Tq X>ђ S& >@T` = `">  @L| @FZ 8 $ , `" > @ $@" "@ $ ``耢 $`" "`$   `@* "@$  $ @ "@&@& 0 $ 0 㿘>  @L@#L@F!$     @^$` $` @X@`(>j!f`< ` ``?4`&4`$$@$`$`$`$`$`,$` $` &0& 㿘 >  @L #L <  " @* " @$  `6 & < &&   @: `c*`@4`,` '@ ,` & &`< :   '  &  &  @, & ,  '@ & & ,`IE < < , > , :  ,?  @ "  R 2  `@ ?& ,& 0& 8& 4  @` ` # "`  `@ 㿘  &?* `F4 & @`" `0 "`0$@ @9`&    @o '  :  :  $   @d ' @a '  " @ " 0@ 0 " 8@O  8 "> @I > #L@Lܒ㿀 ` " ,`, " ,V 2 , (   ??77 @И @ , 0 0@5n& 0^  ? &  0?& 0T 6 0>@Rܐ ` & ,>є 0  @3  0 > /*  @2  (   ??77 @ۓ    € `"  "` "@@w  `> 0 "> > 0@R `> "`@LX 㿀` @ 2R 6 3 -(  ?7  ? 7?А*@2     7 27   2   @3     @+ 0? 0 "\ 㿘P   7 2R " y #@2r .`"@ >` @+ *@ ` "    +@  "   ?2   3 * +@@"  @4O& N . .`" >` @+`*@`"   * (   "   ?2   3`* `(@"  @4&  >&  * ?2   2*`  (*"   ( * "  >@Q X2 &  㿘   @   R `@$ 㿘 @ (@% @@;  : `@@0 㿐!>m"> >ѐ `#\   @Hi > >ѐ! @#\`ؔ  @H_ >  "b㿘`4 €`4(R`  >l"`8 "`  4(2  2  4 ("  㿘@  > v' #  `  ,!  @֒ "    & 4 6 ?Ȓ*  0 & & 6 !& $!  ( 42  2 㿀<@ ,    &  @  (  `  6 & (# @2  ,   ? .@  $ '77'''@Ĕ   &  @ "  㿐> "  ) . 2` 2` >lb">  @H @B && " (& , &$ ,& `, ?"`,`0?"`0`,  @2`0 㿈`@ p T` "`00j $`0`    2X`0&`` B`( ' ' * `* B쀦#    o4 @A ` 04 $ ` x `  ``?&` &` *`` `* "  &` &`   &``` @'&`0`,?`$`0@2`0㿘V` `   `  ` 8 >l#(*` 2  "1`4@ 20  $0  $ @`,K*`0@ G 2V`T @>  : 2V`T @2/ `, @2 `8* @ " 2  2 *T :     2 2V`T @2 `   R 2-`> !@G  2$  $ 4 $ 80,?`$0@10`$ ,`  $ 0&`&`  @}@   .$ ,` $ 0`$ $Ho o 8   €   (  $ (@ϐH 0` " ` 8`@@7 "` ( 2`Ho o (  $ (H 0`  ( Ho o (  ?`$ (@H 0ܒP (  B#@;'`' D?@5̐  H o)*@j> #(#( @ В@ "?'@'?/!@'' H 0` ''   `  ʀ` H/` /``" 6`  #>ѐ $`!@/R H 0 Ҁ? # " '`'`"$``@ ` "` $`   "@H 0@0{ (  ?   8` €   ( ?$ (`?$` Ɣ    ( ?$ (`?$`H 0 8`@ @oH/` / " $  ($ ?$ ($ `?$`` $ `"$`H 0,, ) H/` / ~`"` $`"@H 0` ,*%'@   㿘 ( H /f * ' `A    @aT   $ H 0㿘 (@? `   :6`>`0&`@ 㿘`  ,& ( 0,@ @ @ 4`0 "`0 8 @ 4V> !@G*$`2  ,& 0 4 "?   8,@ @ @  8`@> !@G$`2  4 * 8>  @F& ( 㿘   ?& @/   ?& @` @ 㿘  8` € "   (  & (@  2 8㿘 @`@ @S@ 2 8㿘 .``0@㿘 8 `4 2   @  @!`4$`8 `42  %`8`,  ! (!  @ , `,`0[*`,$* @@>*``0 "$`,@ ޒ $`,$`0 `0* @@&&@& (㿘 8  042  8* @@2@2@@"@ ( " 8@? 8  >  4`0 "`0 4c> !@F7㿘 H/` / ( " & >>>ѐ `@@LH# & "" ( & ( "H 0  㿘 H/` / ( 2  >>>ѐ `h@L#` "` "  "@ ( ?& (?"H 0 ``( `"`(2```2`(x`(D$($$@  &a <``  @@1a 24 X <  "a` 32`@@  @ 24a  I 2y @@ܒ  2r4 @\#\#` ` #d` #h#l@ 2R)>j` !" &` @ ' >j  ,` € a4 8 " ` 2a( a(  8!`@ >j >a$@8 a @@  a   $   "` @З4@  04@  @㽀!> ~,  $,@''h"| ?'''l@ ''"|h'''''' '''Ȓ>j!l'''ؐ .5> <@ 2>@K!   @ @J@,`J@   @@@ - ?`@  `@ $ ?ؐ ?'``ٰ  2` ?Ζ ! ?``?%'   2`` ?  ?" 0``?%'   #>lc@  ? "c@* " b@` ` *   "  ?Ѐ@'y 'А @>>  bp& `` 2 & & `` 2 & `` 2 & & Ȁ 2>@Jc!G ''>`$"  w=c  qZ@ @8 'ؒ?,>c 4>@ @m, `$,$ H@,$,@`2,`2 ,` 2,`",, *@$, , "l,@ f,! $,@ѐ"@ ($"` $ "`'쀢 A'쀤`  )耢 耢>@IȐ!@@䀢 @䀢 Ҁ `H "`H 2 >o2`  d"`"`(`, ?"`,`0?"`0`, "`@,`0``$, >$,@ "`@ "`, ( "@  耢 "@ @  @<@@ ?@ƒ ,*@$, 㿈`` ''  2U !4,  * * @  @'&@'Ԕ  -}쀢 6  @ ?' '  ? &`   Z쀢  ?  '   㿈`4`0" `< /  @@&`<> ˢ"p%>t `c H `<* '#`#\ @| " `0>@I!`<@ 0)` *  @@  @ܐ&!(@`<> "t *  a`< #`!(#\@T > @Ij"`<@t 㿘@@*` 㿘 4 'H>`>ѐ"P`@G  , "> >  @?  , &!@& ,  H@*S& ,?&! @/& m!$ `2"!$` "&`` `|2``x  @P @j` ` " &`@u ` "&`@c&`&`!$@ [ # . 1 8`" < <"`< < 8"@ ` "`   "> DD & D "` "D&  T`> ~@)"`"`L@i`,( 7&`,@\ 2> ~J H6!< !@!@`@+  !@@`H!& hC  ,@> ~ H ,  > ~" H@;`T 2 ,@)Ð ,@@  ((@  @! H@) H ,@@@)@ǐ > v@"c &  H`@@/㿘> @@ & 8@ 8"`<"@& <@) 㿘> c@>ѐc@p   @'>  8`" < <"`< < 8"@@ ,     H@, 1@)c H> @> 㿐@ 2`!$  &@`?" T    ,2 L@" ` 4  !$  2 L`B ( " L L 12L 1 ( 2 LL 1 E  4&``  !<'ސ 2` `"  X!@Ԕ H 2} X " `@ S $ X@s ( B ,@  @c@(b  ` $ `@ 8 & `4!< !@@ H @s0P 2` , 2`( "` 4$ ,&``  !<*  '4/   ,@*@ 4$ ,&`` ?#'s   L 2_ , 2` 2&>єx!  @& "I T  H > ~@2 L " ( L P P P L `T" L`T L P"`T`T" P" H㿘!@> @? @ l `"  "`   "@ L`" P P"`P P L"@  @ M? `?  "` @>  @?  "> @{> "d@?>lcD?"cD㿐#`#\    @7 㿐#`#\    @+ 㿐@` @ @ "  $@ ` `@   `@2@` 2#`#\   @ 㿐>c##>l  cD\ ` 2>   > >l!p@,cH >@ES" #$cD@ ϒ  :   p  >t t >t@ ?cD #>t! @  > @ ?cD ?$cD @=K"d , 1$ ( X $ @7#$!!Ĕ (>c p@-> `l@, $ , $  , " , ,! , @ $ ,>  @= $     "` @ "@ $ @5 Đ $ $ $  ` "$ @ $ ` "`!$     ,  , $ ," @ , $ , @ $ @ @ @"`D& @ @$ D@$ H , $ , T $ L T L"`P& T T$ P$ T `$ `@) @$ $  D€   &  , @   >@   <>@ 6 `$!,>"` #\#\@6 > bb "b   @(" >  "   @"  "   @ ">   "    @"> "3> bnb@:Ic $@@wb > b$ 4> 88 $ 8 "` "8$ > 4>  4#0 @*` $ 8  8"`<4 4#0 * "@ 4 * @$ #(  #("  "4!>, 1@H 0 > ː?bp& ` "`` "`!` "` 4  " 4  ,  @$  , > 4 %@%`㿘@y 2 @ 2 > #D`" `4"  a$ 2` `2`4 㿈#`> 'T'X#\  "   @H ,"& ,! @E#T2& 㿘  > v#`4>ѐ"@D̒a> v#l. 㿘  @G  2>@CP"@5K $ $ $>l#P "@" 㿘#>l#P`"#P" @ @f cP 26|9$777<:;㿘@5! 'p?& & 6 & & &P  2 㿘 ?4  @@ p  `>@B#`> >@B#( *@& `  &   !@!@2`>@Bݐ#X`>!*`  +   @  2 M @  `&    *` @#:` & 逎 e  & 0`  &  >  >@B#x  *`:` & 6  ?* & & 0 @  ?& 0; >  >@Bx# ?&   @2'   4#   2   &    `&    *` @#.:` &   M *@&    & &   " >@B4#   @$  @٠ >@B#  6 0р  @ʠ   " 02 M @  `&    *` @"֓:` & 逎   & 02 M   @ `&    *` @":` & 倎  *@&    & &   "q >@A#   @>>  @A0 ?6    * & ?& 0   > ?& 0@A H J@$0F >@A p @9   5 1 @    &    *` :`@"C 5 24 M @     & &  6 0>Ґ @AH  @" 0@2  2  2   *@& @# 㿘 > @B    @>  V @B  `>@B~!㿈/> p*`" @h>@A!` ` `5 3 `@0 . ba) ' d$ "  @@0@  @  @@@   @  ,`"@> *` `@H /f * '  *   2Xp* @% p @, p>lcX< L, @ 2> >@@!H 0 #0> &: 4* @2@p*`2"@%   @7o"" 7o@2`"@# "`  "%  % * 2` >l#d:` >>Ӕ">#`#d"bP:bp@Af&>Ӥ" C#>lcX  &>  @!  > v#`" 2 &cX` @ cX` > v# `  ?>#`>>Ӑ"bPbp#\ @Ab%?"    6 7o"" 7o  7o"@ 2#\ *&H 0㿘> #0 >  X > >l#d.` >Ӑ"@?bp & > c4: * R@@*" > * ``  * H /f * ' bp A>Ӏh!`b` `@`3 1 / - da( $& $ ," ( @@40@ 4 0@ < 8@4@@ D @@ L HP!*`  bp>l#d.` >Ӑ"@?Q* bp`>l#X@ * H 0067o"@   2  >Ӑ#@@>@?+#0  4   7o""@`@ 7o6  2"" & "H 0>lc\> & > x8: 4&"c\㿈%>t > "p#>l H'> c\ '> ax#\  @>l"cX> > c\"0# X *`@ڔ $4`` \  " `"2 `` -0` ->l` > "`%> @0   @ >Ӗ "@*@@5@5  @`,@> Ⰰ(( "  @ 4> > G!@E!x4> > @!>! $!4> > 6" 4"X4> > /"-"Ȁ4 04> > ##84> > #p# @4> >  #  4> >  P Ք 8''@ɘ 8a%>m U>m)> !   S '>ld. @  @4@ ``  @0$  d. @w$@>Ӛ@#>Ӗ# @?  @4ِ @`@*? !>m!J@ 2  _*@ >m! ǔ >m!@+> ˆpp((6*   . ,  @) ' @"!"" !$($    @(0㿘0# @5 > v &㿘0@'   &㿘  "@&@< 㿘"`@1"㿘`>@=G#   $ ? ?  >@=4#>Ӑ& @ 㿘`>@=#@㿘> v#쀠`?  @H /d * %  `0  &`0>Ԕ  @ј `0 `0 &`0H 0&`D&`4&`,&`p `@,  &`0`*2 @ &`T`&`<@&`H`<6@>@<Ő $>@< 0  $, @ِ  `H@V `0&`4(&`0-@$W@H /d * % P  @k `0">`0 &`0H 0@$w`H@6?$`0("`<`4 " `<`@@@>@@  @45!@. t!P#!& 㿘 \ @* 0 @"> >@< !@5ǒ <@4" <㿐> "#8> "#D> "#@> !>c#`"#<`:`>  ) @4#> "c0:>  ) @#> "a:>  )`@ > "a!>m"> >#\"d`!H  @2 > >#\ `Ȓ H  @2 > >Ԑ `#\ P  @2 > >Ԑ#H`#\   @2 > >Ԑ!` 0   @2#\> >#\ `   @2y 㿘> "`> a @* @@! 2   +" 6>@;h!`""`"@  )  > @;S! )A  "" $""" > v2 H 쀢2 4 > 4> @0( "   4  8 2 4 > > @ᬅ( "     2  㿘 "!$>@:!0!$`  `>@:!XO@  4>@:! > e #H@2 >  @2! $$ $ $ !$   p  ,> vc ?& ,  $` >@:Ð!!$ $` @ "@$`$`> > !@*  $@ " !@* @"@$`$`"% @Y !$@U  @` D"`D D @"!$` 2&!$@# &!$` & @` @"`D`$`& D 㿘 @` D"`D D @"!$` 2&!$@ &!$ 㿘  `"`x""`x`"  "` "@ @? "@>  @4!> #H@4㿘 H!$@` ` 2 T` &`? &`@% T !$@" L` 2 L 1?  ` "`? "`@  L 2!$㿘  N 1 2 @`@  @   @ 0 2N 1㿈 1  *`>Ԕ :@;   4*`:`>Ԑ!ؒ  4> ,>Ԓ!bPƀ"(!>!#ƀN!> #( ƀ !,> ƀ#P h@/D d h@/ޒ d `> d ƀp > ؐ##\   ȟƀ ́ 4 " H4 "!$ "㿘@`4@"$] 2!$  $ `  $  &㿘@`4@"$A " !$$ `   $     4&   "  " , ""    "  "㿘@`  R &R @:`   o.  2& 㿘!$ 4  "  " 4    4 &㿘` @A  4"a$ʐ "5  2a$. !$ ` 2( `,@"a$! a$   2`4`4 " !$`  @  㿘@ ` ` `   `     `"㿘@`?` ? @ ?"n  @?h      @& 2S @ @  @ @ 2=? @? @? @ @ ?&?   ? &  `@@  &" ", @2& , !$,㿘@ ` ` `  S ` K   D `"㿘@`?` ? @ ?"[  @?U      @| 2@ @ @  @ @f 2*? @? @? @ @Q ??2& @o&" 2& , !$,㿈`@ ''` @2' `@ 2 '? ?'?'o㿈`@ ''`@2' `@ 2 '? ?'?'㿘`@`   @ 2 / @" @" `@@Ԓ  @@ʒ 2 @"$ ? $ $ @ $" `,!$`,㿘`@ 2  @"  @@  @ð $" `,!$`,㿘`@`   @ 2 & @" @" `@@r  @@h 2$ $ @ $" `,!$`,㿘`@ 2  @"  @@E  @j $" `,!$`,㿘`@2 2@  @R&``,  22 `, !$`,R` `(@ :    *  2  `2 !>2!>  @ 㿘>  @.Q @(/ P &㿘@? "@> @/ 㿘   P &㿘ՠ P &㿘`  &`!$ ` >@㿘   !$  @֒` ?"  ,2  &  㿘@  )  "`M "'`I    2:N!9 )` !$ . )  * )N!& @ 2N! ) >   &`> #8  )  `@2 N!&  2  ) )?&  㿘@    "`R "-`N  7 A`@D; ` !$; 1`  -``@. @ `"` >   &`> #8 `  `@2  `@`  2 `` 㿘 @ `` ` @ 4 &?Na6 .a  .a@ 㿈`.  @@㿘`(  .`  2 @   2   @ z " z ` ``  `"`@u & `>m` `` >m ! !>c#>c#: ? 8 >2  (>@8  ` @`>`2-  @" 8 2   @( >   >  # "> "t8  @  @Q  << 㿘@  *  `  㿘H o4+@n   ȑH 0 @D@B 2 > %%&&&&# 4`>c#l, @,`b2*@ *@ b 2`* @ *`B2*@ 8*@( Д @(@&Д @@'6`.  .`@c3`+ +` b 2**@C3`+ +`&  @' Д @'@%А @'ǖ@)%5`- @-`b2*@ *@ b 2`* @ *`B2*@ *@'Ŗ Д @'@&А @'@&㿘@ `   M `  H` H@Д""?`"?/""`" ` " ?/"" `&"  `@"` 㿐!> "0 > >mb#\>Ԑ!cВ   @*  $"0>  @+E!Ɣ  $ $ 㿘`? "`> @,ݐ!vvvwpwpwpwpwpwpvwpwpwpwpvvwpvvwpwpvvwpwpwpwpwpwpwpvv@ A ?2 ,!$$ 9 ,2>*`@(  "$ @ 0`@  @"    "  @   㿐>mb> >#\"|`!4  @)v 㿘>  @*"| $!4 $!0 $"`$ $0 0㿘 $!0 @& $㿘 $a0? "a0> & $@, "|㿈@   $` ` `2`Y ` F,` '@ $ $  *@ 2$  2  $  "   $  `  @$ 2  , " ,  $  ,@"   $   2   $  `* $ F 2`  7 "@   $( H*`"2 ( "?`  ," , 4" , 2 ,2 , ,(" , ( "@  ( "  ( " ( " >m2! 8 `" ! "!!  !8 "!!  "! H >m*`  `(!"!``>m㿘!   $!  * 8 >m*&! !  " ! &! & $@ ! 2!  $a $a$a$a ,*@& ,`P "$`P " H   "` "` ? "`("?"H    "㿘 $?!b! $!$!@ &!>Ք!( @ >Ձ 㿈 $! 2`!  $! ``"@!'!'!  ' *@ $    !  ! ?$!#@  ! $!$!$!$!  㿈 $! 2`!  $! ``!Ĕ +@ '  "  !  ! ?$!$! #@ !!`$!   㿘`` . @ 2`# ` 2` ` @ `    @㿘 $ > #8L4 $,"2' `@24/ " !$ 2 (  !4 $@,"2@  ` 1? @@24  㿘 I)  B  >   "  "   2 @@ @ 倦0`    "  "   @e㿘  R @ 㿘    , @F @ 㿐 ,  $* /! ",$(!2($( .``< "`< ' !! &!`! * &! >m! " $!&!$$(@㿘 ( ,>@/  @!@ >m!.`  , h* !! !   N!  .! !$     *@& 욊   , * *& & , 쀤` & 쀣 qN 1 mH/` /N 1  $> vK# , T(P `"6 쀣`D`2C! F 6!<* H& `,   @07 ,4` +    H@& ,`` *& "! l  . 1`" l *& 쀢 @t0 >   "b<! 2 2.!@H 0㿘!  ,*@ *   ?*  !*@ $  ,("! , ((26 $4!@. (  @r@H 0 ,("!!< "!? !*@ 2! * $  $.  >m!  = F  4`>Ր @@/U!+ ,(2!!$  2 H2! H4!<`,   @(H /m* .@ H 0n!2l!  2h! ,(2d!>@/ `_! $ 㿘 ,*   H. 1@"& ,㿐> v#쀦  $>@- p ?*  8 # . a$ @a( @Z0E>!>@-y xH/` /a  ?a#a!`! #!a !  #! >m! "#@!#!#@H 0 `< "`<a$"#a(' `  㿘 4>Ր @-i` 4>Ր @.4 㿘 ,!>  6!>>m& ,a.`@  $@ "a$ "`!㾈, a ,!>m"4 ݰ />  Ȓp ` *   @: @ ̰  D Ր`8$` >$` @.n '''''ܐ#@:! 0P@ <  T?@*@2 @  ?h @/@>,4>c<!H,@.dH' @$ $p'a$' a('$'(` *', Ė+'0 `+ + @'4 H -( ('(( #\;`#h#l  И 0 @ .`> ȑ* 0"#`(` * 4 #\#d#h#l @H  #`#\#d#h#l   @ @ɐ @f "㿘  N㿘@ &&  & ` >"*` & &  > v 2 " 4"    42  2 @*@   "  @ 㿘  >@+ː   `> v#쀤`>@+ U Q` `?&?&8  "'@ "@D  2@@۔Д "@0# 2@@ܔ @&@`@"$`$@@"B &>` 2㿐` 2`>@+` ``4@>@+Y!  2` &`&@  "  /   0*  `?$ $```B >`&`㿘 >@+'!  , *, ,     @?*``@ &?&㿘    2&  `&  && " $  &" $ & $㿘 2 2@>@*!8``"`& `@"@ 㿘`  @  2 0` "`&  " @ `  2㿘  闔  2&  & >mH & H&""`"H㿘>mHH@@2@`2>@*!` "H>mH@ "` H@"@ꤒ 㿘H/` / #>mbH  €  bH2 0 #>mbH€ bH2 H 0 4L@p(dppX0`P0DdXlH$8L`t4Lth,D\p< X`l㿘> >Ր!x!$  > >Ր P!$ w > >Ր!Ȓ!$ o X`   'Đ= x` s @*Ȱ lȒ?`  > *` >` ! > >> > ">@ #>> > H -`   ?`  %> x 8 3`@x  x ( 0$`#\``ğ``` @xې> !x   ` `U 㿀`\?`4>!*`  ?`A> *` >C8>C@Ða>CH>C@4>cz#>cs#>cl#> 7 > 4 h> 1!/> )#!>  L'@ d b L`?6   `4 T  P$ L>  x@! E B> @" H> #H@! 5 2> 0"!!> !'@ژ#$!> @ @h@5  @@> "a     >n">n">o \> x_"5p>m"4e ` [ V > "耢 a@  G> "耢 a@"    #\q>  > P> ␘ @6Z @RHQ>c#>m"d>l#D@B @%ږ;!>l#@'@찒 /쀢``2)  % #@$$#@0 >m"@ @  @ -㿐` \` ` >"*` > <> ΐ6e _> > "bxV* > ˔p > "" * L> "pG @ i>m"P>Ւ@FY @  S> " >m* + bT#@o+ D> "  @^7> !`2 -@ -@M%!>  p   -1>m"X @"X 2"X d  d&"X"X &&"X p@"X -㿘  @     `&@|  | 㿘'P` @     `&@P| 㿘 @ *  \ -㿘  @     `&@|d  |U 㿐''` @     `&@|@ 㿐@#\㿐 #\@㿘\@Ɛ `  @@  `,  `% ` "&@@   ?*?@{@@*&@{  {/㿘@   @     &@{В㿘  @ ` `&@{ {㿘` @   ` &@{㿘@  >   ` *`" *  (&@`!> "&@ {y   &&@   `7{f 8   8&&@   ` `2    2       `2  `&   <   > #8e a 0>"-   4!$ !$   "P  4 , "J !$  "D  l   2:   ,"24 H @c @Az!H 1!Hz" +#ت|(@H"HzВ %@  2N 1 > #D  $ &  #8& 㿘&@!$``  &`|  ` @{ PN 1  1 8  &a(&a0&a4&a8aP@I &b,   &  , @tc@T&a( aP&a0 Ĕ &a4 &a8{  &b, ?&  H "&b0 4&b0!$ &b4!$ 6b8 , ?` `?`l&b<`x " #&b@`|&bD&b<` @ &b\!$  2 `&b\ `bH>Ւ!ؐ @ `.bO`6bT&bP6bX6bVb`@ .b  @b.b    P>b㿈@Ғ"H >  >   >( >0  >8$ >@$  >H>P@ >X&`(&d,&h4&lH "&p 4&p$   "&t 4&t$? &|&x@ @`&`&@`&` &`&0`&4@{` 6$ 6, ?$  `?`l&`x ? &|`| >P&`8& &&d&h&>>>  >&& &$&( &,1.0.3<64>66@8@ $``  @`N1 1 8 &&&/&@2& & & & > >, >1.0&&&&.1.2`P@{ l >X$   "$` &`$  2` &` "1 P>@1?   > >  &, 2@r`&ؔ &&&&& 8>;>;>;> ;>$;> (: > ,: > 0: > 4: > 8: > <: > @: > D: > P Hb? ' T L '?/!''& &$?&X` `(    ߰ - ڰ  1? ԰ ,b@Ͱ @ɰ  9>   ""p =  ?c?'''''''' @sc      &?"p*  ,``*` 'l&x!  v   ?''''''''ܬ @s  a "T"p  '"p "  ?''''''' @s F L " `@:L 2` +wה ,@@&'',wŔ   & '``@   'w @V ᑒ 㿘/> P  L ->  m#> b    (@1 )>m"P m +>mbT "> f > "  * * "  * %bT%"P%bT  b*%"P 5  >"Pa ($>Ֆ!@" "P@bT@@ (@  0$  8<  @<  H< ( P< 0 X< 8 `$ @ d$ D h$ H l$ L p$ P t$ T ФX`>m"P@*?-% *> " "'P >m"T  (@[ 0$  8<  @<  H< ( P< 0 X< 8 `$ @ d$ D h$ H l$ L p$ P t$ T ߢ`XP ݨ  㿘>c>ccl#0"@ :`" 9  5 64 #0 -0)>c& - , @  "@f >cc/  ? ͔  㿘` >m"\>m "`2 P㿐` `3 >j! ؐ,`>j' ! @4# `>j! *`     0`8 `' `&`8 8π8xD88㿘#> b4>a@!> "L>@b@b4@."L㿘> v#쀢" H /m4* . "  "H 0  > >c> w"b<#l @ "@㿘> > #c * > # > >>>Ր!a@@ #8 a 1 ?` $   $ >m"dy h 2 `I$ hH /m * . d h  d d* *  @ * @$ h `$ dy@($ `@ !`1> v#쀤" !L 1 2 ! , 2` !2 @" !@؈ !@j,!0 !,!H 0  2 1@> @ϐ!>c#l@5㿘> #*  *  `& ``&  yX@( "& ` ? & & `@㿘> v#aH/` />c"؀ > > # > "TH 0 H 0  >L 1 >  >@"H>  #> !$ ,!$ l$ @ @ "@ ""$ p@Ȓ`"  ,  ` $ ,(!@ y   l  @̐ , 1 2     , 1`@ @}"`@ !> *!đH 0 , d$ , {  $ ,) #`@ p` 2 $ 쀢`"   ,(!@ 5 "   $?! *  ? 㿘H/` / l N 1 @ ,@j ,$& ,H 0㿘> v#쀦` >Ր"P@>@H"H/` />c"؀ > > # > "TH 0 H 000 >L 1 >  >@": #> !,!$ l$ $ @ @ "@  "#   , 1$`@ @"`@ !> *!đH 0H l8> ̄ 2 `""`" lH 㿘H/` /> > c!̢@7 > 1? >@" l2($ l"@`$`L 1 2@ ( ,[ , , 1` $ @֣ > w> "b<"> @ `@ 2 H 0㿘?㿘> v#H /m * . !@s,! `@ @."`@H 0㿘> v #>@T"H /m * . !@O,! `D @ "`DH 0㿐> v#>m" >Ւb@# @D> ` #"`'" `'А"@@''`b? $`` $`?/!$`$```: @ (2   8#`    Ԓ `В  @8 2 `  @(``B <`> ː ?$`p`se"> @ސ  > w*" 㿘H/` /N 1`>!*` >@" ,( !<  * @&  , `. 1@ՖH 0 ( ,: , & >  0 > ! !Ā@ > w> "b<"J! ( ` @8 *!> Ā > w>  <"!㿘 ` $ @8& `! 1!.!㿐 >Ր# >  L > ((`  0 ( (>Ւ"@ #H@ 0PH /i * * > (("  ' "@`'А"@@''"( # > К"?@@@ "@ # ?/!`"@# > @ " # ?/!`"# H 0@װ 㿈@   0*@ސH /i4 * * > #4#4 ''H 0 *`" * `*''q 㿈M 2`qД  @``#@^''@ 0  㿐@  2 >c#l'@D"'``q p@q  #@-'Р'@N  ` H /i * * > #4#4 ''H 0  $ > >Ր"dx!  ?"  #" ` PH /i * * > #4#4 ''ܑH 0 "@'ܒ" `'А"@@''"@'"'А"@''Ѐ ''Ԑ*`" * `*''q  㿐@   @ܐ@q   ``>c#xp 㿈c 2'@ p  ` p۔  @ "`Q  ` >ccx"cx" 㿐5 W@p  O>m*"@ *`" *  * h >c#t*` * #t@  @1tz & H /i * * > !> "!"ȃH 0 ` !В"@@'"@@ z'`pq   㿈@ P H /4@* *@ 0   q>  +((` &'0(''(("`'" `'А"@@' ' * @`q{ H 0`p 㿀@ 8r ` p  2h`` @?  Z V@ 2Q @ J H /i4@* *@ +  @耢> 쀢 > #(#(  В@ "?@''?/!@''֐ $ @[ q  0 @x@ *  q H 0 㿘B    & E& H /i * *   b? &   & ?/!& & >  c(c( 0c(z $ @ H 00H 00}x8   Є?  >cp &"  6  "@ @" "   "  "  " " "  `" Є@@" "   H(> 44#h#lH h #` l #dЄ@#`#d`@d` h2   2 h l""  #H(> 44#h#lH h #` l #dЄ@#`#d` ` h l##  "@ @   @4"@#>   > ԑ*` `c >  ܄ " " " 㿘  >@#>@ #Ho o > #0  ?&  & "@"   "` "@& > ! &&  "@"  H 0 H       "  "  H> #0> ԕ(  >    ` ` " "`#02I> 8  >    ` ` " "`#080> 8   >    ` ` " "`#08> 0(  >    ` ` " "`> ԄԆ@ 㿘H/` /> !Ԑ!Ԁ@ !"`"@> 0"@@4@4:` `> *`!> g !Ԁ42`:` > g!> *`!Ԙ@0@#@   ;` `> *`!> g!@3`;` > g!> *`!Ԗ@0@ # 4@;  > *`!> g !Ԁ3 ; > g!> *`!Ԓ@`"@0# 4@;  > *`!> g !Ԁ3 ; > g!> *`!Ԓ@"` ` H p@ H/` /!Ԑ!Ԁ@[!Ԓ H 0 㿘E @@>  >  >  > !>ml"`"!  㿘   @%>mx >``@̐#V` >>@Ő#V`@#2  @ 2 `>`@G# x >`` @   " &   "& ^ & &  V 㿀''''耦` `   @ > !' +'!  * 2  ( $ *`: * @*``  2V  $  2V   2>m"x 耢 " > >`@D @@@ X㿘` `   @ > !3) % * 2  (  $ *`: * @*``  2`@ْ`T@ @ $  2T 2㿀>iR`'' ''''`V>d* * ch  @  2V 6V㿘F @'"  !>m"|ƀ * @ 㿘  >֒@   @ 㿘      `  @` `* @"@V   V `  6 6 > a&```&``""`@% >>֐ @r` >  В`@l  > !""2 $V `@2 $V   6 V 2 $  6  $  逢2@r㿘@ /`>@Ő  ӳ  2>@ @V`  && (!& V` V`@&  *`    V`@&   *` 2  V`&  >0 @#  (& $>@!8 )` .`$, $,  d   $`">>!!>@f!`.`*`@_@`kԊ $ * @  >֐!@M& ,㿘  ?* 2   >@>!  @  € - `>h !@   ` >d`$2`>@"`2`$>d#h2$R  R @"2 R 2 $ R @2$ 怢 `"  "`> "!  "@@ `@* "@>֐"@@F @` @ 6`@ 2 ``@ *` "``@ @ $`$@ 㿘`  ` `(  -   $`(`€ 2$`(㿘`  ` `(  -  ?$`(`€  2$`(㿘 $ !> >@"P!"  2>@x"2  b  2">@k"" "! " "@" 㿘%>    $`"  $`"  " @ v `2 㿘> !` `$`   2`$㿘> ! ``$```>0 [  o @w"ذ - 㿘`  `@ @.`@ 2 (  " @ ," ,㿘 ,?  & ,  `@ 㿘@  (&>@ː#@ N &> ! & "@"  $2>"`$`@ @4 $"6"`$ $ @@:  $@** $2 `TT&# $  $2 $"`$ $2 $"`$ @@ * $2 `TT& $  $2 $ $"`$" $ (   @*`2 㿘 D? @2  ` `4  a>֐@c>#>Ѷ#p,` 0:` >#8>֚#@>֘#  <" T>֐#H` >ִ#P ֐#X@ `% ` <`(@`, `8@>֐``8@0`,@`,@)>֐#x>   > >  㿘 > " >  " "   (@h  2 ( 㿘 ! ί @ , $ , 㿘 ,   (  е!&  "а  `& 2 >@#@! @"H /i * * > #4#4& ` & dH 0 &> " &  "@" >  >   " "㿘 ѵ  Ѳ `"  "`> "" "> >   ?" " >@i# 0" 0H(> 44" h" lH 㿈 0??& 0> (@#H /i * * > #4#4 ''H 0  h"@' l"@`'А"@@'' pb? t& p & t?/!& p& t`& h& l >` P 8@ CB> 8> P X @@ CB> @> X H`B > H F@ 㿘> v#  ͔ 㿘> v#  Ĕ H(  : H: 8: P: @: XH(> 44" `" dH " p" tH +> b!? @ S `b̤ @4  `? 4  . * >ה@ 4 `*` * " * > ")> v#  >b̐ (@e`e# `e@ >b̐ P@T #- 2@ >@E  2@ >` >@ > 㿘  !h @Ɣ!h>>>!Tal&& & 㿘K 㿘`, "  J!     L `$  0 tt  "  $"`$㿘> bh > > ""p "bhp p2 >@ِ Ѐ pp & p "`"p& 㿐!> "l  > >א"`#\   @  $"l㿘> "p " @/ 2  2 㿘@ \`>@! >א!(@>@!``+ >@!  `>׀ @{! @q& ( 0& $`&   " " '  `" &   H 2&  & && & &  &  &   & U㿘 2 >@7!耤 " `"`"@@  ` "`  "  G 㿘      @ 9"'` '`  '@ "  & :'`  + `2@'  @ "" ' `""`"@@ @0 '` '` '@" ''`㿘 >@" >א"0@ >@"`:  >א"@ >@"@ * (> @">א#@>@#H@ 2 >@#x/      &  !>ה H " @8 # ``(` @ 㿘\ `d>@F#2 >@@#@ *  @ >  @ >ؐ X@>@' &@ >ؐ @>@ >@! : >ؐ!@@u>@!@ &@>@i! ?         >ؐ!@U>@ "8 ` `* Y`  U`" P*C` `>- ?`@  "@ @   @?      8`  ? e d```"" | :`  ` "@  K `?`*? =;* `@  "@@  @  @     ? ` ?  `" `-" * ` `` ` `  &  !>ה  (&@@  #% 㿘 >@ "p @  @@&>ؐ"@`>@ ":  @>ؐ"@R>@ # 2B @i 2= b 2  2 `""`"@@ B` 2%@   4@ @  ,@ (  $` $` "  $@" "$`   @*@@>ؐ#@ >@ #@"  "`@X  " ?&  㿘  ' #`(   & ` ! >ה = 20  ꀎ` `"  "` !"@H /f  .` * ' .`> "@V `H 0  & 㿘 =` %  "` "@ " &  &"`H / * ' > @ѐ"H 0  "` "@ " &  "`    o& 0H / * ' > @"H 0㿘 2>@ А#`> > # @ 3c    > @ *# 2 㿘`%`a> "         @ a& & > > "b"܁>     > >  㿘> " H/` /  > H 0H #">ْ`""! = "  H 003  @߀H 0> b ?"bo  `$  @&`$ ``     " 8㿘 H/` /`A> "   > @ÒbH 0R` > > >m""`8"` 􀠀2  2 H  <`` " ``@ 㿘> " > @"#> b쀊 b    b쀊 > %"b ?$b쐄   }@"/ ~@w@;?0=@: v@'?05H> b H 6!"b ">   >      > " 㿘 &`&`@F` @ ?@   &`&` "   &`&`" $ 㿘 @ `` ?@ 2 `2``&&@ "  p`#t#p5  ?@ 6 " "6#  $", ?@ $ " "#``"` ?@ " 2#`# t p #pp`#t#p& 6  ""#"" """#  "`뀢`ր`# "t p #p㿘` 2 D 2 D>@ W 0 <@:>@ P P&  D <" & D@`"``"``@ "@ &@" &&``@; h 2 8 pH/ /> "t@H 0 8 `& 8@& 㿐\ 2 >m"     > "p$  $ $ $   b$  ?`$ $ " ` ( @@mc  @ (& >ِ p@ߒ& & &  & & > ? & `& L& 8& ,& 0& 4& h& d& & $& T& D& H& & & & & & & " & P>@   & : @ & h ?& |& | & p@Ȓ&@& ( &@@!  & <>>>ِ `Ж@!b@&@b> bt& t& x& & & & & & & & & & l` 2>m >ٚa8 (   `#\> >ِ#Da@#\ L  V >m&b`& `""`& X  X& \ "$ 㿘 X`" T \"`\ \"` \ X"@@G   H`" >@;!Hؔ  ` "  >>>ِ `Жp@"< " >>>ِ `Ж@"=`"  "`>m"" "> c@""c@㿘 Ā "& > `@!& ā㿘 h  |@H/ /> @ "tH 0㿘` >m" >ْa@А > v#쀢 2 `H "`H>``@ΐ!`H`L@>``@Ő"2!``Ā `"`ȟ€`H`L@ `" ">`d` 5`` 0>`b0@ې +` 2= `D" ``>@ "8>@"`@e    @` 2`H`2`d`  $``$`d``  L`l`H@l` $` 2`D>``@_" 2 ``>ِ"@” >@T"`7"" >``" @I` "`$   "@`D`H?`$`D$`H   ` 2?>@/#$`` "` "` $`" $``$     $ `<@">``@#8` "` "` $` " $` ` $ @``D `, $`@Wp T @ H 2  h `>@Q#`>@# " p |@ p ' ڒ p @ ?@   27> `@#"&@  &` `"``# #  &` ?#   D` H ?& & D& H&  d  ?& d    & 0V `2= <  8  4 &  T  "  0(` "` "  # " &  # H /i * * > #4#4#  # $H 0 @ڐ0?@` "` "  # " &  # & 㿘F㿘 <@@`P@ @'  0 `& & 0`@   ` @ 0 4@ `& 4 㿘 T  $?@ (> `@#  & " &  &&& &&& &$ h 2 x p x  t  & @ & x& x $@@ < D & D@@" &`>>>ِ `Ж@$d `&` "& 7"&@ @  "&  8  @& 8& 㿘   &  D ,@@`   ` @  "  " 㿘` & , <@_ <@ <& 0& 0 D ,@㿘`  <@Ր_t <@ <& 4& 4㿘 H@  & & & L& `&   <@_V <@ <& 4& 4㿀 Ā"' ȟ€ '  @u H /i * * > #4#4 ''H 0.   "  >>>ڐ `Ж@% " ' $" `'А"@@''>m"耢 &  D < ," s  8 0@䀢` * ` "` "@  h 2 pHo o > "tpH 0䀤 2 㿘 H /f * ' > c@ >m""c@c@ "c@T H 0㿘H &* @* H 0㿘  P  @ $  "7">ڐ x@  2 >ځ㿘@ *   :  l"  p"  c" `@*  ` `>   $ (ƀ h T>ڟƀ  ,> 0  4ƀ 8 <> D! Hƀ L > !Hƀ > !p  ƀ *`  >ڟƀ!  >ڟƀ!   >ڟƀ!ؐ   2 >ڟƀ!`>ڟƀ"` >ڟƀ" h >ڟƀ" /  + > ƀ"0> ,"X 0 4ƀ 8 `">`"ƀ , ` @ >ڟƀ" $, @`2> 2 㿐 T@ " h `>ڐ"@>``"0 3 7"@`" `>ڐ"@ْ `>##\@К>@b#X @ `>ڐ"@Ò#\>``#`@ 0  Ѥ 㿘     $ 2 "   2     2"  " " " " $" (" " " " ," 0" 4" 8"`" ` "`㿘 @N` "`$  "㿘 2' , "  0 2$ 2 0 $ 0 @ < ( 6 1  , 8 $ ,$ 8  >>>ڐ `Ж@&l ?>>>ڐ `Ж@&m* "  2 " >>>ڐ `Ж@&p "$ 㿘  2< 8     23&  2 H /f * ' > #D H 0 @703 @ L 4 & 4$ $  "  & &  8 & 8 ` `>>>ې `Ж@9&|*`$  @ " "@ >>>ې `Ж(@*&  "& 㿘 $"  (€ 㿘  q  @ 8?& 8   >>>ڐ `Ж@&l ?>>>ڐ `Ж@&m* $   `2 " >>>ڐ `Ж@&p  2 $ "&  $"  (€ ƀ  2 8`") 4?& 4` "`&  " "& H /f * ' > #DH 0 2 㿘>ʐ 㿘>ɐ~ 㿐   '  `_ `[ 2Y 2V  `2Q "N  2J 2G  H /f * ' >m"P  ' H 0   2!     0 0@* `   & `Wy㿘 T@€ 2-` Ā"&  ȟ€@€ 0H /f * ' @C H p@ 2@ 㿘 T €H /f4 * '    H 00  "  d  ?& dV X 2 d  ?$ H 0㿘  X`\"`\& \X"@"X X"\ "&   &X  &  㿘>l> ˕6`#X @Uc㿘>l#X@U㿘6`>m" `>ے`H@x >t> ! @Ug`H㿘>m" >ے``@g >t! @UsLXQQLtQQQQQQL|LQLLQM,M4M4M4M4M4M4M4M4M4QQQQQQQQQQMQQQQQQQQQQNlQQQQQOXQQOQQQQQQQQQIMMQQQMhMQQMpQNNpNMQNQO\QQOĝ㿘>ې @ 㿘>ے`Д@9 㿘#> c 'H'L'P'T'X !H !!>  "@ $c >@T @k>@N @l㿘>ې @E>m" 4>ۀ >ې!ϒ㿘'L'P'T'XH/` /@L   @}H 0> "   @m 㿀  <@C >۔8@2 O   >L @4  L   > @+ 㿘'H'L'P'T'XH/ /H   @7H 0> "   @'  㿘> # > "!؀`  `> !؀ ```@)>  ```> a؀""a؀`- + ) (`> "䀢 #`> "* `  " `"@ &" `  ""` > !؀  >m"@㿘> v#'H'L'P'T'X`,  a$ ` `   @H ,"  !$ "  !$ 㿘  @? "@> !㿘'L'P'T'X       @$    @mL㿘'L'P'T'X  @^L㿘!>m"'H'L'P'T'X$"   @MH> # 2$"$"㿘!>m"$"  @8 > # 2$"$"㿐?'P'T'X`'' (@P`*㿐?`'' (@ `*㾈  '`'쀦 ' :  ` 쀦 2.`   N.N`%`* N   ''?/N `X>А *`  ? ?L  >@  >۔H  O>۔P wO L` 쀦 2.`  L.fL 2L EL * :   @ 6 < ,` 쀦 2.`  L.<L 쀦 2.` t L.&L 逥  L 4LY >` M쀦 2K.` MLNGN2SN O/M  ?`H' 'D  +A/N`*   ?&7?6NЀ   ,* ?ФNЀ  &%?$  ,* ?ФNЀ  ' @N l2      ?/    ?    @?* : ?:  6  -`/   ?=:  @ ?" ?2    ?pp 2   @  ? ? ^  ?>ۢaX '  S x ?>ۮ!p  @ "@$/@    ?@@ 2   @  ? ? # >!x>ې!X ' ?    2   @  ? ?   2 /' ?`"N逢 ", 4` 2, >>ە4`,  `4 0 - 402 0/- @A `0- @S  ` `0-, 4`  ` 4  -!@ $`/ /&*``  2   <`" ` 쀦 2.` ɐ .|<` ` 쀦 *` .1g- ) 0` 쀦 2.` `0.O` 쀦 2.` 0 .; " 0` 쀦 2.` k ."1 0` 쀦 2.` N .` 쀦 2.` 4 .2M %"! ` 쀦 2.`  .ǔN`2&㿘` @@`% 2    H /m * . `"` " @"`"H 0 㿘   @ &@   @헐 * 2`      $  , & ,>  "b<㿐 , +) ` @ #&@   @s * 2`@   ` P   7P  \\,\<\\<ijjjjjjjjjjjjjjjjjjjjiiiijj$jj8jjjjLjjjjj`jjtjjjzP00000000000000000000zz{X{|H|0}l000}x0000}0}}0~>dch%   ch >d(!P >m>m ?  !>mR 4" R!`$ch  $`*` (>dh2 >m $>m `>m 㿘!>m#  >m#@2 #>^"@r>ې"W$##,`:` `q$#`Q >m>m>m @"> ``( "㿘#> >۔ (bc8@c81>m#>mc  !> #`@c8QXc8@c8#@&#>m>m  > ` ( >m"#"㿘` >m# " >4 >ۀ  >>"0>"0"؁㿘. > . @>d*`#h@ >`"V `*`>Ր#\ >V Ԑ"0 >А"0>̐"0>Ȑ"㿘>m. #> @ >m#@>m>#0u#*> @ >i @##@ *`>i *`>i > #( 0Z#>  $. >#P0Q@>d*`#h@>ے#p>#xT? >{# Tv#T | T?>T   4>>c#>^#'>d* R ?  T>d!*`  >K#A@T?`>A#㿘N -    N 02% N x  X2       ɠ  R˒  *`:   Ѐ  ? &@         `K*  Є 8K +`8 ( (* 8І `Ѐ`  K K "  "  " K"!?22 㿘N?  J@    `)>m,# :  4-`>d!,: @@,:  @@ "* # :`@ -`: ? &@?㿐 >ےl#@a#> >f#Ƞc`@/ (Lc`L "  "  " L  > &@G# >ہ㿘>m##>m. r>`>3#@G>-#, :  y Y n N>ۑ, :  y Yѐ cސ>d.  * h `      h  " h $ `$ >d,`R ? `R ?, i  >ݐ 0 O->d,`R ?">ܢ T>d*`! `WT?>ܐ M   , @D % t >ے#p>`> ސ0Rc >i>ܐ (0I @ 4C>ۥ. ̑<>#@>#, :  y Y n N>ۑ, :  y Y'+ c8c!>i&  *`>ܒ@ Hc &?* (c>i&?`* @>ܒV P<:P#P㿘>m#7 . >d* ch R` "   "  >4 > 2` 2` >+ `>ے'#p. 7:  > x >Ӑ d> 0>m# >i>ܐ  0   >ې& ?>i`* @>ܐ 0#P㿘>m#7 . >d* ch R` "   "  > " >2` 2` Ґ `>ےΐ#p. ޑ:  >Ɛ x >z e> 0>m# >i>ܐ 0   >ې& ?>i`* @>ܐ!0#P㿘>!8#>mc$n ,@@@ 4 #>m>!h  >#>mc$* @ ?* : `*H*`>Ր#p >p!pB>>k!=>>f!8>>a!3>>\" .>>W"H)>>R"p$>>M">>H">>C">>>#>>9#P >>4#x>>/#>,#c$,@J c$㿘#>m $c, : U >m>i#` ? ?$c㿘#>m  $c!,   >#>m# ? >d?$c㿘/>m ->m@ R% >dch@ >d`*!R ?>`  !R. : @/`2@a @$Y.:`e sd ># >#b ,`: :`! R?Ǥ`@`$?%㿐L?  L     2 LL "  "  " +>m,c :  4->d!,: @- :  @왐 "* c :`@ -: ?2L>L#0    >ېO s09#Ё㿘/ ?  c >m"#>d#h a!>i #h@ 2R`$`@U 2J`$.: `` `@R  `2:`$@R.: @23`$R  2-`$ .!>i,:` d e c ># f>#`$`$ `$/ : `$Г:``$#h  !>i  6G,>i /  @ 8 .:  3 ,:` d">m e c >m#> f">m># b@ >m# @ # F@ #   * Ƒ:   :`  >i,:  c>m?"c㿐NN    2 NN "  "  " N >W 0  >ۑ.`.: :^0H#Ё㿐?' >ݒ#> = @c`@ (Lc`L "  "  " L ? 2'L>m#􀢀 *>#P1>d ch* `@`@J  .`:  a> H ' ? q   f  Q># >݁hА@s $>m#->m  >֐ `0).:  >d>͐ 0 ch    ch @?  ch`@ " ch  $ ch >> 0 В a]̀?* @>d#h*`@ $JȐ>ݐ 77ڒ iG̀?= aJ.G: -`D: Bà̑.* $>d#hJ $̴?%>d*` * h J $>db 6>i>d".R   2 b>d>i`ܴ 6>i ؓ.R   2 `ܴ>ih %`%? h`@ `@Q 2R ``R 4 $h h>dch $? ch@s 2 $`@' 2 $R`  2 $R`4 $ch ch>dch % ch@K 2 $`@ 2 $R`  2 $R` 2`2`  $ch chW΁㿐N  N "  " NN    2 >m$-`J ?$@2 `@鸔 "`$J `NN "  "  " ?  M S >\!(N >m*`#$ ?* : `*?*`>֐  N >C!H5  >>m+"#N >1!`# : >W?W N ޒ 2>`` `>>m"#> !p N fŒ   >Wj cN %= n dհ  ̰  >WG dN >Ő!  F e z   >W eN >! \ W  f>W fPWw  0sN W>Z 0l/ q]?0gN g 0`ې] N & ;>N .!>c$#x  *`:   2 NN "  " N   #x"  t!>c#x#x >c#x#x>)! %# >m"x `?`""x>">ݒ">! >" 㿘_>"(>"@> #@˒ ( >P ">>"H    N - 2  *  > (#$2  * ( > ("> Ē2`6?> 6?> Ї* ? @ `2 ?@ (@* ?> 2` > !?? @ `2 ?@  (@* @ 6?> Ї*> ?㿐@ ! " `  `0 "`0`#\`@  pВ '?'''' ' ذ  耢 ?  #' '\"0,?`&0N0㿐@ Ւ " `  `0 "`0`#\`@  8  / $    @  '''''EӒ /`'   '  `    耢 ?  #2$ $\"` 0,?`&0ِ0㿐@ ` " `  `0 "`0`#\`@  p '''''''쀧 '!  ذ 耢 ?  #   '\"0,?`&0х0㿐@   " `  `0 "`0`#\`@  8/   $  ͔  G   '''''E 5`'   '  `$    耢 ?  #   $\"` 0,?`&00 @    2`0b b> ` @ ?* ` @  * "p,2  ð  0 $ 0   B x `D 2 0 @5   `$@ b|"9@"{"YT k b}b~2d @ 't    ?4    b~tc@ 't  @  ?4    b}tO'tT    ( "`<  "`@  ?"`D   2!$5  't   `vt) 2  (  <!$@ `w@ $@  2  0`C 0 ,?`$ 0  0`˒ p`@ 85 ,,@,`  u@~,-   ''''''@k#xxx'''?'` C 2`,` C 2`,` C 2~`,` 4ВC  2t`,; n H /i * * > #(А#( @ В@ "?'Ѐ@'?/!@''ԑH 0`, `,%>  @%`,ؐ@l 29`, 25`,` [Ю $,`,Ho o`,@  H 0`,%`,> >ݐ#X!͵ H 0 "`,`,? ?%`,  #" ``" `C 2``B 2` `B 2@ В 㿘`  5 *   6<`4* )@-, 2 04  $ 0 >ݐ"`-`    4`*  `-  & 0 ,?`$ 0 0F  " ?@Ѭ  &ʑ4``@'  `E㿘@ 4 "&@  " &@ l> #@2&@` 6`㿘 4  > c  "c> 6 ΢# #&H/` /l> #@2 ,J1 U 0 0 @ ?",H 0㿘  @* @` 6` 2 0 6` $ 0  V`6` 0 ,?`$ 0U 0V` "` ڲ`&p>c c` `  ,   @A @ `2`@  >#@t* "**%@ *"@ *`@ *`?ҋЀ i H /i * * > #(А#( @ В@ "?'Ѐ@'?/!@''ԑH 0, ,/> ㌐ @$,_ 24,ж $,,Ho o,@ ㌀ H 0,$,> >ݐ#p! H 0 ",, # ? $,@? @0  @AS@9 㿈(#>  c@{ Z c @s OD I 2 >m2 c" ("`&1 202 2 " (" &$ <$`<`, ?"`,`0?"`0`, ";`0`, ?"`,`0?"`0`, ,`0O " @  @>㿘>t! @? " @> b& && & & "b 㿘 & @x & @& <& D 2@ 0 0 4c& 8& (& ,& & $ 㿘(  $ @>ݔx! 4   @!" @ !$ @ x D M$ D  $ $ " $$ $ > T  ?$ @̰M @ ~b$ @ |$ @̥ $ # @>ݐ $ @!  2B D @$ @>ݔx!    @!" @ !$ @ 2* D" @" @  " @ 8 @ 8    "  @ ~b$ @ |$ @Z 2 D@  D?  $ D @  ?$ @I !T@8   @  ?$ @: " ! @ @ ?$ @|  @   8#@ .   㿘 ( <   @`" DM  $ D 9#> c 6  2  . a @>ݐ"$ @x! K 2  @!> @ !$ @ @ 2 @c $c @ ~b$ @ |$ @А " D? $ D @  ?$ @0" @ $ `u !" @"$ @>ݔx!    @!" @ !$ @ 2 D "@@(  @ ~b$ @ |$ @ˌ @@ "@ @4  ( 2, @@    " >"$ 2 @   $ $@"$ >ؐ"  $>ϐ" @ ~b$ @ |$ @G 2@ D5 $ @<  3 # @ @ ?$ @  @   8#@ 2  " @  @>ݐ $ @! s 2 D @ 2   " D @"J   D?  $ D @  ?$ @   @  ?$ @    " 2@v (  @ @ ?$ @"  @   8#@ Ԓ  .  }@  ( ~@ @ 0@ @ 0@ @    88 "㿘 (`A <   2  @   @ 2 `" `@ `   ` @" !8   @ @$ @```@ @$`@㿘`(@ђ `6`  &`@   @  C B?@>`0>`8 &` $*`" *  * &` (&`  ,*`" *  * &`$ 0&`( 4*`" *  * &`,` &` ` &`㿘 (& @& ( 㿘   > c?"c> b>t" "b!  @;G & 㿘 W @ @ ?& @F  @   8#@   " DR  D @>ݐ & @  5  D  < $ @ @ ?$ @  @   8#@ ˒  %  @`ɵ$ @` $ <> #`4(R`  <2 >m"`8 "` " >m "`8"`   4(R `< ` "`22  2  4(<" @2  " @`  2     4(<`" `@" @  2 "    ` "   㿐>mb> >#\#b H  ݌ 㿘 (   @" 㿘 (   @  㿘c  (J "7cE2I  "~ ""}2=  ##26  ! >3 E    x" ` x = 3 3 3 x1  L # < # @ $# D <  "  2  " i r   @Ԗ   ` @   @㿘 ( H /``A* !`A  L \@:   2  T 2 2  8 ` `!`  |"@  "@@ 4  @   2   "    2  8 ` `  H 2   @  `u l x 4 x`m   4 H 0㿘 (@ע `06` `  @ 㿘 (  @$ (Thx0TTTTTTTTTTTTTTTTTTTTTTTTTTH8P@  D㿘H /e * & `p &`l &`p`@C `p =&`pH 0 㿘> a؀""aؐ@  & x | ` 6 @? "@>  |!& p& | 㿘`l *`h}@`(" `H /e4* &@ @ H 0a >  x`DB: x` &`D>  ``$B: ``&`$>  ?`B : 7` @ . 22X @%  `x2` @2+`p" `!@ ! "!@!  ( 퀌@`@"`p@?`p @h 2?h2`@*@&`p!d=` 2  `` @ ^ @`p@ `p &`p ` `! @`*@&`@ @ ܒ``( "`@ `&`5 2  ` 2 `@ @    2 `x  `@u @ `x  `p* 2 " `p2 `n> * * " b* `&`p@ € 0|"f`px  2i`  2X`p2  `2`@2 `(2` @@'*?`p( ( 7&`p ) ! '" `  ^" ~  | { } \2?(&`p? ( 2  " ` "`p@&`@ -`p2/  +`V``@` `"`p@`@ ` `p@ ` @ ``"6`@l`6``p>*@&`p 2C  ?d= b`@ `@  ?"`p@ @֐?  )>ݐ#  @@ В@Ő?   `#  @ @@d`p 2  d" @ Z`p 2` d` `x @2v`p@ r`p``( # V``H 6d`p @w_`p@A [`p`@$ Sa @ @ aK`p   2`ހd  6`@`(@ w `p`ޒ`*`:  6``6``p@*@&`p /@5V`ܐ@ / 2`p `"`pV`ܐ" 8  $ `p @?  `p! 2`   ` `p* &`&`p@㿘` 2 >  p `d``B ; p &`d`H@ ٰ? <  9 `5 `ܔ   "$ H /e * & >ޒ`H@ > `p&`d > B;`p&`dH 0`܀6`?  2?  >  p `d``B ; p  &`d @J`H " 6`~  6`܀ 2`` 2 `` ? ` 2?0@`@"-`?`>#*`   ' ! ^ ( ) \? "`> `p \`dB:`p &`d@`H =` @ > V`܀ "2?>  p `d``B ; p &`d@ `H  >ݐ#  ?`V`>#*` 4 6`` " 6`  6`ܰ?0 `@: `{@  ]`z@/`^@, D  r g@"%!$`@`e@ `@0`@ . !$     > >naȖ(!@ v !$|   ,` x ` !  ! "  @4`o@Z`^@ ` @`@?0͐`a@m`n@?0`s@"H "@_`@װ?0`w@ h@Ѱ?0 `b@" ~@   ] r@}@"?0`@e`@?0  g@w `e@n`v@U?0 `@y`@ {?0ϑH /e4* &  p p ?$pH 0^ H /e * & @{&H 0H H /e * & p$$pH 02 ` ` @̐) 3!> !؀  " > p ( (> >ސ 0 @ '''''@Dj  @f` !@g@h @K $!> a؀""a @7 " 07Ք , h&7ɔ ڰ !$ |@ , 2 xВ ʰ x " #H /e * & p ;$pH 0 H /e4* &#@  @   H 00 @2@*  : Ѐ€ " pH 00tp2   2 $ࠐ ߐ"$p@e$$$($(  |    @p  @"( ऒ ! @ ` $@<(@ G 7 77 *@$$ऀh$ ( 7&  @  $ऐ6 H 0 >n!@ l  h H /e * & h>n `*`  €.€  h*` €H 00,hH 0Ȱ H /e4p* &p  @  * $p$@H 0  @   @   >n!$ |@  , >n h `*`  € H /e4p* &p n> * * " b* `$p@€ H 0_ !$ `Y ` | "| O |`" !$@? "@> |X!!$ @ "@!$ $|!$$x!$ "  , 0' ,`!$ |(  , $`2`     $x@` @[   5x   ?  㿘2  *@ *`> "@ *` @ H /e`A* &`A @  4   @2` p 2`` T  H $  `˒ `ƒ H 0㿘6  * * > b" * `@@V`? ?2  >n @`&`8>n P`&`8&`> * * " b* `@@ <H /e4* &   "`2`` "`H 0 㿘 `>> * * b" * `@@`<H /e * & @b$` H 0  2 `  p 2` `  4`   㿘 >> * * " b* `@@ <H /e4* &   "`2`` "`H 0 㿘 >> * * " b* `@@ < H& R 䀢@   㿘>m" >ޒ`@@  @" @ !  (    " 㿘 H /e+ * &$ @ H 2 p p - p2   @$ ̀  & p>n8 H!@  H  p  2   @ ̀`H 0㿘 @ 㿘H /e`* &`  (`" @ ( `" p@  p>*@& p6 @6 @>`>  n* p *  ~" & p* € H`@o H H? H 0㿘>n  4 㿘  ($   p ?& p!$  ( p @2 ( !"  ( % $"  "  @v H 2  p`@@3& p @@ Ԁ €   p @& p㿘 > HH /e * &  p @ & pH 0㿘 ̀`@ 㿘`D 06 㿘 p"` @` & pސ4 21  n> * * " b* `& p@€    & p  @2  | "   "   & p@] 㿘`" p p & p ` & p  @2  | "   "z ܒ   x>m" >ޒ`P@q    p@ *& & p 3  & & & L@  p *@& p㿘ې 㿘> v#     H /e4* &@ H 0$ | +,' x#       > >naȖ(!@5  H /ea* &a; >c#l5 @В    &1 p0x   )q   А >`X ¿ [ U " p0O ( L ( p   @    H 0  H 0 # >n 0>n !@ H 0"  2 #  #p #m( H 0G 2  d$2  x  `<> >naȖ(!@} 2 2 a' !  a     d  @c 6 H /e4 * &   @H 007 㿘>m"  >ޒ`X@  p @% $" "  @( H 2  p & p @@ Ԁ €  p ?& p㿘V H /e`* &` > v#   H`Ȁ@$@"`> v# 쀢"  pH 0 >ccl & p>ޔh H w  HH 0 0` V   H /e4 p* & p*   @%  H 0  >nH 0 #  !@ H 0݀`H 0> v#$ | 2`, "` x @| 2{` 2v` 2r`  r   > >naȖ(!@A c  @2&` HbN d` 8 0 逤0? >ݔ @U ?6 u 6? H  @: H60" H@6 > $p ܚ@  d< C 6 8p@& d $  @ H4 ` 2 4 `A&` H?H /e4 H* & H  H 00" pH 0` &` #>n & p8 H!@ H 0`2`0 㿐` h  *@`z&`V`ހ &`ސ> >ݐ#   ?e> 0* @| v`` @"r`ސ@s m`ޑ*`:  @{0eH /e * & `p`@   V`ܢ``&`p&`6`ܐ@ @@R ` `p* *&`&`pH 0V``ܠ$  6`ܠ ?,%`ސ ~? `>ސ x[`ހ` `p 2 &`p \g@b``@]`ސ?6`ށ㿘`S P  M`㿐 @?> H /e * &  (@ @)@۔  @ @@˔  p*@& pH 0 6 6 ށ㿘`p@2`` *@&`` (  ( @      ^   ^ޒ  @ ?֒㿘  p   xߔ Đ  * @2``@2@?㿘 @ 2`@: !4! & 6 6  (  h* h 4(  4@̔ 3* @*`@*`6 㿈6 > # d* *  * $4` @А d@<>ސ`K | 2 x> ``2`>`Ѐ  >ޒ`7u6 ސ@t 2 @ L1   24>!(>ޘ!04>ސa #Д@"? '?/!`''! @{#>ސa8 '?/!`''@f#>ސaHh d* * " *  * $@T4` L1  1 (  @>ސ >ޖaXÐ6 ށ W  1   `1?@ "G 3 ```*7 0`4  ?@ "( # `"`4` ,`, 2`4 `44  㿘H /e4`p* &`p ( (  H 0? 2 olH 0 㿘  "V , : @ ?>  >  h㿘  >!@ǵ! $@  ($@  H$@ &>   & "@" > h> "haP 㿘> `h? "`h>Ր!h`"  "`> "  "@@ @ (@ H >㿘>  h *  a* > `> "` l"@"`("`H"` 2`2`2`p"`|"`x ""`  "` h*`$`( 㿘`"8 ?`3> L*` > > t p> d`> |x >  h!> *  +  @ 0 -?㿘 > & @`:   > & @ &  & & && &  㿘  " @    >  " &  ,:`@ʒ`  >& & ?H4(#    "` `8("@82 "  " "" " H  㿘H /e# * &  @ "  " 4 ,& " @@ &@&  &  4  & & H 0$@ H4(6`2     `- * a  #   8("8 `0    `H H4(@"'"`$     4   ""@ ""`4 "" H 㿘H /e * & @`@`2` ` 2&`>!$  " `H 08?&`&` ` *`` `"@!  :*"  *  +  :*"  * *+ @`  ``@ &@&` `&` H 0 ` `8( @"@**2+@` `8@ + "@ 8  ""  ( @ ( (+@   @ * +@ @ *   +@ +@ &+@㿘`U H /e * & @>`5` 2/&>p!$  ."& " " 4*  "  @@ &&@& & `@& H 0  > >  > `   `@"  @" "  "@  8("8" >    "@ "    8 ("8!"@ ?H4(&  2 "  "   ` `8 ("@82" " H  xH /e4* &   H 00+@  `@ؒ) ) ) H 00H 00?=?㿘,  $   `@X?@Y@Z 0 㿘``,  a$   `@Xy?@Y2@Zd 0 㿘``,  a$   `@X[?@Y$@ZF 0 㿘`,a$    a@q @  a$   #`, @Y?㿘, $   @Y㿘>  >n"(>r" b>r"` "`# ` "```:` "`` 4* ``2`> c >  "c> c  > " #> > "ㄐb>`#c !> "0>`b "0 > " "2  :  R  4 *R   > ") "   2   : R  R 2  4R2  42 4 " 4 *R  㿘`> /   `22  * @eg8     P2404*P *㿘>    @: `  `4@*`  2 㿘>  >c  @: `( "  `4@*`(  2 >c#l2`@ 7:`㿘>  >c  @: `$ "  `4@*`$  2 >c#l@ 㿈>t! '>c H'#\ * @"C > "`d%> >#\b!   >n!h#\#> >ޚb  c( !>"p c"p >n!d <ʫc>c#}>c#yc㿘> > ˕6` d @$c㿘>  d@$ߒ㿘H /f4> * '>     @: `, "  `4@*`,  2 H 0> `` "`㿘@~㿘@㿘@r   @- 0 㿘H /f * ' T > `*`@ ?2@   @f   "# 8@  <"`< < 8"`8>  $&#  ( $ 0 ,  4 $ 0 ?4 > "H 0㿘 MH /f * ' V > `*`@ ?2@   @   "# 8@  <"`< < 8"`8>  $ؐ#  ( $ 0 , 4 4 & 0 ?6 > "’H 0 㿘T @Ɛ 2  `#V @6   &x  $  ?4  $& `&  " ?@& & 㿘@  㿘@ 㿐` `>ސ" Ω `  2 `$@` 2 >Θ"@@:'@l $ #V @4   &! $ @沐" $$  "$ $   "8$   S '  $@$  $% H /f * '    @4  8$ <$ 8& 8 8" "  2lV 沐">"X  > ``  "`` > `` "``㿘`>ސ"ܒ`>ސ"֒&@` 2 >͐"Ȁ@:2 >Ð"" %[& 쀦 㿘 J  @*@  &@T`  3`8 " $@@` @4@@ 2@T`   " $@@$ ` "` @%&ݲ    && 㿘 2`  2& ! ` @@ *` &$ `  @ & 2  P `&$ 8" "@ " " `4 4"  0"    "    "  , 2""" *" 2" 㿘  ` ! `` ` ^`  &@QV @  K$`  `#V @4`` $]  &  ?6 `$$```  ?$@*`>  * 8 `` $ $> ` &@$`  " &  & `ـ `$@ A> `\  "`\㿘`f  h ( h` h T`  $&@GV @1  A@ ` ;$`  `#V @ 4`` #ޔ  &  ?6  ` 8``  #В ` &@$`  " &  & `〦 `$@ Ӑ> `\  "`\`&  (""@`2 "` 㿘X `U`"@`"q ` @8@`"j ` 24@"6``8 `$" ?ܐ?" 6  "   "@ & @`""`4@  @|  2 " & Z"   "`  & ` " &`   @@ 2@"@ @ 2@@ "@&@㿘$@ ~  @8 w " 2T@u (#V @6  " & @t  $"& & $  % `& Ɣ H&$C   2T <@   " ?@&   % $ $" H /f * '    @6  8& <& 8$ 8 8" # 8$   $ $   $@ "5$@&@㿘 & ` `> 8>x#`` $ @ 0 $ @   @  2 㿘`>ސ#V `>ސ#0P(&@` 2 >E#H@:2 >;#h" @ & 뀦  㿘H /f * ' > "   ".H 0  6 H /f * ' > `.``@  2@ H 0  & && 6 㿘H /f * ' > "   "H 0 #6 H /f * ' > `.``@  2@ H 0  $ & 6 && & & 㿘H /f * ' > #`  "& $H 0 $ (  & 6 & 0& (& ,& <& 8㿘 >v#Ѱ`  &@`  (   "    "  8` `"   "` #@  & $& &    @@ `1` 8`"   $ 0  @ "  ?&`````     & l"6T```8 ``$" ?ܐ?" `T4T`2T""` "`  ` `  "& 3          2$ e    >  "&     $ R $&2&㿘&` T     K  쀦     Ԑ `  cV 6    & @r $&  a& 㿘` `* o " 2 2  㿘\ o "@"   @ "  2 㿘㿘`   `2   2  㿘       0 㿘˒ ``     2 "@& "@$@`  "  @㿐> >ސ hc#\ Ȕ   㿘> v#쀦 "Z +  2VT +O )H /` * ! >  h @u $  $ $  $ $4`  2` 4 ` $ `   $ `` $ `@`$ $  @ 2  H 0&@  `@b4 H 0㿘H o *@ a   ` @ H p@㿘H /` * ! ` `   @ " ` H 00 `` 4`>n"@>n>n">n"@&4`4H 0 㿘>m" >ޒc@А       @ :  @  |@>  h㿘H /` * !     @  @X  2 @  @N   5  # 2 @͐ 2   "   !!"   >c#l!> V   6!S "     `   @ `"  " >^#6 zH 0㿘>m" >ޒc@@  `   @ 㿘H /`4 * !   >-#ؐ ?(6   2  5 `  @ H 0㿘  , -H /`4 * !      2 8@4 "   8 `  @ H 0㿘H o *@ a   ` @ H p@㿘H o4 *@ a `   9`  %  `  @ H 0㿐> v  #'H`  'P  P :   U ```   2`  `4 "`4  *`*@ " |0& H 0Y 5 8H 0O H 0G H 0?  5 H /`4 * !  Ϥ  8 Ԁ 2 |  $2 | 92 | 9H 0 H ° ' | "  "@@ 4  `'     @  (   (H 0 @ =D< )@ '$ ! ! # ? 5 ?5 K @u |H 0 PR H 0P$ P n qoP     $$y  쀤 4&`#   (P > #& @4  $h4( $4 $P 2 6  " ?@$$ %@P `  G"` ```P` 2``  5 H /` * !  `   P@HH 0`   ?5  'P  PW ? 5 ?5 } P   㿈 'H''X'`'&@ 2'X` @ ? !2``* -  ` @  @  1`2you2& $"  x    @  x `  @O L  6 x H /` * !  ``2n ` L@ :i ` \@ `@"c ` P8_ ` 2[ ` 2W `2  8 L " 8>Z#  2H ``  6 8 ` 2= ` x "7  "1 2V ` 2   " 9 a 倊a #` x ? 6 x ?6 x x@ɐ LH 0"{ xڰ `"  >>>ߐ `X" V `> p'H   + H"@  L T" & L& T H0"@& TH "& `K&H /f * ' V> `*`@ ?2@    "#8@ <"`<<8"`8> $q#($0,4&0 ?6> & `"ZH 0~ `    'n  L T" & L& T  0"@& T `" '  2'@'& `K&H /f * ' V> `*`@ ?2@  9  "#8@ <"`<<8"`8> $#($0,U4&0 ?6> & `"H 0 ` ' V }`!`2V& `" & h>>>ߐ `"V`'`!2a"2b   `  >>>ߐ `Ŕ"& `& d& h  * 2  ( >Ɛ ?6  H "8 "8!"@쀢 "@H 0Д'H /` * ! 쀢`%& "` 2``" L  T" & L& T 0"@& T%& `L%H /f * ' V> `*`@ ?2@  J  "#8@ <"`<<8"`8> $ #($0,f4&0 ?6> & `"H 0 ` ` >>>ߐ `#C&& h& `& d& h@ > % "@&&  L"& L H `2 @"  & H  @P6 @N`J`@0" 0  ,@ L " ` x ? 6 x ?6 xP xH 0 2     " 8 V     ѐ `  ```2#@ː L`22  & `& d& h "& h "     @ @2쀢``   x ? 6 x ?6 xܐ xH 0 x쀢 2X`" x@"@ x ? 6 x ?6 x xH 0㿘`  ``@`2      @ h L ,  @ 4 ,@ϐ0 4 ,H /f * ' @ , ? 4 , ?4 ,z ,Ȓ 0@ 0  4 ,$ $H 0   `@@㿘?#@'P  "դ * `  @PаȤ *"1`">` 87` *"3`@.` **` *   1`` *4 *Q`" ` 2 ``L#@4 6 `" ` (~ `  e6 *b6 "q ` (m ``$ "  0N &L L |@c DR 7@8<&  P@86& \"E ` 8`? '>cp@ >cclc"@@. !D  p@,  2 ``06 6 z`  ` ` @P `g㿘?#  " * `x@ v3  G&` 4 "CV @">V "9V 0X"6V 0U"3V  ".V 0M ")V 0H  ", \    "& P4$  "  07 "`&  "V0- &`  ` "@V `(" V ` #"@ 8"@6 8`"2V zV >c#l &` `@N$@>ccp`$ ߐ *& 㿘 <  @ D+ l`4R`(2(  >n\>nl"`8 L>n|"`8 |H4 $( $"`" $ ,2 ,H  4(H4`p(`p  "`p2 `p`x2`xH `4( L"`   "  8` 2` 8 "`"`,  " \`0   4(H4`(`  "`2 ``2`H 4(``| `` 4" `   2`8"`82,`   , 0  `&  4(P2" P2@  2 㿘   ;  6 @ْ @ @: L    6 0֐ 6@* L   @  |㿘  6 `86 @ |@ L   㿘  6 h06 @ |@ L   㿘@ >m" >ߒ`@v T 4T 2*T 0 @ @R %> h 8 @6  6  6  `6  &  66 6 <& < &  &  &  &  @& @ D& D @ P@' `   @  @9h `@ L   9 6 6 㿘` > &` 0  6 0 2  6 2&``&`(``(&`,`"`" `   2 0 20  "2 22 ("  , , ,  , ( " "  㿘 `6 @? |㿘 ` 6 @6 L   㿘 ,!  @6 , >R .$ 㿘 @4 , ,! >ߔ    ,   ,  4 ,㿘` `, ? 6`, ?6`, "  D <V @`$n 㿘 |@" @ L  \ 2  & \ 2 (&   8&  @* 7㿘`%>n   2* @ * @)2@   .`@&  & &  㿘@ڐ& & 㿘` "&  "@!0 @8㿘  @"  >>>ߐ `@"@% & 㿘`%`   a&& ` " `0@&   "& " & @` &@`  ?6`` 2`@㿘`6 ` R`  2 ` @`2R``   a&& ` "`0@& &` "& "@` &@`  ?6`` 2`@㿘@  >"!` "  ` "@  "@@ 4 4C  ޒ  2@8 $` ` "$$@   a&&   " 0@&  2    a&&   "  0@&   "& " & &  㿘>!p   ` `"   "@  "@@ 4 $#+   a&&  "0@&     a&&  " 0@&   "& " & &  㿘 `y ``  " @ 2R R V`@  2C@& ?A =9  8` 0$   "  0$  ?&0VV`@  `` `  @ & ` @ &"& && `   a&& ` `0@&  ?6& >6W!㿘 , "  >>>ߐ `͔#"@4  2 "  >>>ߐ `#' "  >>>ߐ `#( "  >>>ߐ `#)  >>>ߐ `#*㿘  Y W  " &&   &@  0"@& H /f * ' T > `*`@ ?2@   r   "# 8@  <"`< < 8"`8>  $2#  ( $ 0 , y 4 $ 0 ?4 > "H 0`m 2  >B" ( "$ $ "W& " &&    0"@& H /f * ' T > `*`@ ?2@      "# 8@  <"`< < 8"`8>  $Đ#  ( $ 0 , y  4 $ 0 ?4 > "H 0 " &  " "& & $   2 & &  "& 㿘 `"^ `& `  " && ` `0"@& H /f * ' T`> `*`@ ?2@ `  ` "#@`8@ `<"`<`<`8"`8> `$N#``(`$`0`,`x`4`$`0 ?4`@> "8H 0 2`   & & 㿘`  (>ߐ" "  諒        2 趐   ۔  & `$ $$ 㿈 `(zc~ - 2` 2` >m#"``@p` ad0"`(`, ?"`,`0?"`0`, "z`0&z㿐 @@ ``@    ( 0" 0`, T`0㿐 @@ ` (`0?"`0`, ;`0㿈`  `   @{@ H /`4* ! (     aT 2 2# 8 #  8 `  6! Y 2T 2   8    >ߐ 54 8 8 z4 8  А 2>\"H  y (b찒  $` 2 4 2$` $`( `("`,`("``"`$`, 6j L쒄 p& j  2` 2`>m#"` " (} ߒ `` 8'  T ` N   `c0`, ?"`,`0?"`0`, q`0簐y (H 0 0 ,?`% 0^ 0㿐 @@' r`(  !!2``0?"`0`, d %C`0` %`@c  2C  2=   !! 0" 0`, %`0c $0?H /` * !     8  >ߔ 6! d "   84 8H 0  ?4 `0?"`0`, `0 ?'?" x@`` @`` } (xԐaఒ j '2  2 >m#"`"(aఒ 2M2 2 " "`('@谒 5` 2 ` 6찒 +`  S  $`, ?"`,`0?"`0`, "}`0`, ?"`,`0?"`0`, n`0x _dbԒ'_]b͒'耢 xz쀢 p`` ``'` @'''''И'@4؁8`   &䀢$# ( *  t 䀢* ؒ  `@@ 'u h '@R԰ l    ''? '''' ` '  `@  6`"' + @  'Ԛ ( ̰ 耢 ?  #    &@' 0" 0`, `0Ѐ p`  H  "`0'`` `'` '`@''''И'@?؁8` '  1䀢$. ( *  s͔ `䀢 '*  @'@  `'  t h ''@԰    ?' ?''' ` 't  `@ ؀  Ԙ (̖   耢 ?  #  S$'`"̀2 ' '' Ȱ ;Ȁ &   0`, Ѐ !  ` :` &` x@`` ?$  ` 2` && 0" 0`, `0̀ "Ѐ 㿐 @@ ` (`0?"`0`, q`0㿐 @@ ;`(' `  7 ``0    7 2`  7  `  `$  ( `` y 0" 0`, -`0㿈 @@w'찒 B`  ` ٔ  (' (`` 2` `쀢 " 8'   `   0" 0`, `0쀢 㿈U谒 ''@    uӐ (\\ u (㿐 @@  9` q  $  (㓐  `  @ ` 8'`` [ ` T  0" 0`, ``0`㿐 @@ɢ G`(  $ 2``0?"`0`, 9 9d`05 9   # @  `  @ ` 8'``  `   0" 0`, 1`0p㿐 @z@ I `(ዒ  @ 0" 0`, 9 -`05 -   2   7`  @ ` 2 - ` ` `   0" 0`, `0㿘8% "  ⪒ 褒   2 ⹐ 7 $ { ⭐0$@ * 㿘Y: 2R`    &&`0  "`0z@z\zlzzz|{{ {}~}yz~d~z~~~~ȝ㿘> v# `  X -`     B - ``2< `6.`>!\  1 8@<-@s* @#    @@C    2  >n&  Rb C@{ V  2>>"p   T , |`"  &` T$ , ( L`"  &` Lb$ (ڀ "x @ Ѐ V < t>߀ ä 8@   2  9 ``>n"`L+ *`     7 @   "   >4" `Lk 2  j`L `,`T`L " " &  `T", (`L " " &  `L"(`  W "@ 5Q  &@V  ? "?`L@&@?&  2 0> a8$  "a8 0 &( 4&&&,& &$ 6&  "'&  &   "&   "&  &   e      &  Z  & >" ni㿐 "V P  8V ">n ">n >>n">n"| "" 8 oo  " 7@v 8& $@M * "@*`@*`$ 4$ 0㿘  " " @ &  "  @ @6 6  2 ""  > !<  +ps @Dpo   ` @ `N `@,  'x'T'P't'|@/P 2=` "d@8}td@̐0@^@ǐ) 0@m '`$ 8 !7@7dd`@6t 2`$ &  $ & @8  P` D`  a '''''K?  (0I* @א D< > &@@6 5`"1 =TV@@, )  $`  2` =  `沔 Җ $  $  ` $ $ $@@Ԑ㿘V@V@  )`" V  >""  "  b"㿘 '& R`` 2  $  2 >F"2 $ & ` ?2` $ 㿘R    㿘4 8   6$  oC 㿐> v ?4,m  q ( V@'$@@`?2@K,  ,  Y6 `? , XQ?<,   (Y qn ( *`" @> '`<?"?"<H` ?`% & qF (nΒ 㿐    ` ?#@2  @ 4,   ?` "` 8`"   $ 0  @ "  ?&``a 丒   Y 7 @ $ ` & ?@- UM?#' #@   `̔ > ` ` "` @< "`"<  ` > ` ?"` ``<?""<㿘)> !4 #> ` > %!4  "a@ ?̐*@4  2 `耤 7>   > @?Ȑ*4  "@ `"2  @" T  4  (>n "(@2  >#`a,@Z  2 > !@ `>   &* l `  ` @2  @2  $@` 0 $ 0  $  2 @R` 2 ?`( "?^?` @Z_ ?`m &%!4㿘 >#a@ 㿘 1 *R 2# ?#@2 2?2  @$@@`? 2R  ` R`  > @  @2`2`㿘 >  0 & 0 <?& "<Y 㿘   > !H >     > !h >   > !h2 8>ߐ" 8> a?"a 0@2 > ː"p >   :@T 0" `"T> bd" "bd> bt" "bt ` "`#   "㿐> >ߐ! c#\ t  > !H  %> ""> !h*"%> D> x c > "b\)> D @b"H"H@DD@X"H > x" t@v> w!!P,`c!?$ D$ $ H@$ p> "p`> "p$ 8 8$ 0> ː"p >   :@> "Td  > #"T"daP> !> `"!` $  "` ""$ > blbl $bl" "bl$ D`@t"H 2:: > "bX> "!D @ > ˔"p@ :@ !> $"`$"`"H` `"`: 4$"`"p`` : "` 4$"`㿘 @+  0"2' 0 & 0@5> v# `, "`,'@㿘 @ `0"2``0 &`0@4> v# `, "`,``'" @ѐ 2 @ 0"0  "0@4֐ > v# `, "`,@ ޴@i㿐\#`'P'T#\PT 㿘 0 2 \ \ " \ X "  \ < @" \@PL ``< 2`X` ` `"`p`t "`t "`p 0?  0a $ 0H /d* % @  \> v# `0 "`0 \`t "`tH 0 0@ $ 0@4_` @@u㿘 0 >  0 & 0H /d * % @H 0> v# `0 "`0> " F> *#$"@ *`  @0  0 & 0 0b& 0@7㿘 0`& 0@4㿘>m" >ߒc@c̐  0  0`& 0@q㿘>m" >ߒc @c  0  0 & 0@\㿘H /d * %  0  0 7& 0 0"@" 8 0 & 0 8$ p 0@; p > !t`@ 0 " \ 0 ?& 0 \ " 8@@ 8 > > !> `"!`"p >   :@> "Td  > #"T"daP -& 0  0@> !H> ː"p >   :@T 0 ` "T> "d> @ ""dP> "t> @ ""tX 0 "&  &  "` ""&  & "" 0!> >!hc !h& 0">  $!h> p  p> "d> b`?"p 0 H 0 0 @ 0*@& 0p㿘 @k> bx> b\* @ "  P2  \2 0@ 2 P 㿐 '@F)> "x '> \* @ @;"x \* @ > P26 \22H /d * %  0  0  & 0>ߐ0j H p@ ˰ 0Z 0@,H 0 2 P >  @  @ &@" $@& & P& TH /d  0`0& 0QH 0Հ * % @7H 0 `"`0 "`0z@!㿐 @ 0 "0> ll "@l"`"l" @㿐> "t@,@@@( 8>#8"& <:A 8 @| 0 "0> ll "@l"`"l"  8 8$@ 8  H H @ @U" 8& 8`8""`8`8`< 4"`<`8 >#h   8 Œ  8(<& !`  'H 0$& <`0 "`0H 0 H 8`H@ " 8""`8& 8" <`0 "`0& <㿘& H /d * % > "t> aD> "h> "d> b`#> > v#> !@> !@> "p>ߒ`""p"p% H 0`O 0> !P >  "!h>ߒ !h  H 0耢`' 0 $ 0 0 " \># @5H 0 p " >#?$ 0$ D$ P$ T$ X$ 4$ @$ <$ d$ `$ l$ h`"  "` "@&㿈> v#> "!> "t> aD %> > >ߐ"h   %> ((`?H /d4> * %> !X ߢ Ȑ 0 $ 0H 0 0@H /dy * %0q 0 2 p>#耢 @ 0@;> !|    . 0 $ 0H /d * % > ː"p >  8>   :"Tt@  #"T"t$ > aX` $ `""` 0 ?$ 0,> z> "t> bXr> (( "@'"'А"@''耢 ]> H /d * % > !X o> L"t㿘H /d * %     0">H 0 0$ 0  ;$ 00  0(  4 " 㿘>m" >`@_  0">  0 p"& 0`> !p`@ 0@  0@*  \& 0@ 0 @  0  X& 0€4 0 0 0 *@& 0B㿘> v#&@>n" *@ &  > cP` "`?* &T *  ? ?> "|> cL* @  2 T@2L 2@Đ ! 2 2 > cP`? "`@"(>  `2)  @ & @> > cP` "` `  "`   "@$ > cx`$ `""` cP` "``T@> cP`  "` @x9 @" @.ʔ & @  )   $  @, "@b0*@ @       @. &  `T&  > @?> cP`  "` cP` "`@     J?@,  C*@>&> cP "cP `  "`   "@$ > cx`$ `""`&@'  `"  "` > "#|  "@` "` "$ > xx $ x "`  "`"xx$ ?㿘 $>n> H" c>c##> cp  > >  "@t @cp $cp#x N#x ` "` "  "@ ` ` 2"  "@$ `$ `T $ $  T !$ , *:$ > cx` $ `""`  T.  > "|> cL* @@ $@" "@$ 㿐> #x"#x"`!> >c#>  |y >m$#Lb> >#\"`h @   > t"t" T> |> L(@ t@" L  2 L@:@t"t" T> x`7`"0`X""`*`"``"` `  > |` ` ` > @2 `@ "`> xx"`x` ` "xx"` 2`㿀`2>  ј ` "0 +``  @   0> vc$0``,  "`,  >n" " &`@`  &`&` ?`= @8@ @, ?$`4 `` : @*&` @ `*` 8 &` &`` 4'  #`#d#\Y]  ; @$T8i@d _ @, V?Q$`4 `` : @*&` @ `*` 8 &` &`` 4' `#`#d#\ @S  `0$`0$`T@`  > v# `, "`, `0"> @,Ɛ``0" `0?# @$`0Ӑ`@,`"` `<@R`P@&`@㿐X L\` d> ]  ; @<8@ y {  0& T& 00m#\@h 0"a.  +b  $ $$ $  L< $ @& L3   R `8`@@ `H@ >  `0 &`0R"  @~`0 5&`0`0` &`0&`T  *`"`$ @  "Ȓ2  0  & 0& L& Xc +ǐ㿘`   `0"\&`T\ߒ`0>- @c&`T&`X&`0㿘>m"  >a@[  0(2 4 L& L  H??@$  H@ 8$ <`$ 8 0$ 4($ 0 8"& 8  ??$  8"6 H>p!($ @" @$ & <& Xb + 0 0 0 *@& 0Ӑ㿐 P  \&`&`&`&` ` "`X` 2 `X <` ;`  T "``X@@`L`?`K'   <; ` `;`@ݦ$ '@2% < 2! <@@a` *`` @* ` N *b, + <` @T < Ƞ (b +@&` <  ; @< @"  T@*  T? &` T&`&` !&` &`&`א&`&`&`    @  &`&`&` T&` 㿘 X L >!P?   2 ` 0͐  `0 00  `0 2`<?͐`8@t?Đ?/  + `C `<$`8>-$$$ `Lc$`0$`X`H @$`0@$`Lg  k  0 2 xb   $ `8`T:  T@ >`P! T> P!>! 0?a $ 0 0 $ 0H /d * % 6 \`t "`tH 0 p > !l`" H@ H@e`<- `8@$`<$`8 8@"$ 8 "   ``  `0 $`0$`L$`X` +֐?'!㿘`` "@ ,  _ +`  & @&  .` <?`@` .`" `& 㿘> v#  2 >"0 @(.! >"& @H  S 0%!(& @ " @  2< <@2 "@   @(2  @ >& @@  㿘 㿘  $`p   㿘    ]'  㿘   ]  P >n8 8 `@" "  2    - -㿘 2& !> #  ^* #@*`" @2@>o " @`>>"J>ܐ" * $  2㿘>o`* @ > >Ő"#   #`* @" #㿘%>n  ,``,`    ,`Ǣ`,` >nc  c** *>p#> " *#@㈇*"@"㈁㿘@G> @Đ#>n>n#c"# "c  @P?`(ȔȴɈpʰDhˬ㿐>mb> >#\#c( 8  % 㿘W` Z  "@T @ B&M `` @2`?? DE?4> 289  3>  7`/ c < < $ $ `$ 4 $ $ $$ (\ 4   c0c@@.@|c0 㿐V  $   (da  @> #  #"& @!    @2 `l> y# `l>n`#P@ >n#H  @ @2`?*  @2 &  6 @ܐ 6 & & , ( ,& 0 ("$ (>nP \    ,` 0"`0"( 0 ,"@& > 2#@. 2'  @;  `*`>1  `" "& V   R` > @4 >  # 2`V R 2> #t  @  @ " `B  & :@Ւ@ [ V  R` @ ``"0"`00"`(0,"@" ", (,"0 ("& ( $2,`  "  '&  "> #z   & "  B?:@'j`" "&  `B :@ 㿐  2D'0K= @?`D>1 *` > ` #"@b05     @ @L %" > ` #"@G`   B?: ' `B  : @I  㿘@( "  6`6` >@ ?2   ?2    @ b `B >` @?  4&`&`6` 㿐 '  R` 2`   @ 2V  㿘'` ` `@< "  `@4    ? 4 @2 "#   42  2     4   8  & '    @      4 2    ?  4 2i  c 4  @2 "U  @  ? @ 4 2I   C 4    @   424  @  ? ( 4> 2 > @ 4    > ?>  >H#0 - 㿘 `@2   ` @2 ``B > '&` `@>  `@ > ` B?> &` #:  8``B < $ ,$ $ $$ (`B?> &` & 㿘 $`0"`0& (0,"@"  ~+  $2,p,$ `$0` ">``2$>#h?"`>ې# $>Ր#`$ Z $` $`$`  "  "``[ $@"$ `@  "L /"? ""$, $  $ > #$ `J /2X @ϐV X`[  `[ 0~ $ Zi `'`  $  ?'''''''@#а   (U`[ P`$ # ?( ``[x $`*@@$`J /@ @z X `$`@/$ @`@ @d`[P  $`   @@2  @#  `$  >`[8 @@S$㿐$` $ `    "$ $`@*@$` `$@!`'J /2$`'J /"`""@$$`<  J 2` 2$ $`  P$`'$` ! `􀢠/`+  @ `  /+ `2#@`$`"`$`j ?$" $J /2` 'J  /" "$$` $`*@$` J 2`` `*@$``  $`  * $`` 2``J` .2 `J@ .2`` *@$``@"%$ ' @@`@  > #2@$$@r` "$`!"X$$`*@$`@! "@`   >#?@ ?X< '`@@0@K@>`@ $?Ā` ` `X <  $@   `*@$`` ""@$` "@$$` J 2#`  $`  @> 2< @"O  €@F 2j @]$< 2 < "<`!ې<` @@  @@"$$` ]$``@ =`` @2 @$`@(`@? `* X < %"  X < "` `@ @$2`@`   @!ݒ  ` `  @!ϒ @@$@u$㿘@*   "&`@J 2> #@"> @ "@@ ?>#QO  X < J@I @-E  < 2  @">ې ? %  X <  " X < 0@ @ 2@w  @!S     @@@!G @a@&@㿐>mb#\> > ܒ Ȕ ``  > > > " "bP">  " "`> !"!"`> "!> `"`" > @ " 㿘``" `  ` @U] `  㿘  UR 㿘U@ 㿘> v#>n#``@͒ 2`$`2  W4!@=!> h  U   $ $ @ $ <$ $ `> `$` <*  $ <` @  /,   YC &  㿘> " ">n # "  "  $ > pb  $ 2  >  2 @`h 2@ @2`d 㿐 >  !> b "H * & d`& h`4"H"H?# @ `>  * @ ' '0"H `'4"HƐ & dJ   *J8*` @ ???: H2 " X": " <" @" 8" 4" 0" ," (" $" D" " " " " 2 㿘> v> >c#'> L#ᰓ*` "L"LH /d * % #ᰀ > !`!>  ̀` L "H 0>  k ܠ@I $  c$   @@ @ 2 \ 2 DH 0>& &]  "  \> @>! ` `"``$ ` \"@ L ?$ LH 0 < @f > @q> БH /d4 t* % t  > H 0$ @$ $ <>    S$ $ $ 8@ & $ D$$   X ` d" h h h h d ` " X`" d` d h`"`" h㿘@  㿘@ 㿐?> &@!Ē   &@$ <@  '@ِ&@ 㿘<> v` #_ @Ԓ >` ?> * aȠ  !   @2< <@2 D `@? 逦      < "  U9 $ " " " $"" @h$@ @h@& @ @А@֒ >    R& 8& 8& Q$<㿘@@ @! "& @>  v J  D 3` L ". DH /d4 P* % P    \`2  ` `>  "  \`" ` `"``> "! ` \"@ L ?& LH 0  D` & D@v "  D? & D@  㿘 D 2 >!& D㿘> v #>! D 2 ?>!@>! & D@8 0P H >!@>!H /d4 D* % D  >}!8 L "  P>!P@>r!p `& L>  > ! < 2& \ & \ \"`` \""& ` \& `""H 0 @ 㿘> v #>?! D 2 ?>"@>4" X& D H >"0@>'"HH /d4 D* % D  >!8 L "  P>!P@}> !p `& L>  > ! < 2& \ & \ \"`` \""& ` \& `""H 0 `@ @O`L`P`D2`P`\"```` `> ```\ "`\> `\"`` `P"`P㿘 `` `X `d@ 㿘> v#@"2 ` @ 2* "  D H "#  < 2  D @ސ "` <?  @ > !& 8    &`㿈>;''cH'쀠`  㿘 D  & D @!"!>L"h& @`@֔@!Ɛ` ? @  ` ?@Z@ @Ȕ@  > "O D? J& D P >"H /d4 D* % D  >!8 L "  P>!P@i>!p `& L>  > ! < 2& \ & \ \"`` \""& ` \& `""H 0 ̐> ! & 8 F @ @?c > "& & @ & @v;㿘 D  @  㿘> v#@㿘 @! ">& @  tt 0<  X   <? 8[ D "W D@"@  `2"`2 @>k" @("6  !   @2 < <@2     @2< <@2 " ><"2 @ @ 7# @ @ 7& @ Sb &  D `:& < L 6H /d4 P* % P  >">  \` `"``" ` \" & \ \"`` \"`"& `H 0 : ?> ȅ(   2<@2"  㿐@?# *`@`@ * @ٔ @ `@?㿘 @(2 # D   @@   ` @2 < <@2  D  2 X >#8`<>n#ȓ*` `D>`H#@`P`@ />cx@; @`@ >c@3 @`@ >c@+ @`@!>c@# @`@">c@ @`L >c@ @`@(>c@  @O >#` >>#0#@㿐`->n#=  2$6 \#\`,-    `% ->n#k >n #   2$ l ( -㿐 > ! ` *` *  * Q&@$@&@tJ +> @`` @>  M 0  ('`X >n#쀢 >#`Ѐ`d   ` Ȱ ;0'2`> $@&@     @" `" `  2``< <2`"`  㿘\`  <"z $`0`4 P $`4 < "l$ <`i d  @ 1P3@<`Xy\ U `\@$d_,`d" \`f B d@$ g,  . 4 ` 2 >  ``. @2`` `$€@. 2  7 @"  $`0`4舔 P $`4 Q 1㿘 `  Q 1㿘 ,` >?bL`   (P $` ,`㿘@" < <& <! H " <!& < 㿘 v '>       2@8 >   2  > (`> X֪ 㿘H o@>t h> # >   @ @   >>a 0^ 㿘> v#쀢 >   @  #  > "D+> x*`" *  b* @? 5  0  @`"  0 &bH /d * % ⿐ 0 $ 0H 0ː   ?>  b? > @' @㿘`  2 ->  L  >nh#İ㿐  -\#\ِ 㿘>m"  >`@HN  t   t L`$ L`p) " t㿘>m" >`@H4   t??& t>3  L`  & Lq t㿘`IH /d * % >  `p .H 0@ٔ  H /d4`t* %`t  `p > H 0@!0H 0H /d * % `l ``P  ````P &````p` `0```P &``9 `P &-0 0  &0> ot "`lH 00+᎐0 &00 0 &0ɐ΀``l` `p >•j!H 0 㿘H /d4 p* % p &  0   0 >H! I 0 $ 0H 0 \`O0⬐0Ҡ`` >H 008   p  H 0>!H0H 0㿘>m" >a`@F `\ >!h &`\ <? 8?  &`D l &` l`"`  l& l&` 㿘>m" >a@Fϐ  \2 >Ґ!!P#!@  `"  "`   "@& L`"& \p 2& \ "Lx`"||"`||x"@& \P`2L>! "P`D \`"``"``> " `\"@"\> a`\"``""`㿘>m"  \>a@Ft   0"@`t`)&`te `"  "`   "@!P#!& 㿘>m"  \>a@FI  !P#!@  `"  "`   "@&  0 2 L L`/ l p 2,@ $ L x` |"`| x | "  p <   >n#>n#2   :    >n#@y #@@ & @ "` $@& 㿘  >i!>n# # @w   $  $  >n @4"& $" (`" @ 㿘#>ncc $  @Q  2 $ 2     $$c     4 $ 2 >n"#  <  㿘H /d4 D* % D  >!8 L "  P>!P>!p `& L>  > ! < 2& \ & \ \"`` \""& ` \& `""H 0 㿘#>n!> c  a0"`"`> `"d$c>n@4>o> ` @H4 L( L  x" | | | | x  L" L> d*` " x  x |d " |H 㿘> v#> "!>o>  >nbd)>  * #(@ # # H /d@ * %9  @  /H 0  @ @~H /d4* %  p  >n < ">n>Ɛ" #o ǐH 0>nc ?"c#(>o> >!Ȕ@ ( l >o㿘H/` /> ! > l!Ȁ@nܐ H 0>n#>n2  :   >n#`""# 㿐> !  /$  "`H> > b\X `" <#b\>n#@> "T22   : :` X  #"T>n#2`@:  X#"T"T#b\ b\$ 㿘  "X>n#ݐ >    `< ?`$`< @    " `< @$`<  㿘 D 2X  @ 0" x`"||"`||x"@L ?"L H"H 㿘 >\"H ">I>S"X x>o \  T i` Z࿖ ` D ''''' Ր T@`@?`@ 2`X H @ < @ @$ <  l  TY "0-  `!5 &`   ِ0 @$`@@Œ(  0  T& "0  " `!  &`@  . `< ٰ @ 0 >n0#@| 2$2` -  y  I!@|!>   F    >$ $   <* @ $ <@w̔ $  $ l` " < < `@$ < <>ߐ# $ <`  ~ @  $ <` `@ 2 <@&$ x <@@"&$` <@ $ < <@*@ $ <$ < <     I "$  $ R0A䭐 24  $> $`$  2`""" @, @5 < 2,   D ` 70 " I 㿐 D 7   € "> >`"#8`!> ` 2  $  2 `$ ``2`!> #$#P@ D'''''7 / X `l  Rђ "`<g0`<@ @ [ W    `@㿘`< ?$`<` "`<? $``< 2`` @ "`@ `  "@`<  > N> ``E0Q "> @`"``@@"@``,'> #8 $  "  TT@2 S ې$  "  TT@2 E ͐$   2 ;&``  " ` ">u"> `Ed`H  㿘%>  @+>   "`<` 2` ?$`< @@1`  @ "``< @$`<`ݒ@>  P@ @''''';   X `` `@`㽨@ @'''''! $ X  D   <>*@$ DQ  ߗ!','(`3!L@ @ =L`( X 2 `0?"`0L`, 0 jU`0,  D L`0?"`0L`,  jA`0 > <*@$ DQl  PR!'t'p`!``@}#!-> @@C >   `3@,@*`D`` @ `<>*@$Q'  P !'t'pݩ! a@`@> ` @( &&0& 㿐`@@  K (`0?"`0`, "i`0`@ Ք <   `@@Y @m $ `    ` €    @ $EP@ D '''''@2 ` &`P P 2@ D'''''@  " }{ $  $ 㿘   <   `@@ ݒ @ 0@: Т`(I410  ` @` $ ?* @ `0'`8'8$`\ '\'<$'d 0   ; 8@ ݒ   ?`\04  ?43H0&?"h g0H $`\4 2`4 02 4>o d"`4(" (  ?7 ? 77   0 @̐4 @ ;0`@ ɐ4 24`@ @ 4  2`X  <  `<  @ ! a4  ?@ K   @0/f42֒0@ 0&4`, ?"`,4`0?"`04`, hQ`0Ht0O| & D@'''''ʐ ؐ@w  Xd'h' X$€ `  OJ'T ``  @`b (ٰ H \0ؔX `'\@۵  \탐 2  FT` h T'T`< ` -  !@  \dT`<  @ k \T @ { \dT@ ْ T @ T@ ڒ`풐  ?T@ } e\T@ 5 ]\`T`H "`H\ `2`\ 2 \>o d"`\`0T."`(  ?7` ? 77`  0T@  T\ @ ǖఒ  TX.c\1Ӓ04`@ \ 2T@ t X&\`, ?"`,\`0?"`0\`, gE`0Gh \  X.7\1T GUN] %x@  쮐 2  Ft`  t@ t `Ȕ `ȐN1 2/0@ڳ  2'쁐 2   F` ,8 2, X P    <>*@`!'PڒM o ` j @ 't 'P'x'T'|AP ]` ( 쎐`<``$ /`* `  7 '8    2  '' '  2d` @ dtd@   d@ V>d0d`t@ @ Jtd *  -P@ @'''''Ӑ : <   ` '''''ܰ & "`@ @_  X 0 @ ` @ Ē@ ԰E  Bs$@$h 2:`  'P't'x'T'|}P -` d@ ˒t`@ ` ` 빐` $ `8 !7@ dd`t@ wCp P@ `'''''> . @2`@ @א h   ͞D @ IJĒ@   @ iQāP@  ''''' (`@ @ PĀퟐ01/ @  @ ]  @ WĔ@ 8 @)  2T L 2I  (`<  B ``? " `  ( 05 2 2   ` B)  `@ ܒ `` B`@ B < `2``   `<    >P`?@2 ` D $  ` $ @''''g'ܰ 2$ ``*`` !``2`@`@e @ v싐$ $ @ D'x'P't'T'|:P `@r`  KҒ 2'`[ `@ 'x'P't'T'|P `@N`  K 2'`7 `P@ D''''' `@ ,(@ '''''ݐ ! <  `` `  ?''''''''@ а`" &@ @'x'P't'T'|宐P 7` @ `@<`X < % `?K< @@ǒ ?  ؐ`'@Ð븐0@@ I  (@ސ`@`X "` < & `?J @@ ?  铐`'@~@   0" 0`, c`0`?@- @ @'x'P't'T'|P !` @`@`X <  R` /7@<10`?@8 @@ 1  (@Q`@n`X  <  ` /7@ @ K  0" 0`, c"`0@ @'x'P't'T'|䢐P F` @`@0X < 4 `?`?<J+ 2>n#Ā <@@ ?Ð*@ <#`7`''@Ꝑ@'P't'x'T'|OP F` @`@ݔX < 4 `?`?<Iؒ 2>n#Ā <@@] ?Ð*@ <#m`7`''@UJ0@@ U  (@p`@X < 5 `?`?<I 2>n#Ā <@@  ?Ð*@ <#`7`''@@F  0" 0`, b`0`  @ '''Ĕ  D耢??'?2@?'@ @'h'@'d'D'l|@ - P @`@ `X <  + *" " * *   * *''''@@鐐 瞠`  @L '''h  O耢??'?2@?'@@  =   (@`@`X  <  + *" " * *   * *''''@@A@  0" 0`, aZ`0@ @'x'P't'T'|ڐP +` @K`@h`<  @ؐ @@  `?@0@J@ 7 2(&  @`@.`<  @ 2ݐ`? @Ȑ@   0" 0`, ``0㿐@@ `  (`@`@ @ `0?"`0`, ``0@# `'''''9 2< `,` '''h'l'&h  @yʐ`x`|<``< `  `<  " "? $| @ @pĀ  @@h` @ @ @]Ĕ|@x@0@耐``" @rpnp=  "e=ؒ ? @ `'t'x'P'T'|ᢐP /` "d@td@0; ` '`$ !* ` 7@dd`@~t `P@  '''''d 2`<   " `@      @  @Ĕ@W@Ā0us8`  @@ '` 2`( u''`< "` l' `''''''''`@   ?  @+'' @}:  E`耢@#>o``  k``@  )`耢@2`  @ "`  X`< "` ` '  # (]:`  `'"@& 0" 0`, _`0 $ "`0$@ @'x'P't'T'|P $ `@   @F  `D `@ @@  㿘#[ 2R`    `0  "`0&㿈@ #G "  2R  (`< 2` ?0 "0#\``!㿈@ #" "  2R  (`< 20  "0```?#\H㿈@ " "  2R  (`< 20  "0```?#\㿈@ "ؒ "  2R  (`< 20  "0```?#\ǒVVVVVVVVVZZZ(Z4Z@ZLZX[8[8[[[[[؝8`,`d$b ;  $`(i$`$ L$`(߈ ` 2`Ր`'7@ ``@\`$ {#`@Ò`$``@ `墐 `h$`h }$`$a  D$`(P ]`<  T -bP d` !@c D`d< = @? 8 @P 1d"< 2 @ @`@c  ?@N @ ` H &H4㿘 X < " @ <` >T#(*`    @ " @ p    @" @㿘` H?$ H@ݐmp`d hl`@N'\ '''?'쀦 '' '@@ذ %  " @ 㿘( @`@@ > <  *  @Ò@$ @ C >@@ 㿘 ( `<   2   2  2  `X " < "  @`@Ӑ@>@ @$B>@@ 㿘 (@8@J "K&@&` <?`>T#L*`   ( 0&  *2 @ 2 >`86`6` &` &`&`>`0&`&`&` &`$&`(&`,&`@&`D&`H8`( <?`->T#h*` "@0@@ 8`$ " 3&"z@ T`@%!@    @T`@   a@$   "$!$` "`㿘 (@㿘a`@ @! @ @۔  "$ @>ؐ  Z  .@@2 @㿘  (oV 㿘 (@㿐>o  8 ''*` @㿈>o  8 ''''*` @㿀>o! 8!'''''*` @㿀>o!0 8!0'''''*` @㿀>o!\ 8!\'''''*` @㿀>o! 8!'''''*` @㿀>o! 8!'''''*` @㿀>o! 8!'''''*` @㿀>o"  8" '''''*` @㿀>o"8 8"8'''''*` @㿀>o"d 8"d'''''*` @㿀>o" 8"'''''*` @x>o" 8"'''''''*` @؁㿈>o" 8"''''*` @㿈>o# 8#'''*` @㿈>o#@ 8#@'''*` @㿀>o#l 8#l'''''*` @㿈>o# 8#''''*` @㿈>o# 8#''''*` @x>p  8 '''''''*` @؁㿀>p 0 8 0'''''*` @㿈>p ` 8 `''''*` @㿀>p  8 ''''''*` @x>p  8 '''''''*` @؁㿈>p  8 ''''*` @㿈>p! 8!'''*` @㿈>p!< 8!<'''*` @㿈>p!h 8!h'''*` @㿈>p! 8!''''*` @㿈>p! 8!''''*` @㿀>p! 8!''''''*` @㿐>p" 8"''*` @㿈>p"D 8"D''''*` @㿀>p"p 8"p''''''*` @㿈>p" 8"'''*` @㿈>p" 8"''''*` @x>p""' 8*`\''''''' @؁x>p#  8# '''''''*` @؁㿐 \>pcH'cH'8* @@㿐 \>pcp'cp'8* @@    㿘@  " >v! @   㿘@}  >v! 㿘@s   >o "8*` @  㿘  \ " @Z  `0("`0H /d * % h H 0  㿘 @ *@&   2 @+ >p  ! 8*` @㿘@  "       㿘>w!Ё  㿘>v#!㿘 @! "& @>  V  @!  㿘  @ `,@ ` `   "`` @O@` 㿘`  ``,!@? `4 2`,>  L? `,@ # mmmlk|mmmmyyyyyyyyy㿘> @ē*` @   㿐`X``  `<  <`>Z"*` > #Ā ` ?2, ` -> L  , * > b"* `$@ j L , ? ~  `D ݐ S@*[ N , * "> * b $  @ $@```0.> "* >  L ` ?`  > , #$"@*`   㙐 , "> c$* @`` x   >u"P 2 > v#쀤">t"` 2 <  >  >  *` * " *   `0 6  (` '>  `"*"> *c$" * ` @`   `h@   `  ` "  (`` '' ( 2@as N L=@b*@ > @bh &@ 8   ?'#\#`Ȓ ?n " @"@8 HHɞ쀦 "0tK"pɖ 㿘    㿈    >t4" 2 <> v#쀤"<>t("  > >  *` * " *    ` 2 6 >  ( b*"> *c$" * ` @`   `h@   `  ` " ``" ( 2@` G "F> @a*@ =`@a %@@ 8 @   '?Ǫ@%@8HG@ȧe쀥"s"͐ 㿘  < `  `,>* * > " b* `  * @ *> c$" * `@ @ > " c$* ` @    @ sF"㿘 `< 2``>  *` * " *    0   㿘 >  b `$ @*` * " *  `(   € 㿘 < IH /d4p* %p   0   0 >r" 0 $ 0H 00۠` >ؐ t p  H 0>"60H 0 㿘  p   F> !l`"> @> , #$"@ *` @  "    "     2" 㿘`  <`/ `U>̐ ` !$  3`!$ " ߷ 4 @!+4 * @*`> "@*` -```  `  -` ߎ 4 @!4 > * $"@*` r4#``㿘 ?  ` > 2 `#s  >Z(   "      㿐       #\   㿘>q#0zzzzzzzzzxzzzzzz㿘`>^".`  . .  .  . . .  ( 6 Ւ $&`  &`  ` 2&` # 7&` &`EӒ `@  `  ` `5` `"@&`&`  K" `"`"` 㿘 8  . 8 @   " >qm#h  " @@@ >q`#"@  2&   "& 㿘. * *  0; %> $#> @c?$b@@b̘   И b̒ " d㿘?> 2 b̰  .  * > bА* @@2  @c d>q"А & D&  㿘?2  . * > bБ* @H /f4 * '   pH 0@$ 㿘?2  . * > bБ* @  2`  @~ H /f4 * ' ?   $ 2/$ $> #0+$ $)$ $ > $> c0?  #!Q  ? #H 00I     )$    : "   " $  $  $ $ $ H 0 D H /f   H 0 * '  $ $ $ H 0㾐?2  . * > bА* @ `2`6  `1 `  ,R '`D ( <  (  /H /` * ! ` H 0 "" 4" " " 4" " " 0㿘?2  . * > bБ* @ `; > 9 8bt@bs@1bf@"/ bjbh@'bv!@@"bq@bo@ bn@"@  w "p@"k "m@K bo@"`08q@ bv@  bh@bi@"`/ f@xj@"`& "@V s@t@"`<  w@ bn@>c  ~@" br@" "k@bp@" bu@А}@"  bm@>c   v@Аbg@B 0 "l@bw@; 00"f@" `ΰ H /f * ' ` ``@H 0&`& 2 >q"   8$` &$`  @H /f * ' H 00 " H /f4 `8* ' `8   ` @    ,`8H 00a "_  \&` "X  @0S@P#l>c#p@[ D$`  @ >$` #l` @d&` @d>cȷcp1&&`4-&+,`:6(6&&@ !$`<,`; ?$` $` $`@$`H  $`L   $`P`H & ($`D `D&㿘" ( ,` 2 @@ 2S H /f* ' & ,& (?H 00b5,`  -#`l '@d !H /f* ' & ,& (H 0.8  .4  㿘N@ .` ` @А ( `>  @    0.@ $@ > "Ȁ`"@ ` 7 @`S 23@ < 2 1 2  @ 'H /f4 * ' @  .$H 0 @`2` 㿘 5 㿘`A?9 2  @*` *  > Б* @H /4`* '`  `: "` ` ` ?  `$ > #0"`$`XH 0? 0 ((> R`("Ѐ  >q؆\"`8 "` "Ѕ(H&4\(\ 2` \ 2 H <?0((> bЄ(@" H4`(`  `:` H㿘   0& 0 (@Ȗ >( L@E 2 0㿘 2 >l# 7@㿘`! ` @`   0& 0 (@ >c#0@ 2 0㿐    @ 4   $&  `2  4 r& 4& & & & N&  @   D` H L<| P  X \& X!   @ J$$@""  2" :`& N @   D` H L  c0 #  & $ & & & & Ns&  @   D` H L<& P X \& X˒ 㿘  *ɔ  &   *”  & & &   +  7㿘  " (+   " +  " (+  ( " ,+ܒ  , "&+֒ &㿘  *  2> >k#"Ȓ "@""""" "&""㿘> "Ȁ @" 7$> #Ģ @ 6( > b>_!@   `@ ,b !@2`  `> "̀@ > "А d ~   +}  2 & ,㿐`-    -0%1>q"И'D 2`>q"Ԁ@4 &"1>q"Ԙ'D " 4&"   T(D\d4tL,8p\d| (0H D"@ @6   @ " @ * ( (,  ,   % "  " @  @ * ( (  * ( (  * ( (  "  "@ @6   "   2" "   * H  $?? `>e!*`    `?2 w`  `H2 ؖ @ Y2 ` @ "@ @6  ` 2ذ A@ @ **  *`   ` 2 r@ @ *`  @ 2 ` @ "@ @6}J {@  @ 2 ` @ "@ @6 @ b, ` ^  * Y@ * T@ * O"@ * J"@-  () '  *# !  2   "  (  *    2  "  * "  0   *2  "     @^_     * 2    :*`2  % &-  6(  6#  944    ̔*``?㿘!> "h>lP`ct@"h㿘>q >q ("b>q>qb@6!>q*` ">q?`#@ "   ">hP#b@*` >q"'>q ` 6 8>q" >q"" >>q>q􀢠" ""@)>q* @")>q"**   ' @Z (? "$*   &@Z!>q" "(+ $">q">qb* "@ > >q"& >  @@ 㿘  @K @^ A@( , ( & @Y`(,`( , `0] 8>q A+  @2`, >l, , 4 " !t$`$`  `$``"``&  $`& $@& $`,  *@㿘 8>qb* @ H o *@ g  @C & H 0㿘H /f4> * '> "܀  @  H 0㿘H /f * '  @Y? >   ,`" @*`$@   2 ,H 0㿘>q"  > """"` & &   &  & >g#" "> ܒ܀ & ܐ "` "`"ܐ& 㿘>q"  > """"` & &   %ܔ  & >f " "& > b` & `""`d㿘 @2  4  a    @~ 0  ` # 㿘H /f * '  <>n>n>n>n , ;b@⤘"6 <& & & `&  > #,` " `>i (bt #>i`` > @$ >r`@k> `t@g `"  "`> ""  &"@`"`& "@  2 8<`"@@"`@> "#@<"@ 8>qb* @ &  2 8!>q"* @&s  8 "* "&l >   0  * @`" €  2 0@, H 0㿘@  ` "&@$`` "&`` &`"` &` 2㿐@+   @   €㿘@  @r 2  ` -@㿘$  L  А 8 6$`F L B`4 >q 0>qL  9>q"쀦 "$@\ 2 @\֐ 2 $  А  *` :` /" @R^ @,` L*  ?В$ ``L  `2&@>q쀠"  " > ؄     > ؄ ؝㿈> "ؒ  &     4>q"?`  ` @\r  "@ 㿘> "܀ , "%  `  2  @ @Y   < "   "   " @X    2  2  㿘> "܀ " < "  "   `@2   `"   @@XӐ    2  2 < 㿘     >q" > >q".  >q"9> "܀`4` ",` 2#  `` @@ @   @`* "  @ \ "   2``2` > ܀ "     22  㿘  C ` "? `26 `2 @XB "/``"'  @X8 2! # ``   @    @`  @  2㿘 ,`D ( `$`   `D` ?@~ &`D"` &`D    $ >l!t㿘>m" >`@Ӑ  < | @6 < " I   2   ` ` & & "` ?& `@1㿘>m" >` @  < |`@6 <@㿘`  & && 㿘H /f4> * '> "܀  T :   :*` 4 : `" @  2T :H 0>c#lKT㿘> "܀ "  @Uߒ 2    㿘0a@ a$@ @ay@ az@0!x@0, ހ@8ذI԰֐а 0ɰ a@ J <aH a2@ a1@a@Ha@` a@aI !F@ !J@aG@a@"(a@" H` a5@x` 0 !6@"w a~@" Dx` 0!K@"k q` {6y&w& @  Dr,w l <  H /f * ' ǐH 0 " < < 2 "܀ "f&@   @ `? ``   2 &@O > "1`. @ ` Ô e   " ؒZ  2 S   2  ? ``2@   ؐ   2Ȣ@S 0 "?@"&@㿘 ` ` & & "` ?& `    x`" ( <`2 ( 2  & (a 6 <? & ( < > 6 <   <  a7ذ 㿀< A A  y 2"8 4  @ X   8?$ 8 4 " 4 x "  0 4  @  0@ ? $ x 2 4P A " \`> #( :B A@ @ " > (' > (@ 2`* !(<( <  (沔 e (w7 0` `  `  ` @ <(K H沔 B  "A````"`8```$"  `?ܐ"   ?"  `` ?`$`$`   `` `` $` `l dh `7 ` [  7b  /`@```"`8```$"  `?ܐ"   ?"  ``  &` &`     $2Z 7      d H /f * ' ଀@&$   7ऀ 2" $$ऐ $ਰ "hఐ $" hH 00b $hp $p<$@H 00א㿘`Ԓ @㿘 <` @ +h>q  ` @"`  2` `  @S  >q#@Sڔ  !"6 l & l d  & d #  `   `" >c"$> ϐ *b ْ >  >  t |>  "  >c"$> ϐ *b  >r >rg  < `@0[2`X @ S  ` O*@"@J "% ?& & & 8 $#@"   "   ?`&&  B 8  &/ ^, ݐ0&H /f * '  @`"0 & 2" "" "H 0>   >q0 :*@ `*@`*@`> *"㿘!d      .!e.!f.!g.!h..!d.!i>n#X  %& . A. B& D. @ !d  A`Y &!l ,  㿘!l`""`"@ Ғ 7!l2  ? > @(2 ( 2    ? @  2 * 20G   * @ 㿘   "  ' /     >q#  >q#(   ^.@.`.`  `.` .`  .` 㿈H o *@ g    H 00Y 耊 2 alH 0L  @R  2  @Q  2      & H 0.  7ޔ   H 0  7  }  & & al & al "`&alal& ap &apH 0 4㿈H o *@ g  J " alH 00> @Q  2  @Q  2  2  H 0$ ?  & H 0  `"  "`  "@ 7ap?&apH 0 4㿘!>q#0@ #0㿘!d J  - @OO!d> ^  ?>s>s!Ȓ`p  & D6 <& & . @. B`&. A> ""07Q ,   㿘> "䀦"  `K  㾐` 2 ,>]  <   ''' 7 'q&`4! @" X4c ` 3^ A X & X h` & h > ^G L />  tH /f * '  @`"H 0. 7&` 2" "> "` ""  >c"$ > π*"ؐ  P  P & P` d & dH 0 ` "`T 2@  1@ @"  < @" A2 <>s ""  /  /" D "  " " " "" " 㿘  @  2"`>\I "` "`"@ "`"& 㿘 `` ``㿘@ 2 & > ]8 >\!!㿘 } `zx0!50 !6"&o `@l `e " @2@2Y &@& P&M& ` `&`&`&`&`€`   *  Ĕ ` .$` &2 02   ` *`$ "` Ӓ &`  㿘 8   @  2  >! \ 2 㿘 2 @2 $ & "@  뀦>qH"  H@ 2` @ H  R`  ` "``R`6`   R` `  "`  "``R`6`  @  @    ` "J2#  ` @ *J@@ `J@`  "  J   `?㿘   ` @9  2  @>       2 `  @ ``>   @8@ @@   @  ` 㿘@V``  ` ` @"``V` 6` ``2 @ `    JJ@   ` e` 20_:   :  ",@8 `` V`4 `E ?``2` `@ 2@  "` T4& + @8          2  U    2 @2`  ` 8( :` 0 ?2"  "( * 㿘@`     JJ@ *J 5&& "@ *:  ` ` ``V`8`     $ $ &` &   2& & &  㿐->  @ " @( > > "b E`'> ☤@>$?('> L? '> ☢$@4 !>r>r`<6"`<> "r , < 6☒"@@Kx$ <*)> "&☀` ☔@Mf 2 V`T  0Q  K @KT`0 0☒"D` >aPYy r 0/   "  $  `*`:; `>r 0*`J:`@2 $ $* @8`6   .  @ 2  :  @ ` *  㿘> b쀢  "b  ڔ  >aY  @Jڒ  6 .  " & & & $㿐  `     2  8`<  퀦`,T :   s     2 2`$  ` , `$ 2$$ $ $`? . & 6` $ 4  @,  ?`8` `T 60 ,T: @& 2 U &2` *`V:@ :V@&$@&`P-`T`:  0J  & E$ :T`@2"2,V<`@&!4* "  ` >aX. ӐŒ ߐ 2<`V@&$&㿘 4  @@K" 2 `       2  `"T O > $T aWА հ >aWȐ 8  ? 2" T `8V @4,  V @2 >  & 2> #b""b쀢2 > Wa   ` 8 2 & 2& & `  ```" >`2``"> "`b(Wg   bȔ  `2"`"`" S"    `2"`"`&`"3 V  "*#2## & ? " > b""b얒2>>bHXW  v  "  " `2"`"`  # ` , , #㿘V  6   `2  "   V  6    @   2  "  㿘  t1  }  "+ @H t&> "f, \ , 8$ $ *` 2` > ">x>w>u>u>y$` "blܘ"$$ $$$ $( 㿘>  ` !> > `(4"``> !> "`*`>bxVz 0)  1 #>  $b>V9""*@H2@ "> b>   "⠀ " +  *+> " >V"㿘  >r 7 @>rD "$    4 4 > bb $b" "b$  㿘  "``"  "` "@ 㿘    (DT>  㿀> "'T'X'P'H'L H  @@2@ `" `@28  "  @I 2.  @I 2$沔 ɖ  LZ C  Uఀ    2 L= &0 9ఀ  0 㿘 `  k -    \ -J`U.`>z"d   M I "F 96C "> 9A0 8 1 8$ + 9 `€"  $ #"Ӑ   2   2   9& >T"Ȁ㿘>   "  $* €  2 㿘m> #㿘` `@  `4  @ &`` 2   X > #*` 'H / * '  `3 `€ .> +c`"' 4!" 8̒     @( ' 8 $ 8  4"  ` 8 $ 8> c`  "` ` @FO 4'Đ@  H 0㿘`  `@  `4  @ &X > #*` 'H / * !  `F `€ "A  2= `5' 4!1    @ "' 8 /$ 8 " 4"( @E 4 ' ' 0' @ "  4 ' D' 4 @ 4 0 8 $ 8  > c`  "` `   @E’ 4'Đ@  H 0㿘 2 8>S"ؔ?-& 8 4 )  > >S"b? "b>"U0@  @u D`" ` ?"`    㿘 2 >Sw# ? 0& X >m"  >c @ X  i 3* @'  0 @2 @GE 2  D  2 A`<" "4  4 * 24"l '''''' @+``4> #4>  "4c  @I A  ``'@@`> c "c $@D 4''''ܒ@2 `'D@Dϒ 4DD '  ' 0' 4@' @  D`8  "`8D㿘 4@@ |ѐ 㿘`>4!2 (>R#02>}>R#`c -㿘   퓐 Z퉐  2@ "   8 4?` & 8 `@2 D  D "  `@  "`@DD 4''?Ȓ@V㿘 ,   `" ( ` 2  (f " (` & , ( 2  (  " (& ( ( 2& (    "  "   ,`" & (`    $ $ n& ( (`" 3 , ` & ,㿘H /` * ! `> c* @`  /`$ 2&` " ` "h`(0L0``   4!  "  x>Q# $`x  8 ?$ 8$`x`|`"`4`8?"`8$`|`4`D ? $`4 > b "b&`8  $`8Ȑ0"  "  4a2 D @ v@&`$ 0&` H &` ` &`$ 2`(! `(  F   7@CK `$ $ 4$ `@` r } 7`  `@ =`A 4`   $ $ D  $ @ P`P ($ |`8 "`8` `  ޒ @4@" 8.` ` 8 Ő?$8`2  ?$  4@@"  x | " x1 x " +      " 4& 8 $ 8 4!!H 0㿘@ ?     0 "  ?  8  (     2 & 6 ِ & x @& 0&   x `8 ?"`8& x 4  < & x P 2   T" `T8& T 㿘@.@ @`.@ `     .@`@ *@ @B7"X ' `0     2} 7 Ē " 8 D?@$ 8d 3b A L$ D@A 4 ' '''̒'```   @ 8 ` $ 8%`24`21 "- 8 D?!$ 8>#Q0 D    D` ?"` $ D $ @   &   @C㿘#>r`H " > >>>#cȖO#""!> ">7scd>c#l7t" $`H㿘>r H   j   @Ao && &  & > `&  "`"& "㿘3 `"  "`   "@` "`&  `"@ "  €  `     f   ">?& P   2  ` "`  " 㿘$ `"  "`   "@`"  "` "`  "@ ` ">?"`Pf P)  2 㿘>  #4 .  2&  `"  "`   "@`"  "` "`  "@ ` ">?"`P3   2       7@@ $ $ $ $  $   "`  & $ $ $  "&  `  "`㿘> #4H /`4> * !> "`@ 1``"  "`   "@` "`$`  "@ "  €  `      ` ">?$`OÐ ` " ` @ & ``2`H 0>c#l6+     㿘`      & @@' `( &   > c?"c > c`?"` > c`?"`> c` ?"` > c`?"`H /``* !`  > v#쀢 2  Ӑ `=  :   H 003  > c "c > c` "` > c`  "`>r> c`  "` >r \> $ `3"  @6 H 0P'L'T'X'P'H  '        2 ԰ 7  2 >M{ Ѐ`K(' @'s   ^  'k 7  %> v'_ + 4&@?R 4 'L@Ɣ`' ` 8I Ȁ "  8A Ѐ " ~  "7 7` @ *0 7@A$` "* 7` '  Ԓ " `> ԓ*`  "   8 D$ 8Ȁ     $ @FP`8?"`8"`H> c* @2  / ̲ "ݸ ` "׸  8 $ 8 T  0 0 ' 0' ' H' 0 @`"'` ' D'`< "' D '`86'ض @ @     " 7/  @v  4$& P (~& = zȀ   m E " "` `؀` Ȁ   "Ґ -&`D؀ ! 2 ` Ȁ ``4` " ` `" `D " `D  `D` Ր?"` &`D`  '` &`@ $@m`P`D "   Ѐ 2&`H`P * &`P $ &`P - "& @& "= @ > # 4   |1`26`Ā  >r2 n ~!  | "@~    >r>r>r`l\L` 6`  `" `" @`" `" ` "  `" `"` " 㿘@=  :  *$ ?  @ *㿘  T   L h  h  Lh$ >KS {   `     { "0  & & & @=6 ,`  @*@&@ ?   }t@,  ,4,{Ր 㿘 &@   L  T L2 ,``  @*@&@ ?    ``,`)% $  &   "      &&  & ,,4㿘> # `7 @ " " @>r`l " 22>r>r `l\ǖL`> # @<| 4   D` 8 @4 V < $ >r l$ >r>r \L3 `> # ` c  @r "( '0'' " 82`4`"` "`"` >r `l 22>r>r`l\L<`> # @; 4   ` 8 4 @Ak >r l4 >r>r \L3 `@    4`@K @;Ē 4 @  0' ' H''  D'@'< "`'  ` "&` ""` 4 4 P$  t ($ 5 $ @`84 $ $ $ $ ` "`&`&``@;y 4> "܀"s ``" 8@2g `b @'Ԓ V``O'` "L`` 4H`8@4 T< D$  $ ` 2B2`"@@ 2.`@ '`'` '$````"`` 4``  82` `"``$"`"``^` "`&```̀ '''2` x  f `a  @: '   ''''H /`4ؐ* !؀ %   0 `` > #.`  `@2`> (bp `0>H 0  䀦@ '"  &  *` * " @5u &㿘H /` * ! >c#l>rؒ0o> #`` \ @> #(8@ `2`H 0㿘>r`0 `L> ( `"( "(!> ">07cl>c#l08"`4` `@ `@ `D!@8&`T0Ԁ "` `0"@ 02 `4` ?a&`4`4a&>r` f`@>  @`0,`@ 84c(`@&`\ @ `P `T!@ `D &`T@" ` ``@ @  > 8`@`` @,`@ 8|4  Д   &`L>aH  0oY M > > #̒`##"@9Œ $``4$&`4> cc $@c" "c$`> #܀ N  `@ "H  2 <`   H@2 < ; &`\`@ ,`!d ; >r > "&`@`D '` ?"`   $ &`D> c̐?"c@`"``"``@"@&`L`4 ;&`4` "x. 㿈 wŒ  4 `$ $ @9T$>q# (4  4`(  4 4 , ,  ` `ݔ `ٔ   // 㿘!>q#= "  ^// /   / / r/ `"`L @> 2  `2 `\>a8G4 wZ ``0> #(@( <  2  <    0C < 2@  "$ w$ `\ 2 `\>H>!`> #(&`\`\`"+ `4 ?&`4  > #(@"  > #(>r&`\ ` @  $ `D@`J!d  >r `4`\` &`\&`4$  㿘>r 䀢 ZH /f * ' #>r`䀢 ` $`"`"`?"`H 0 > 2 >Fr!  y  &` " w% `  *   : yp ` h@@  `w  `䀢 x  `  `֔ ` ђ> #܀ H2<  @2<#܀܀ H2<  @2<  `@  2``2 €"dH`@9   ` >qc@9۔   ܐ@'>aF  0܀'@ΐא>aДE ' @`? `~`0z : `@9 P`4@ܐ@'樐>bEǐ 0^`@ @'`@ 敐>)bH@'拐> bE $`\`@" 0`" 0 ܐ@f'`@ m>bE 0"  `,`  `\ > >r#(`ܐ $`\`4 ?$`4 `$` $ u0@  ``˔ ǔ @T  `` `0      (5`5``  (4  // 㿘 `2`8>D" $``0" `  2`*& `4 ?"`4 `    㿐>  *Ԓ @ .&6 2 8'  4? dd& 8 0  " L`@'> Dےc 8 4   4@    N 0  -㿘`H (!d`>`0!&`&`㿘      *   h@@0u)㿘   /  >r0) '0%!  >r!  @#>ra > ad @8=  > cĐ ޔ >  cٔ  $a> &#t㿈 t  3 $ $ @6$>q#   54`  4(  !d 4 4 , ,      // 㿘%>r  - >r#>r "a $a??>c#l>2 > #Ȕ0: $ #"? $a> #k > #Ȓf   3㿐Ȓ㿀  `/ `8 >C#8 8>C#X@5 /7  '  '      $@ `  (  @? @#  "" &* 2`4 ?# 4$ * @,  ,&          ߖ ,  "5* 2`4 ?# 4$ * 2 4 ? 4$ ,        ?2 * @ 2b >D?#x?# * 2`4 ?# 4$*?????;;;<$;> >  ԁ 㿘!> "䀢  @2  &    2  8     """" $"&  ?㿘!> "䀢"  "  2  h 8  " """ $"  㿘> ""  2   " 8㿈%> 'L'P'T'X'H   $`$ ``s$`0  ` : uN 2 ` $` "& & @ `r"0q " & & ```0_ 0\  $  < V `2Mv  r0K"`"`8 @2D > #'' ` ``t`<`'`'`/`2` 2@8 ?    &`@7 2 &`> "# `` ``t`<`'`'`2`0< 8 2 `rk$ 0`" > #'' ` ``t`<`'`'``2)@8 "@@ 2`?`>"*` `( ñ&`@7 &`> "#Ԑ &` `` ``t`<`'`'`2`0 " < <` 8 2Z2V ?@> #܀` > ` 2`<`> `0& > #܀` ` 2`<```t`v``"q@ 2``j&`` "`` "` ` ^ \&`  "W U  " < O<` 8 2" `q"0@?@> #܀` > ` 2`<`> `0& > #܀` ` 2`<```t```@ 2``&` `" `?` >"̓*`  &`@!㿘H /` * !   ?8 &   < 2& ?@  & @6 2 & > "#& H 0㿘    8 ?   <     @ 㿐#> cԀ QH /` * ! > #$c'' `4 `t`< '+  ? $   2    @L   @G  $  $c ` `t`< ' ' 2 H 0H(> 䀠2     2H@ u  ;> #` @ $` $`$` 2* *2" ""` ` ?$` $`*, $ @4 4 ` `  $`$`   /'/  @ݚ > c`  "` >r$> ܀`" `,`( " `<`2`, > ܀`"  `4`0 " `<`2`4 <  8  ?     * H"*  "   " * `` 8 2`*  㿘@1-   . ``:` `*`?&@ #: . 㿈 !@  !@ 00!@0  "0 T@+' > #܀   2 < a@"'a@"< a a@a@2 a0a#@ a!@{ !@  aa%@q a      2 < H@2 < !@2  "ڰ 1  O >>#2q    x@0 xH /` * ! > $ <c` <$ @`""`$  $ "& D T d $$ $ , d<   , T, U$ $ t< > c "cH 0/      "    H ``<` ` 2`<`H 2`<` ` "  ` 1a@a@"8<a @0Da@pa@0<0a"@"<  !@a!@ 0-a#@ a%@0%Y D< RS T MN TK d  H /` * !  T |  a  n H 00     $ 튐$  텔 H 0߰ <  Tٰ I ԰ H /` * ! @  ’ H 00$ 4$ h   H /`4 E* ! E   2 D    H@" 0  @k d0  h $ 4< "! 2 @Y T    2<``"<@K <  !   T ϔ  Z H 00NH /`  鞐.* ! @ ` "`&  "@ <`" @ @"`@> "# @ <"@@ t  Ԑ?$  H 0   - 2 ><ː#!@ "!@"ǰ -0!@2° - @" 2  2  `  2  @  "  8  !@ "4t!@"  -0!@(t - @2 @.} @  "  //7 ah@._  @0(tt @@ 2Z   !@t      2 t  2  08 1!@2x D D˒<  T TĒ0@.!ΐ h&& @. @  D D<  T T d d a㿘@㿀H /f * ' `D {    a   l H 00]H 0>m" >c@  &@&@ ?0  ??&`,`4``,&`h&`4 &`,`,`d`4 &`(7&`0 H&`$ <  `0`42`,&`X`(2 &`8 @  &``U   @U < 8 '@Ð㿘 X H h > #܀  <  "HXh @ 2<  <2      $ 㿘` 2` L <  "`H`X`h > #܀ "3<  <  " H X h @ 2" <  2 << ` ` Ԓ ` ?$`  <    ǒ    $  2 < ` ` 굒 ` ?$`?. ,`20`> , ")`` "%`2H"X" 8>r(" 0" (2  2`@ 2`< xH /` * ! %> ܀` ` 2`<` `t  $@      $ 2   $  [&  6f  2 @H 0S  && & ܀ 2<2 &  6H 09 t & t "`t"t&  ` @// ' a1؀  `"  "`  "@Z 6H 0  vH 0xH /` * !  ? &  `"  "`  "@ / '  a2 6H 0㿘&&     & >9ؐ#ؐ    & >9͐#6 >(0 *`0 *  * 2`~0> ( 2`~> 0(@ ` *  㿐!>r!< > > ` #\ ؔ  0  $!<>  1 v 7@+ $ $ @>s >s, `>s, `>s, `, H /f4@* '@$ $ ` &`@" &@ >`` * @  $ ` ` * @" ` > ` * "@` >` *` $  < (  `` * @ $`` * @"  < ( > ` `* "@ < ( > ` `* @$ H 0 & ?$  㿐 @>  > v#ܨ c쀢  0 " > 2  8 2  "  `   ` `S ` ` `< 8 `6`'@  - ϰ 1 2"- 4  /#~ 2 ฀ > `4  `@&   >  @ ฀ 2 0> ` `@ " ` @R @2` 0`& 8 26 > h  >r>r!6a: A #  "X  >r>r!.a2, ,2 5`@8, @.&@$, 4&@4 \ 1?* 2`@45`: 4   > `  8@ ڐ76 >, |@.[$@, 5$@4 & 1 * 2`@ 45`( 4  R > `  8@z ڐ6 >@E 㿈` `  \   " V / I> #܀`"`8  ? `H2 `8`  < "`8`X$ `8 2`8`@R``@`H 2 `8쀢 . 1'* `' '` @g`> "`8 0 2 `> 2   12   1$`8 $`(  @4`<㿘 @   "& (@6 < @  @㿘 @ p"` " HhD H @= H /f   '"@* '  `"  "`   "@` "` "  @ "`"`  @ "`H 0 >  1 㿘` &` @)6  , , >4  8$ 㿘` &` @)&  , , <4  ($ 㿘 >m" \>`(@  ` 2- ``2@' $ (2  @ . <2 @2  >/ 2 @2  8   Ā2 (㿘` `` (2  @   ` H`& H@( 4 L'`0'` '`4 `4  ` `0 [`㿘 H & H㿘 / 7  /  @  9 >+020  ( `2'  <.02!  8`" 8  82 `````"  @6 `  2 >㿘 H  H@(C  @  `2  (  . .  (& 㿘@ ` @28 8 9?"8&@2@@ "  @ 2@  .`.` &`` @( @` `@ < "`D 2  4  2 4 * 4 > #܀ 2  13 &@< 8 2 D" D> #܀  2 <  D 1'  DH("    >`` ( "`` ( `>` ( `>` (" "  <(>`` ("`` ( <(>``( <(>``("H 㿘@.6/  @7  . / (2' <*2 @2! >+ 2 @2 8 2@ ` "` "@ &@" #@&  2 (  >r!@  *+ > 826x3 㿐@'>  >  > .3`    *  3` >@2 < 2 8@2 ( 2 /  .3  *  3  >@2 < 2 8 2 ( 2  >r!@ >. x62 @` "` "@ &@" &@& uuuuuuuuuuuuuuuuyXyXyXuduxHyXyXvyXyXuuvyXyXyXwTyXyXyXyXyXyXyXyXyXyXyXyXyXyXyXyXyXyXyXyXyXyXyX㿘>r#0 >r"c4㿘` @ , > aX "aX`?@ ` 2%`!  @* @          > aX` "` # ` @Ӕ ` 8  @ @*  8   (8' dW     jH    d i   &  ܐ"   ?@& `( >3Ӑ > !X .` ``" *"` "*  `2 *2* "* F2*eΒ   2    $?쀢 : >3   & & & @&  * @ "* 2* 2`  " ` k" k_kXd?0d< 㿘 @W㿈'L'P'T'X'H '@` $> aX` ?"`@8 @ :  ff 2 > aX` ."` "@& & @) > aX` "`  "@& & (!> !X*  `" `( >#*` P>#l.    A!X <!X 7!X   j `# !X  *` @`8 !X` "`< 8 >r#T#  > " * >r* aD * `@  0!X` "`>r# 2M/  # !XF/>r# >r#  `  # !X`Đ "`Ā`] @/' ,' >r# ~` R!X`>r >r"#h `o>r)#d j /`h'  2  `  < 2`X " `X&   jc !X``  "`* `@N" 0J  jP >r#, >!X`#( `  *` @`8 !X` ("`>r#t#  >rcd"` !>r#T"  ' Ț쀢 >r#0 >r#4> 6`쀢 #Tl#Ta @U0bڐx    '-   ? ?  "b`>  $c܀ >r H@ >r  < " < X@2 <>r#d  "  `  2) Hؐ@#Ԓ ܐ *` /"`ݎ؀`2`t> T`b"T{`    H`D "`t`8 ?"`8 H $ a,@ ͬ   b    `%` "@`"9  D 2 `` 1 ` %` $ $`    ( ` `@ހ `  4 `  ` * `  %` "4@* @ $  "`&  "&     |6 @ `a㿘   , "@& & 4`@!"@4`  "@& &    @ _ 㿐@:T@$fa* &. . @#㿐`, @   3>r xc05>r4  c0`ᙒ &4ᓞHc0 i &4  *#\ >r#8  㿐ܪ  "#  4 >s 0   ށ  P (c P>s >`ː  㿘>r Ґ#T : 2#P T `   * $ >r`#@ D>r# #*@(P`!'`@ D` "PT "Tܿ 㿈 2 4>0j ؐ  2  P     0   4> ">r* * aD * `@   0 "& T㿘>r#$>r> !Pǒc(`?㿘 2 4>00!       0㿘.`    ,`. 2`<2 .@#^2`. 2 , 24 .@#T2` ,`6 㿘A%?)> 'တ @&%"#c4 >  > 202b > ,2b%""` 2 #>  4b > 2b 4bb @%*   %"@%c4 %",2   >!8,  ,`@%ޑ2 *  2 ,` 2  @"c ,`2` >r  > c( ?` > >r> 3""b03c㿘#>rc!/@ > #(> b􀢀 ~ !> > ""> b @"a?4"> "c@ > *`"2`A4c> b>r@ . 6 `(HPPPPPPPPPPPPPPPPPPP(㿈' `1>  `>#\ `#@0 #x>aL >a\ > >  ah #\ %Ŕ   ]ݔ   >.̐!p>rD" *"@ *`" *  *  * " * "> :*$D>rb   $>  2bR  D" *"@ *`" *  *  * " * ":* b 4*> "!> >s "`> #"#"`>r# >r#>s"`#> `@ s   (@`2*  * @#  (@ (  > (> ~2*@ ` ( * @ " > >ax @%ǐ `> >a @% > >#Ȓa@% 㿘H /f * ' > t` t` "t""`?"H 0 ` ` >. !@ 0ց㿐'> ܀ !> # $#  #a   2 `  $`  <@  #`X "`X2 <8 ` "` ` 2 #` "` ` "  ` 2    < 2 #`p "`p 2 ?  # t `" " t@䖒  #` "`& #`t "`t`@6 > c` v"` > c` m"` >s 2"@ & & `E>s" @Ɛ [`'@X "`  < 2>``< 8 #܀` `    ``<`" ` 2`<`  `t 22` > >r#䀢  > (`]"(0@ 0`?@>    `< 2 > c`  "` H /f+> * '+> `   H 0  > %`H 0 > ! " ` @2`  @2 ` @2 ` @"` 2` ``"2 4`*` `*> c`` "``H /f4%`* '%`H 0 0* 4`*  h > #'>s>s`  $@d $dH /f4%`* '%`H 0 0q>  $ d $dH /f4%`* '%`H 0 0U `$" *"@ 2@H /f4%`* '%`H 0 0: $@  @ `,4`@H /f4%`* '%`H 0 > c`4>  "`4 `  >r* *  aD* ` @  0\ߐ> ܀=H4 <>r40 '>r`"#<`2< <"<X`8 `0`(2 <`  `2` 2H 㿘`  ` *`  " & -&   궔  > > aa &@" "a&` <.` .`  6` &`   &` y&`3 `2^f` p `     `  耢 + `2` 2> ` ` `@` ` @( :`    $ 0`>  ^)`2``"2` @ "@ "@\` @`"``"``@"@> %  >s`?"`` `  4 2 ` $` " &` `  $ $" %$`  `  `` `@`@   o `? c * @  > h`@a"h] ` -> ]&@$'>s?`$ $?$]y2 5 `% `% @`"``"``@"@   * @&   *  "@&    @& > `[f">  $h>s` ?"`㿘 "[S `"  "` "@> $L >s`? "``"  "` "@ꢒ 㿘H /` * ! H /f#> * '#> `   H 0  > $`H 0 > ! ?  *>   `" 2 H /f4$`* '$`H 0 H 0㿘H /f%> * '%>  "  H 0   $H 0   "#> a  > a`R"! > H /f4$* '$H 0 㿘 2 `2"> !>s *` >s : @?> h  -` `  ` ``  ? $`D"y``QԪ%@`2Ъ%@>r#쀢 "   />s $V 2?`%@   '@%@ `2 m  đ@'ԔÐ H%   < , 8 @ @ ?  ? |>s `Ԑ #>s `  H` @'Ԕ HÔ   c, ꀢ`$逢` 2   *` ? 'I%@ ?   "   -$@l %$@  c>s " ą 'H   R>sВ`u >së  /C '̒ ̒a  /%@` ``  >r#䀢 @; 0 . 'Ԣ @ % 'Ԕ>a(ɐ   ?  ?  $   > c`P  "`P㿘>  ?` > `"  `8 ?"`8> "   > $ , , >    DԞ > 㿘>s   @>!) + > cޔ?2 >s> "`"㿈   //'7 "D  4 $$2: 8 0  > 3 8d4 "܀`"+ 8` "#` 0  @2     `@ 2   8 ?& 8 ?  2``2`  8 ΐ?& 8 㿘!>s  X6   E %>s*`  & >)6! > c* ?  "@ >@)%"  *`*` `R  `   >@)"> $@#?`> #>s $@>(" 㿘  @` ` , ?%"  "`&  "& @* @@$@㿈->s     >` "(`( ` ! > `' 2 `> (`X"(0`  - Ӕ> >  ,`  `@    8 ?$ 8> "   ,,`!> $       0` D4 XM  " @ @ `Z$*` @ @2>r 4 0.>r  `(>r#耢 $`#>r >r D#4` 0 >r 4 "` 0    >"H (A>r#   !> #\  @ > c`(  "`(> #`$ "`$`, "`, A> d*   > c`L  "`L  W^0  㿐y ?`i>!l*` `>  L h  >r #_3>r  cc` 5>s c>r#J&c F3>s` B `怒 ;&` 3>r c>s`/cߐ 0*  >  `J !  >  @   > #6   >s -#\ ʘ08@LXhhhhhDLTxhhhhhhh``````````p\X'X'H'L'P'T    >%"``@R `@<`* @ &@6`@=  `*`*  > 6`&@c`8  "`8ݐ #&@ - ` ` @~ 4 "8``@" 8 ߐ?"8&   ,`,@`$`"`n 2  >    DD.`< 8 2 "`> #ܠ 0 D "-`<")` 2<#` 2`2 `T> c`Tǰ Al 4&`D`@ D`t "`t`4 2`0`< 8 `H&` 2|`2@ 4 "8``@" 8 ΐ?"8&   ,`,@`$`"` 2  x>    D@.`< 8 2 "`> #ܠ , D ")` <"%`  2<`  2h`2`T> c`TE A`D`@ D`t "`t`4 2`0` 2`H&` `< 8 2x`W`!"7`    .`> c`T A` T <@ > " `  < 2 ` > c`T 3 "`T  > #܀` > ` 2`<`H&` > #܀` ` 2`<``t% `    2 "`   "`` @` ?'` @`  < !TҐ'' "` <   12`  D@ (`! >7`"`  " `  P 2` ` 6``    0 "`@Ɛ`  ?"`  0 "`@` ?'` `8/`  0 2 6` ` >  '` c`x "`x6` @ژ6` ` > ƒ`a,  "a, > ʒbx`0 "`0 =@4   (P >  DT 8"T> c`L 4"`L@7  0,Ͻ 0-  '` T%`2` > c`D "`D` `8 ِ?"`8T㿐  -`&'SѰ ( "@ ?& @  i Y9  > '@#  & z `  c 6 @ > `**` $& %?Ȑ*:`@4  @ 4  & "@ 4 4 T  B&& & ` `0   >  & c`x "`x4 @ٵ4 > # H`" H`'% U|&   44` `0 24  >  & c`x  "`x> c`< 7 "`<4 @ف4 H /f * ' ``"    > c`< 7 "`<` &`H 0    S*& 2㿘 ?` c @ I` 2$      $" & Xa  6  y` &  ?6 `> &`   & & &@㌰&    & yɔ    @& &  & z$   y`& 4 㿘  , ?쀤 (`  %쀢  ,@` 8 >!"x  >!"xy@$  ဢ & ,@  `㿘`  Т r u 2ʰ`g>" *` `@ "\  2W  `R>" *` J.`mH.`t`h B&`h ??&`h`h 9&`h ?6&`h`h 0&`h ?-&`h`@' "%  2   "`h"`h " `h  ? &`h ?ߐ  &`h ? &`h - * ]QɐY`S>!*`  Q '` "F$  $ ` x ? Q ' `)$ >!*` !`m`t`h `h2 `h2 `@ Ql ' $ `h  2    "  $ "@ - *㿘 `Qg`&`  `T Q[P Ka`   E `&`  xߒ`@ϒ `$3`  "/` `  - )'  2$@` ?&` ,`xN x`$@` א ` ,& Q  㿀@   X 5z &@ ,$,4?`>"*` "  2 > $#܀`  `H2`<`2` ` T`<@"Ӱ 1$"ΰ  2ʰ  ,"ð  2  8 ,"  2 <8 @@ 2 >  /' *" " 1g @`#܀`  `H 2`<`2` `l T`<@h  6  , `2 @@2  g 0c ;@,  "@ Z 7 V4"S  2O <8  "E `>  #܀  H 2<2 `"2 1  `,   2 ,   2  ,  1冠 6 , ?,  & `?4 -  @@@@߮ 5&@㿘 OҐ   &0  # -0+ ``"` @`> #܀`""` 2`<`""`H"" `` "` ` ``"` `*  -㿘    ,  @  , \ 5㿘沐 Pf  ` 4 `@*`4  㿐  @ +   " O * ` 7 `  <c7 `   0 , 2      Q90 2@ ̀ 0d͜ddΔ\ddl΀d㿘> ! 㿘 +> a->s a"`@@ `u`"`8 @24``8`"`( @2,``(` @2$`沔 Oז  Lch OQ `@bcఀ  `@`a@2 `uL>sacI O20 bEఀ  0      > O> # 0 4" 4" 0㿈 'P'T'X 'H'L h `M  ?`#@L ``" 8`  $"   ?ܐ"   ?"    ?`& &  O#        & 2 E 7 .`6` u.`  6` 8.`&` 1&` ?#N/ ( @@  "`  `@ 2 <@6`N  > >6`> c`\ "`\   H㿘`  C  ?N!쀢" 5k3d1 0' `" ` 8`    h  ?$ h M\ M ' "  h`  "@  - M 㿘``  K ``2 `.`>"H  "`>M" >s !>sa6 x> a㛐 q`n, u` "i 9` >+"垐_ > "܀ "U 1? 8O 1 "K$ 8 "F 1C$ 8 = > "܀ 2 `6 1? (`/ /_$ (+`'`   8 (2 9    -嗒 墒>ː"ȀM㿘> > * "@*`"@ *`@ d""$@4 4 $  ttG!hd t@!hd   t9 (4 p @ (4 p888㿘 x` @+> ʐax 22` Ѐ@2M, `""`"@` Ѐ@" @> Ɣ`M"ǰ ` ``@` ` " $+>   `$ # > Ƙ   #   ;`BL; ax0Nߒ"&`&`> Ƙ  #  Ȓ ;`B; L` @`"``"``@"@ax`"$ `` " $$ 6@ " "2` N $ 6` $ $" & $ $" $$V d $> `": `  Ѐ@24 `  А & ` @  `$ `@"  "` Lg` > _ L> ʒe!x    Ѐ@"`_i L   %> Ơ | 'L 'P'T'X$ |'H'7  # ''7 2  ` `( L&0`  N   $ :  <8  r' e܀ k   " '@ :4  2 ?߀ @ !( `" R"!(@* ` 4 $` F"`& a( "a(  2 ,"> ƒ`` 0"`4' @ : N > ƒ`` 5"`"   '` `$ ` 2 @@B @2  2   '`'` '  > '"\'oئ 2 D> Ƹ ! '!' R > ʖ@ "\奔2D! '!>sVd Đ`'|L-@  r@  @  w> ƒ // '/7/'7  > d7  pr (  M` %`@ ` M`K#\@  A?"w  D;>  P@(Vd@2 W 2  2W 2> ƒ`a ]"aW 4@Z#`#d#\@ M KI Vd`#> >"bh` &0>c#l> ʑ2`@Xt4:`4` #\@A %Vd 2 P`7 2 P耢P@, PЀ2 P " P2 P @2 P X"  bh&T&P g"@ $ P "@ 4 P$@* PVj 2 P!> Ɛ !` "!bh"@ @k`4" 8" bh@\"@   |" `` <`B ;`#`_JL& @20 2 >c#l2`@Vhs:`^ ]D |Q @Q P M L"@ X T"@@ 4 4B P> ƚ`a  #a А & `; `@ B  ;`#`  @JL] L]  L   p >s!P `&p> "H&p|p@' L"@ X T"@@ 4 `& В"@@ & Vd &̀ 2耏`|`> ƒ`a"@ ` "@ `蠏` `"@ 瀏` "@ ‏` @1 =|   &&&@Vf $pl&$p ؒ` &&pe&" _> Ɣ`[.">c#l> ʑ2`@X:` r6d4p ` `ON.L.MH /f4p* 'p   H 0  &pH 0   H /f * ' p* &pH 0 4 bh@ "@  6d &̀@"@K > Ƙ  ̖ؒ <  ДB; ؚ`'# к?&&耢 "`2!P`쀢 <bhT" 4&P> ƒ  :  !B`#!# ; " C` &`6ߠ?4p> ƀ` p> Ɛ &p``` < B #`;`    < B`; # @'&"'"66  "Vd  " @1> Ɣ`" ̒@$ <> Ƙ` Ѐ  )# В : ؖ B`; Vd 2 А" $@̀ v`Ѐ@q`p` &p` "` ؒ < B; ؐJ1 "'耢 P@ `X" `> "h&T&P` `X@rd?* : `>#*`  = 67 8> 6d `" `@ 66`2Vdp `J >  `Z`Y">c#l> ʑ2`@X:` q/6d4p ` `ON.L.MH /f4p* 'p   H 0  &pH 0   TH /f * ' p*@&pH 0 ?&" W>s )` 2%6jH> Ƣ ` $` A>sja * :`@ .6j$  l2 @  ( p&(&4l&&$``aPB`<``@ G$aPVjpl(@&@ &$&$l@ @ 4&$ڀ`6j!Vj &6j$( 8&$6j "@ $> ƒ`` F"`> Ƙ  "@ <`B`;  # > "h"@ @`4" 8" > "h@"@  @20L ' 2$>c#l2`@Vhp;:`$(l p0@ L?# * 8 &$ |@   |"@ & |\O   \K "& Y | &&Vd "$   `0E/ 5`0@ >`   X>c#l> ʑ2`@Po:`L )6d' 6d@>c#l2 :*"@ L*`X|` `@!Ŵ>c#l2 :*"@ L*```2` @ @@ @#` `  2&@2 &> ƒ`a "a&&D &&D '` ":"6Vd 42 L>nb (6-ߔ Ԑ" $& L"  ? ' H  @7 VؐH ?.H@ !@ÔԐ"@ 4& 2Vd`Vd H /f4p* 'p   H 0  &pH 0 Ѐ@_ [Vd WH /f * ' p* &pH 0 p >s!P ` &p> "H&p|> К` & :``  B ;`#`  Em GlX LXx L +  '`G[H /f * ' p*@&pH 0 p &pE6`"A Vd <  XpА `&p&Vd "    (  >c" 6d6d 6d@>c#l2 :*"@ L**`W  #l2 :*"@ L*`  d `> Ɠ* :`p ^ `p U@ې0Q> ƒ`a  "a`1Dːp`@&p0?>s!$>s> Ɛ a( ``   @ } 0(` '   @ n 0x @  d  > Ɠ* :`p  D㿐\D7 "    9@ 5@23@ .`kJ (4` 2'@ "  p @& p`@8.!O2@ $@``k0 ``k,   >  p!& pbh`&!T&!P@&@   `   㿘 > 8  &>W" D H `*H*I " j ?& > Ɔ <* (:   ( 2< 2<*`& >(8"( 2> 2>((2<2>+ 8@"42f <*`R>(8882h2h  2h2J㿐x)>s!@ܦ ,d (`@`T 2?؀ "` < 2 D>r# 2  D` `(;'  D?؀ ` D!@?ؐ * `44.. 8 ؀@*p !!4,?>sl 64l@+$lʒ$$!X  !.  * .  8 $$$$4l 㿘 x l7 @ ~V!< 2>dl ":dP @a @K* 2``6!@ ` 6!@=`$@<6!<p "*`z@ݒ`H6!>2 :  : 6!>!* :  : !@ 6 h6 h 6 hd ":??`@lT>nb 8 V@|` "P?@l@>nb 8 V,L` "hP@ h ,` * &!(` 2 D>s@쀢*㿐>s!` > Ŕ > Ɛ#" "`!` > >#c#\   ǘ 㿘%>  2 > >  "`l> "c>  l>  b F*`@  H@ k & s@!`* > ƒ@*`#@ & 8H /` * ! >s!h` P> Ɣ@`B :>#`" 8  "`#*` *   "  "@$  `"  "`  "@>  8#*@ *`@` 2`?$ " A ` > `8 ? > "`8> Ő# k& >s!d d> Ɛ !p@B`:!p!`#* @*`@ ` @@ :#@ "` @2@>.#@@`" 8  "`> Ƒ* c*   "  "@$  `"  "`  "@>  8#*@ *`@` ,2`?$ " Ar ` > `8 ?> > "`8> Ő# & 6 >s!p*` *  &    &   2>c>cD >c#l 2`@ j:`a\ & a\ "`a\&a\& &`& `"$``> > ŖX c`4`B #c:XH 0㿘H /`4 * ! B  >s a  :& > Ɣ`B :@   6 >s* 2 ap@*` *  &    &   >c>cD K>c#l 2`@ j:`EH 00P> Ɣh`B :h`" 8  "`> Ƒ* c*   "  "@&  `"  "`  "@>  8#*@ *`@` L2`> c?"c " @ ` > `8 ?] > "`8> Ő# ҒH 0㿘H /`4!\* !!\ O   >#p`" 8  "`> Ƒ* c*   "  "@$  `"  "`  "@>  8#*@ *`@` 2`> c?"c " @0 ` > `8 ? > "`8> Ő# q2 &!\H 0㿘> `>  *`l@ @ i >s!`@* @> Ɠ*`#@&H   H 00(*    <2  D@] 2 @ `@V  2 Ƒ* c* ` " `@"@$```"``"```"@> `8#*@ *`@``2`> c?"cH 0QĒ  " 4 >   `$ 8 $ `$ $`  H` f` $`  ?   &` `fW   h!֧ ??`< D p D &`p` 2 .aO``2 .aN ` .aL`2 .aM&`p` `p!&`p@  &`t@ْ 7?9 x > %>cl>s"h5> `2`&`@`|:` ` &`&a6`d&a0&`&`&a &`h&`ВD`4`"Z`` "`Ő` l`l&a$l``|&``|2``@`V`h:`&`&`&a hX&``4` `В a"@ 4&a`Д&aX``B :`` "` >` ` > `8 ?\ > "`8> Ő#ђ0,  @  "`G` "` >k` ` > `8 ?7 > "`8> Ő#> Ɣ?`B :㿐H  *  0 2 H 00^ | ?" $ H 00O`" 8  "`> Ƒ* c*   "  "@&  `"  "`  "@>  8#*@ *`@` 2`> c?"cH 0> Ɣx`B :x " = ` > `8 ? > "`8> Ő#,㿐H  *   2 H 00j @"  H 00_``  `6 H 00P`" 8  "`> Ƒ* c*   "  "@&  `"  "`  "@>  8#*@ *`@` -2`> c?"cH 0> Ɣ`B : " =f ` > `8 ?2 > "`8> Ő#   D P L"@ X T\"@@ d ?# @4>s!H d`' ' `#\ "  '     !)> #> Ɣ``B  : "&= &&@@  ` h @`" @" h#    < @q @n  dD d `&6@.&|& 6`  `EX 6&4&@ !! 6 ` `2( * * @<*@2   &?# P* <2 * * @2` & P* * < &&@) 2?>  " < ` #`8 ?M #"`8#Ò> Ɣ`B : 㿘 E    ` /< / <      (`<, 2 '> ㌐(4 7 A    `B ` `<{ `v 7`,@4 &` &`&` &`@D  E  `  H`$` d,` $`  F4  b4` 5 $  <*@ |* $ ` $ ,  6  , , 4  <2 ,  ,   @2#@$    @B "> "h" @" E  4`44 @K4  E 2 4`>r #,`   x E  />r# `   { h !   x`?` `@> "h!0V h" *  l&!$  "@ !$8>sV d!0N n ` `|*  4 6 f`|  <`   &  6 f 0 & @Ȑ` l2  8 `|  @* `L`P `X`T"@ 4  U`@ p @:N!dN n 2J!d!D2` `2C!d ! @,>!d?!M#* 4!* А" " 6-!d* 6)!d p2%!d2"!d  " 4!d"!d "!d"a   2]  0 2Y @X6 fT !d  K .& p `!&   //ѐv 7ΐΒb   ݐ p   @"  p!N@#@'Դ  p ` ((  a(@B` "> h !P "" ((!,> 6#"(  !> #(> &#"} pN n  2  > ƒ``l "`l ! @ > Ƙ  X P <B`; X # P  H D <B`; H# D @  H> #  `@K ` `: `6> #`$`  `  $` `8`"`$`0 " ?$@$``4 ```;ݔ`  $` :  $@:(; 7`| "?>$` > ƒ``h "`h``x "`x  " > ƒ``p "`p``t "`t ?  > #  `?ؒ ` `:9 `> #`$`  $`$` t`2` > f#Ȑ%@"`> _#`` t `  ? p   ! @& 2  2  0 "!  $  Ѐ$ В `ٔ 2`<**` $ , `P2 ? l& ?!M#* 4! В"@ & 2 = 4   "@` @ 8 4  ,  & !d  2N n`   $` *` 2`?# 8"4 N n  0 2@  &   p `& & p ! "@ & !4  &! > "h> &!4&!8`` "`  2 `  @>c#l 2`@V hbؓ:` 0 " `Ґ 6 f! "@ 4&! `  V d` ך@$`!d   `>r`2` x t*` x m*` x`H`  ` `Ⳙ #> ƀ 7 ( x@ɒ >  A x@ʒ 7  22 pV d $ p,6!J > "HC |% `@ "`@ p  `  "` $  p В!"@ 4&! p В &!X& p & p^ |2  㿘!<* : V!>  :>$ !@&V f>s!p*` b=  x 4 x>c#l  2`@ b-:`V f  f`6 f㿐> >#\` "!h   !> >`(#\ !x  ؖ >s!l  !x>s!\> "\2 > "bh@㿘`t %`x 8'  2adT  >  & > #  (`@  & >   2ad8#9 ad 2%   @  4 , 8?$ * 2 ( 2` 2* 2 $ + 2  3  `# 4  >* <*@4< $ 4 4 $ $ , 4 㿘   x @ T P L X" " 4 !d  H@<    2 7  ^> #  &^ ( 7 & & (& `` &` &`` 44 2&  4`  (`& && * <*@ $ $ $  , !M=?#44 4 @ 4` 4 @4 4`>r #>r,`c `  $ x ) 㿘> Ƥ" @ @ޒ!h$>s!B>4 la4!, |  > 0,` `` >s!H   >s!D * :` * $ p4!>$ x4!<4!@4 h4 h 4 h $!d$!($!$>r #,t$D㿘 x @V d  > 6 d^> ƒ``  "` `` "``<V!J 2@4 8㿘 x@ * ! @@ _H [   V P @ V!<*"@ *`" *  l `* @ 2 $ l$ l P  V!>*"@ *`" *  p `* @ 2 $ p$ p P 2  d!(" d h 2 l d2  l* 2 2 @(  `H`( h`@ 2 $ h$ hH /f4 p* ' p   H 0 0& pH 0 @8H /f * '  p* & pH 0 @( p  ?& p |ܐ t "> 6L> ƒ"H$DB> ƒ`` "` 㿘@  ` "` "6x > ʒz!x@  㿘%> G\ "D`H /f4 p* ' p "  H 0   $ pH 0   ""` > Ɣ`B :H /f * '  p* $ pH 0 `\@2`D?  *!N !N *!N* * !N㿘 DR`d   @`A!`3`@ 4 2aJR`f $2aJRaJ "2aJ4 8粐 6I L   H |x`>ˀ`r o%>s.  >2#$? >+#H  >r# >  `' *`'  "\ ϝ >?> #D  ># 07 0>  `*`'  "\ #\Ͳ #> #  A 3 @@   //7 'Q0"\̔  Dl $㿘 DQ `" `4 2 `TB  `T ? G$ 㿘 D/    4 Ғv?  !> Ɔp`(((0*`0㿘> Ɛ"p > "f @> #(  ?`  @ > > ""`3"f2d㿘1> "d!/@ > #(> b`"d"d*``6"d2 _> bf? * .  㿘> bX 2>  @"bX> bL 2> ʐ "bL> bT !>  @"bT"H >c#l@В $"H㿘H /` * !  p`& pH 0H(> L> bh> ʇ(""P"bhH 㿘  ? 㿈H /` * !  f`*`:  6 f > 6 f``$ "`$V!J  < 0)> ƒ `( "`(!* : !@ : * V f>s!p*` ] !@* :`@ 6 h6 h`$>c 6 h>c#l 2`@V h]:`O>r# "=V f x"9V fV d 5V f 3 @ | "-V f " !d 4 "!d P 2 V f!d` @7  //(W' " V f P  $ P̈ qV f $  _ x!<!>* : @6!>6!< &!4&  !$ 8  l2 @ ( ]*&!$&!( 6 jT`"TH 0㿘H /` * ! > Ƣ `, $`,!* : !@ : * V f > > "h!0"@T>s!\  `0`$`0" <0 . n. nH 0㿘H /` * ! > Ƙ` 4 # 4V d`C` x @  +`*>c> "P > "h> X!0 "@ @-` 8`# 8 t   `?   4>c#l> ʑ2`@L\:`[0 >c#l> ʑ2`@X\:`O 4H 00 <`"< "P> "h!0" >c#l> ʑ2`@L L\P:`0H 0:<;(;<;p><<==,=L>=`=>>|><BBBBBB㿐 `  G  2 ; 0H /`4`* !`  ` H 0` ` 2   DT d`.`>ΐ!T   8@  ` " `T` 2` x4`` Dȕ߰ >  Ȍ ր  4 d < 8 'Ʀ 2  'ƞ   >  f  m   $ tȐ 7` `P4`C>c#l> >s "ࠕ2`! @  4 d[r:`6 4$ $ $ $!  $ | -@Gx` u Dː@` n0`  h d `|E[| 5V`&@H 0_ `H 2`` @"D `!2@  !H  :  6 #&  !I0*@ !H ,,!H``|"@``"@@ 4 ~`|1 7E;`|  , n $ , nɓ ɞ >ǐ @  `    H 0㿘 H /4`* !`  H 0 l 6 h1᐀ `    / ޲H 00P4 D F% *""  (  `p &`p ?&`p"  (  `$ `l@4 6`l0 0 0 ' " "   *`p "@`l"@H 0㿘` >s`P  > >s!>sD  > ʒb\r `!  "ad2`d  ` ? u4`` 74`㿘 x @V d 4 p  T  E  BE L@  㿘V d`>ΐ!*` I6 d  6 d V d  xB @V d  >c#l> ʑ2`@P:`YҠ L疐㽈 2g 2d @"^ UՔ" 2W Q H /`4* !   > '"\'蠒  > Ɛ !` "!> '"\T    @  ?' @ '?''H 0"&@U"㿈K @ "   08 1>s03  غ 5 >  ّ @,  h%!l ' | 2!l@ > ʐ!x  2&!l   *>s#\!ؠQTRTDRTDS\STLSSTTT<TLTDTT(TDTDTDTDTD㿘>s"> "H#> bx'L 'P'T'X$bx'H 2  l  /Ѥ`  54   @:> P   2 bx` Q"`   bx` ?"`= " bx 8$` /"`1A V 'bx 2 ?! ``("`(/%"`0 * `6bx`/"0 & bx`( "`(`  "` р`2 @?  //7  @5'//7 ' < 8  #> ' C q#> bb@O `>@2F``8`"`( @2>``(` ` @26``<@21``'沔 /7  " `@0`LДBŖ  .> ʒbx`   "` A`   `@` " ``b@2`>`> ʒbx` z"`0`LДB j A`o^  ' ;> 'bP . > ʴ"x$`&$  '5 @ bȊ   &  #  6& U 6    01  `h 7   @) 00`@А LB8 > `@A6 L`@   0 > ʒbx`  "` . . 㿘 -    Tݒ `& $ $$  㿘 @2 8 @A L @    @@ |㿈>Ӏ`1!` -@ ) '>s .  ? >#H `0 >  `*`'  "#\Җ0"   x h 'X'T'H'L'P a >ِ h?# @ (  (  8 8H /` * ! ĸ " H 00 2  9``" 8`  $"   ?ܐ"   ?"    ?`& &  -  S 7     & J 7  @q  .` 6`  8>s&`  (&` >6`a < 6`6` /  & ` 2* `2 2`* 2 2 *2`2?# 8"6`6`6` t> .` mx.`,`", @ H` 0 j#\Č$ 8$ hH 0,,ܐ㿘``   ``2 `.`>ѐ",   H /` * ! > ʒbJH 0  >s">s?ΐ  >r` #{*`tH /` * ! ´ H 0d  ( _ 8H /` * ! æ H 0 H >*D  ( = 9H /` * ! $ 8H 0` ?%4`?" %>D@# -  8    - ->[ ,,㿘H o*@ a÷ H 0㿐` @  >  @գ @   *#\ >s"є 㿐>s" 'H'L'P'T 'X  ,  H> ʔ `+" 0H@ 㾐#> bȒ  $bȐ -2  b (`+$ (0  -    $ 2    />ϐ -  b`+"0ʐ  ,ۖ2  b(`+u"(0  -Œ  b` "`2   >  @   2 +W0 ">s < 2% >s" > "܀"  " "  ` 2` @"lb 2  bȔ" :` B3  ;`> `t>V , `t@  ', ''7 'H /f * ' `` @``*&`b`  "` H 00*& ` 2" &@> `&`` &`" }v >c"$ > π *"S@ 0 $`*"$0 S H 0㿐  ,a 2 `/a%  > a( a 2  > ʔ,`*",& ``" 8`  $"   ?ܐ"   ?"    ?`& &  *        & 2  > ʒb` 7 "`W&<* @ *@@ $ >r4  c4 , a($ a $ 4 ` +    +,   4  /@ , *(> &b`( / "`(> ʘ"  # &a 2 `  `?쒂B>`  ?쒂B;  㿘`    *>sҨ" 8!> ʔ">sb$'L 'P'T'X"` 'H  , 2   `)" 0 "`)$"0u +" `  " ` 2 " `)"0] , ؒ"` Q"`@ޒ @ے   2   )" ?$" ////ܒ *  * + " :  B;   *Ж ? @6   >q#@쟔   !"6 +a "`)W"㿐a% ```> a ``2 > ʒ @> ʀ`"  `)6"_    .  2  > ʔ`")" 70K#V @4`  O` &  ?6 ``$ $` > $`$` $@b`#```(? ; B;`(a  `<* @ *@@ $`>r4  c a, , , 4 ȕ4 4 a($ a $  //  *i& 㿘`    *>sz"$㿘'@`  0  %@> @  ? `> U >! >!(2  Ā "C   >  `  ̡, < Q (@䧒 d$ 0> @'y " $06 2 `@: @䌐>ޔ!@@~  a `@ $`$a'@@'R  >@ H> !` 㿐\'` %@ `0 e@> @ 2  ?  @  >`0!֚`>h!2`>c! ".`````̡,`< Q|`(@/ d$ $`.`  `>`0"` >B"8 ?KD '= @& `@@2 `@ $y$`dT,@" >"X``$6 `2'`<`*Q!`(@Ԓ `̀@#>>bx '`$``<`(Q@Ò d`̀@`0> b`Ԑ  $`>"E`>א#>ޒ!@@ $3`@p@6 `T&?  @=  `$`$`d,"TM0""0 H@衐%@` 2" >@ H>!``԰  K'@&;  >s", U   e$ N     P@ ,`@`T`d`0@ Ó: 2`>^# @&  @6  ,`@ P "`>L#H@&   `8@ `d`T*,` T "`>#p4@ @ ` T@:-@`T@:2 Ȑ@T 2 @K 2 `*` * ?`0?J KD 0  H@>` *` * ? ` *` * @>ѐ#$ `0?IҘ  H`@⚐>"@ ,` @@%@" ,``T`d`0@ : 2 >#`d T: "$>#`8`@ߠ @>s"( JaI>sb( ` %`    >s"( JC I @* ,``T`d`0@6:  `d, "T @`T`d`0@ : 2>s>C "0 > 0`8`@ڤ J}@ Jw 㿘& Ȁ h<@ 2@m,O6@: @ꏐ<@ L @   *@ @ ?*@  >!@Ŗ "; X  @06 `" > 8C>Ր X> p9& &  &w * &   &  >@ ה> ԰ 㿘  , @ @{ @w  @ "? v  ,@곐*  , #P*@ 6@`& `&  &#P 6 #P*@ 6@`& `&  &#P  @ے``: @8``: ,   8@ & : ,  4N[$$NV   0NP@%@ &@ @8  @8 " 6 #P* 6 `& `&#L &B &#P 6 ,#P* 6 `& `&#L && &#P , 6 #P*  6  &#P 6 #P*  6 &#P Mْ 㿘 `\@ .? 2I`8`t @  @``M .?   @`@c@_` `,@ʒ`@V cP*   6%`&cP 4: cP*   6`$cP- `X )& * ``*  " `@0 $bMo`8 Mg`DMe``|*"@ *`@ @*``8? @ MW`8㿘  "`,/ 6`,@@6&@  .`,@`,@T   ܲ``,@"  㿐 .`P T': @/? 8? 4  LL.@   d?`, F՘ @`H"U  > #Ԁ  > H  H 0#($ @T>!   @"U@:c `   ?":@ ؘ  8#@"   @"U@:c `   ?":@ #@  ># *` 4 ?" #*`  " T>-    @"U@: `    @"  * *+@ $ ?$ $̀P?$̒@` ?"`  ,G㿐 .`P  2 02 ް L5L0.@   d?`, F  @ HbU  " #Ԁ z  > 0q> #($ 02 T@F08>  . 4@ ,`@ "`8@I  L@@ 8 $   @"U@: `    "  * +8`@ 8  $"@ $ $̗+`P $̒@`  4 "` ,  " Fa0M@p  Fǰ 0B@6" $   @"U@: `   ? " *@* `@+ $ "$ $̘ 4P"$̒@` ,`""` , ?# $@*`  # K_F㿘  `H @` " 8`( @l`@bU c``@ `@ Օ> 2 `#X" 8%P Ő |K+@ `@bU -`T@`T@  @"U-`  @`X@K * K @) @ݶJ J@@J @%PJ@ݢ @,`T $`%P@,` @,`T 4 T`@,`T $`,`T b@ JŐ%@ | `@v* %L,#\ %TJ* T? > В > 2%T,#\%PJ * T`@"U@c``@@ & 2( `%L?2%Xe` `@  `: $ > В >G! 8@2 6&`(n , `@>`bU "``cؒ@@ ?@`&` Ē& ` #P*` "J= |@  |J7@Z @ J1  |J-@P @N J'  @I%PJ!@ * `@"U@"`X-` @@J* @?4`bU -``T@`T@  ?".  I` 㿐` .`T6`  II.@   d?`, C @ HbU "hԀ h.$ @  `@ 4$@ `$@ ?@`$T@ Tv"@V"8  @⽐`: l:`*  & *@   *`  p   26C @4@"U@`&@  2`>7!@@$IT`&`*@ @".>"!` @"8>!@@C0DW 㿐 .`P  2 ۰ II.@   d?`, B @ HbU " #Ԁ > D# 0#($ @  :`b \  ?&:@ X 0` `:" ``` @"U@:" \ @#  @ "U@ " \ @ 2   0>!>}!@"U@"  \ *    *>!ϒ>a"$ 0 @"U@: \  ?  &+@* <?$ Ȗ P?$Ȓ@`?"`  ,  $ P $@ "@CHI㿐 08 @> @ 2  8T@>  $  >0"(o>"X@ג$@ > `"p>!@0 HH -@   d?`, A C$0@`H"U`  > cԀ > C 0#($`@ 0 v`@`bU >@c``@@  2 ` >">"@"U@"``cؒ@@  @(`-` $`ĐP` $`"G|@]|G@@UG|G@@G@ඐPG@A* `@"U@"`X-  @@G}* @ 4`bU - `T8?.@`@"U@:c@``@   " $  : :@ `4?@ _T > 6?`$@ `@"U@:`c@``@  : *`"; " @ >"i>""U@"``c@@   ?"  *@   +`$-`$`$̔P$̒@` "` `@"U@:c@``@ 8 " $  : :@ @ `@`"U@< c``@@ h c`$8 " $`$8̐P#@$` #@'#` ``$`P`$`"F|@]|F@@UF|F@߽@߻F@߶PF@A* `@"U@"`X-  @@F}* @ 4`bU - T@`T@@ @ "@ ,A㿘@㿐` ,FT@*>`#'@ᨒ` FDF?-   d?`, @ AY0g@`H"U   > #Ԁ > AK Y #($ @ @bU 6`b \ `: 2 `>#8ILҀ 2 >א#X@"U@b \  +@* * 0@*$ 0 -  $ <P $Ȓ@ `    "` ?$ P?$@ ?"@ ,@ 㿐 0  @> @ " $># >덐#@*>#높 @[E@T* E  d?, ?v @?0T@`H"U` " cԀ "@ E?@ޞ0 @"Uc``@`@>@ .T > ! @   @"U;`c@``@    ?#;@ 2 `@ @  >#@c`?㿘@U  `, & :    & `@:bU "@``@@ 8#>s*b4  ?"? *@ @? *`@"U@ c``@ 8b4*  ?"? *@ @  2 >  $ >궐 (&.  9&`,  `@"U@:c@``@   8 "  :& >;@ a,.> !@*   `@*+` 8̀ > Hߔ >q ` 㿘%$lh>`.`# (.> . # (.@.%$p@6`8('@ . `. @ ` @ '@,?`8('@ (> @ ?@ '@  4/  &.  &`*` &%$( ? $  #T( 㿘>` Ԙ    P'T\'X@ƒ <0 @ ?'>黐 2%6P6 @׹ ` S @P ` 40`*: ࠀ8 <20ऀ@8<0D L 03 /Ӗ#`#\0T `P+ ;   @{5<.`$@   $X`= >v .`P* : ࠀ8` ऀ@ }0?=G  `"-P<D L    a?=+ " >j0h#`T#\ 90* : ࠀ8 D2 0ऀ@(0DL DT n  ? %X`d*@ " T <@ H" @"  Q$'@ I 4>运 В* @'`3'  0T  'Ķ0 >֐d'.@ <"T@ڒH = "`@ 2Ѳ*  $'`$ 'M ` ' =Ő C2 0  0Th  & 0>d'.@ <"T@OH <"`@ @ * $ &'X`<= ?0<8 h-@H*  `;@* @i0T K &0 >? d'X.@ "TH@<" @%@* @X* `$盐!@X*` H$ <  T@; "@ $$㿈> (( *`" *   * ''`X <`   ?%  @    ?%      `@% `%   % %  H`B = H  " ((% `*`" *  * %   ?% e, 4 ! !5 5  ` @ܜA:`@ܕ`* A2`` @)@܉`x``?* `d, ;`0 "U !X@   H* @ >  `X < @;V; 'T    < `2  ` ` 'X @:`  ` `! " >桐!x@؜   !  > & `O @D 2ϰ@xR & ( & ,& 4& 0@>e08 e4   !T#\` D T 2> @x!@w`:T ;iT !`&    @xe<2`PJ> @6   !T#\` D T 2b > `P * :  8 e<2`0 8e<`0 eD `L @w< T$ H@T<`:pT`0; T`0  : D`P@B?'`t$ '`t@$'`0 :` 'L=v <. ? " "@ . $ .% `!&    X'H H=P <=L <>  (> v > v# T Vt?'`t"@ '`t ?ܠ "@'  `d/ @P 2P  @ %`0OL@  {ޠ? +` , ! &`P* :  8 e<2`0 8e<`0 eD `L  < @۴`J,`  E` 4`0`P`* :  8 e<2`0 8e<`0 eD `L ` > `P`* :  8 e<2`0 @8e<`0 eD `L " >!  `T:  є< @H  0. ">!    H ">Ԑ!!> " &!&! `& ?@y 㿐  ''P'X    t>Ӑ?P@0:  :֘ `0" > v# `, "`,`0`< `8$`0 $$`T>䆐!m=R P9ʐXu"?"`H0 d 0<t, "@@c*` X < @ 8ِ 2'9rt?>v?&@,  d. ?? 2'@0@?@ P @s,  d. ?_ 2'@C  X`0 $`09WX"㿐  P @ 4 0*:  8 %<2 0 @8%< 0 %D  L  '?7 9#0 %< H @ & '㿘8>s4/  @. +.`   '@>>>,@@2 8!/@/8/`/ 8`@ڈ 㿐> "D> x*" *   <* :`  T  <"6 t 0@21 t \ ,  l 2& t`  @2  t < " t T4 t: $ t>PĐ"  <> T;  "0䶘?>H"` t ɀ㿘 8>>0#  >@ `?>@ * @ * *@  `?>@*` @ `?"x㿘 8 >  >0 >.@>@ *` @ *` * * .@ >@+ * .@"㿘 8 >  >0 > .@>@ * @ * * @ .@ >@+  .@⾐"㿘 8 ">  >0 >@`?>@*` @*` *   `?>@>  ⑐"㿘>⋐"؁ 㿘>⃐"㿘>#㿘>{#8㿘>w#`㿘>s#㿘>o#㿘>k#Н㿘>g#㿘>c 㿘>_ @㿘>[ `㿘>W 㿘>S 㿘>O ȁ"@  㿘>D 㿐> v#!> > #$ K   >> "%> ~K  >㙐#  GL >>#ВcIΔ  @  ?"I?  LL0$> ""` 2""@"`!`  Ԕ Y8 @ DI @}  8 l R `=#`<*@$`<`< @ @? aL Ҁ   Ӏ  #`<* $`<@k  Ӏ `<@ L Ҁ  *@$`< `<@0@` E`<@B   `h  !h j  L р 2 `<@>> @ƒ Ұ   Ӏ   @Ē  , 7  ,@?$#L   DP `0 @&(&&$&&,E; < " >  b&    "`<`< !!`g h> i u`<@@#`   ` 2 K K ( ` Y6̖ Z`" @א@ 6 Y Z`@@˒$ ` Y6`@@$ @Q 4aL8\ l` `D`&@`<@"& L Ҁ,  Ӑ  , #L͒  `<@   ?, Ӑ@  KD㿐`D `LېP ``J_ I ``  QH "@>h `` @:`@ސ`* :{`` @r@`x``?* `d`0, 4N` @  x@^  H* @ 7֐ U % 5J0J~x< '  `fǐ   P h  >  `h ?g " (<` @%?3ܰ F HaT\  0@@܀eg85. 0n `#P"P#T"T *7w h h#@40 "05 %(@%@D@  4?@̓ ##P 8 0 49Ґ$  d@*@ ?3ܰ 0ܒ H7?4 8 Ӏ %$ $> ,  #T%$"@ ,`>''''cJ”㿈 ?Mސ L > ~" e`  P'  g q`<   ?fT e `h fʚ " (<' @R3+찒 1 F`H!T%\ U 0@@Ueg8 Ӑ! O>s  O, В ?L р , Ӑ`, `<@>> ^ %L @Y  %L?    ѐ!@ڒ! h ʔ %`%\F!T@ %` ` H6m h h#@0 "04 '` ,  4@ː %$` ,*    @$$#P 8@ 0 48Ð$  d@*@ 2찒  H603ب' 8@@@%$ $&a , @ $#T%$`"@ ,@`&a&`d "`  2&`h`  &`h`<%( &`@&`<%`%@%` t %`$ d%`( 8%`,,````" @{"`" , $#L 6  ,@>$#L Ԕ!`4f"`Ԓ" @3%0> =aPp 0 4 :    @ %0B? 8 <%0%4 <%0C Ӏ    #P: #L7  , , `<@   ?, Ӑ@o  #P! " 쀢 35  e` `   &a㿘  *   @ &  %L?&  &%P%, 4&$ 0 *` * ?:  :`>%0 t : @g %0 B ?>%0 H L8 8   ;`; >%8>%@$ 4$&$$  @&$ 㿘6`<` `@> 8L Ҁ 2` Ӑ` `, @  "#L(,  `  ?" ` N4 L Ҁ   `dy?H `#P| y v <*@$<$㿘<  H͔` % , `@ @   , H `c’` d``e 㿘!F aTe\ "`4> &``0&``(&` `87``̠ &``(`< :`: @Ϧ  @ d$ &``7`,?&``Ȓ D@ &` `T4{ Z `4w Z!La4s l `D`@ʒ  㿘` "  < `  p ``F ` `d` 2&@`eF G` 㿀 L`Ѐ   L`Ҁ  >> `>ܐ >b''''GՔ耢 2< `` , 2䀢 >` < 2  c ` d3 2 d @ L`Ѐ @ɒ 2㿐a @ & > # D > & L#(@*! >   T$ Fh >s" bX$ $$ $@$ "F ː0e@э6+༠@ц* 6# @@zx`?* d , /0 F813=&@x H* @ 3zT$1$> # @ "F#& 2,^ * ` $ $ X < 2, $, $$  &㿘! ` ( F5,`@  F@   2@ "`"`㿘    4?@W *#P 8 0 45%  d@*@  1 `H3`@0x 8/Ԑ 2 8& 8 6  T d@I"    h1} , > c($  h2`H%L?`H"P%, 4P8 H"@"P`:00;0/ 2㿐> @ 2 >mbД #\"@> >a#(!    |@ 㿘`  >t   -0   -0>t  8 <>s",>s"(Q㿀   `>>!8˒aH`<`X @ऀ `2  2 >>!XڶaH ( >>!pڮaHe0 Ű 2 e4@(0 2   b'@ђ  '*@: ࠀ8 e<2`0ऀ@8e<`0eD `L e< `0 *= 2`P@(`P`P+@ࠕ:  Bऀ >>t 8  ?#\#`ࠐ$54$ )` 4'`*:   2'ऀ8e< 'e<'eD `L @ '?#\#`.D ?.  '$$`@$6`H`H1 /L'  b 4_`P`8[`P "/6 $x'` >>!8Ւa` 2<1 "#   >$>뀢 $>>뀏 "  <`  @"`` @ `  @"`0 2 `>>!٤a!١a` % ``0 @ 2<4< `` ` @     h ڰ  '``  ?耦 `P@g ` <0 @`"* $`!#\ r`< @ 8   @   < @j '@j֐` @P`* :  8 L20 8L0    8@ @@ @ "@&H7  H@ "0-w  >t <  $6  . -  " `  $ ` 2r``(` " `  "` 34 ` 䀢`    !@ @``& @ b $`<``  !`   㿘 < 2   "   <@" ?   `?H /d * % p m  0*@$ 0  p a  0 @W  0  >_!"  P &K  p  0@> !|     0 $ 0++: 0` $ 0H 0` -=0, RH /d * % p  "  *>В H H 0 +H /d4p* %p   `k< >!EMH 0    `? 㿘  @Y >  ч#($  㿘 `"     "@      @  ` X  쀧 >뀦` >א"`'@L@ @?"Ȁ "Đ@  6'Ę .`(* &`" `` 4 @6 * .`,  2 @` ` '@.` ,  "@~ ,0z * @V  , &L -i `0"2 >%"@`0( , $`0$`T`K> v#`,`/", `H*Ā`$ !`"  $@: @6  .`` '@$@ @ .``H ?,  "@ Đ? 'Ā , ```"(,(, &?& 㿘 X!&`&   ` ?` >"pִ^   &@`R $ @_ >`  2 ( % "& "&&& "  @ĭ   @Ĥ@Y &&:& @' `" `2 $  >"Z 2& 㿘>c#> ˒  > > "`"> ˔> ˄ (  @222㿘> v#>  > ː@ `* @ "  @2 @2  `? > 0 2  㿘> v# T    > @> ː  * @``2 @`@2 @ ה  `2` * @ @ &@ " "@ &    2   "" 㿘 >n #    D >#8C 2V 4$  X < 2 @R 2!?@S !   @? &   !& 6 `    !`    ^ A  㿘>n# "   D >#XBђ 0Z   @@ h'  < ''*  ''$'&  ?x \f @ p  X < ? c .] \ ' '耥2 X "X  ?'X! L?' |  ;    2$  8$ $   )'$ ت  !;   @ > 0$   `  "`'> cP` ' "`  aB 2` * @  * '   " )  !:@  a2 H?' H`  >t @ @   >@ː a "" @$ P@ '@`  `  ?"@`䀢@    2@耦 ' 䀢@&@   '@@ " `2 @C` 2 X @ $@ ` "f`@$ `}$ '`@$ @` @   &t | '$ )i 2O`   2G "C  >[9 C   $ taB 2` * @ *  $  $  $ tܐ& $ t$ $ t!,#  ~ $ $ xԐ(` $Ȓ \n $?@.1 2 `> cP` "` `    ?`@    >@ `      < $ (  >$ |@ ;Z  !$ t" $ t  2X=&   " ! `! "=  `'&0Ѐ+ (Zq {   2Xt   m&`($e Ȓ [ [$/Ȓ [#$X `  ȐY` B*@>$Ԁ/ ,ȐY  "=:0-*@   2X=$&  Ԁ   Ȓ [k $&@-0 㿘 >`X#   D >ҫ#㿘  ""  @ > ? @ $>#     >  @   J `@  J   㿘`(2 >l &`.``*  X @ < 2 ..㿈 `t ` B`!"a>D 0 #\;  "  2``":  <` @c$`"6 Xa@`L` H @ ) [Ua`   ` : ` 2 `` : <`` a:@ t ?`t  "@ "6  ` `"  )p`t  @ź  @: 6>Ѷ H66>ѱ `6)MZ``)$``x %: ` 8`` ` Z.`xa@:   @ ``X&㿐`  !:@ F "@ *` t "@  !:`   @ 0 t "  2` ``?``&`&`6``X < @  t & %  $ 㿐  !: @ !"`X @ * ``` &`&`6``X < @% Z2  $ `   2C >` ܐ  #\#`#h#d#l  V' 2/ ܀ 2+  "' `( 4 M  .2M  @"  M .2 @   D4 @8  `` ` '= ; 9'܀6  ܀ 21 ?  (  @逢`# :ܔ X `찒 <   #`#\ #d#h#l   U  2>Ð x܀ :        -  㿐 `   &@㿘!?`D  `0`4&& 㿘> cD  "cD 㿐 `` &` a`@"&:E & F `00``0```)* * )))))+++**++*+㿘 >nc* @  @ 3 "     㿘 >n@c* @`  @  "  "  ` "``D?2"`9 " <;$ `  2   `"` D=``5"`> ("`` > `H#(@"`:`H`> ("`"`> ("`` > `H#(@"`:`H`> ("``"` 㿘  ` `<`>"*` X <  А 2   @"    ,`! 2 >!   6"> (" > H#(@":H> (""> (" > H#(@":H> (""""22" " "D:"$"(","0"4"8"@"< <(@ XL" : 0( @( :H < "H:P㿘       T ?2  ?2  ?2  ?  D? L?  L   @$`  @?c @? $` @ @$`` $` @`  ` @  2 X ?"  X <   @  ?2 < ?". $ <  ` "  Xa " X ak  < g a@  @  \ 8  2 $ ( $  $?2 X ,?"5  X < 2D `a@" $ " $ X 6 T / $?" ,` $` ,?"a` $`a` , $  ?#@   X <   @  y㿘 !@" F ") "  < b"!  O!  2 d"  <  @o@$ 4  @ b2 @^ 㿘  a"a a@ @  a  ߒ 2a laa a "ݐ ^ڐڐ$a $a̐ 8ǖ 1Ŕ 0% > 2`` $`  ` 74`  ` ;4`$a $a !~   E 㿘 `<  ` @2   ` "     1`    7S066㾐  $ >̆!< 2 XTf X@Tݐ^   S TА0Q`#TƐA ` @T7 `` `a$`4`$`     ̔ " ``?``$`$`4`Z "     T 6g㾐  ` ``>0=*>0:X @ B @ -`(2X>!( @ 4'>!H `/``# /  X @ 4`>א!H*  $` X ː!p`$` ` ;$`㾈    ''$$ >˧!X X@  "0X@S耥6M5ސ耢 5S6>6<0L ` ߰   ` ْ , < а S̐5566 ? %>T! %2.쀢` S+ Q ఐ#@ఐ Sђ   @ ` @ S  <  :༐   RK  耢   RB S h  @J .@     S K $` }Ȓ 5   `$4$      S]g`  Q SR`2% # S`" 4  O@2>ʕ!Ȓ1r A   `2[``@>~!% #`# `` `a$`4`$`     ``?``$`4`$`   ````a$`4`$`    ဥ` } 4`@>@>#!`@2`>!""`  `" `a@"`a  `<  `  B`  B $ < 2  2Ò ` 2``?$``?%` 2 ```?`4`$`` ` 5`%`   !@ a` | 3萂 | 3 ? %>ɝ!0y쀢   ">ɍ"4F 0V@">ɂ"  >tR H$ X $q ` %`쐂 `|Q ``3`340$`3`3` ?$O    ?$$4303h` `$`>("0 #@  !  ԰ 2  `$a $a 2   "`. a`  3E3C04` $`Ԑ "`<4`$`@"` $``$4$     2X X @ >t>t D \ؔ  a`''a #\  "  . `" <`$`Ԓ @Zn"А`H D a     Q Qа  ԔА1 2  "`{i `"@ $$4`$` $`4`2 2㿘  @  " @3 022^  R   N B`S 2`E B @@   @"`9༐$` $     ` $`  $$ { #```$`4`   ?4 $ X <! @ @? @@ "zߒ 2A2?㿀 (`  @N /  "zƒ @ X @@6 ఔ n  <`$ <   #`#\  #d#h#l  M 2㿘    !@n $" "   O 2N  "J > >Nj"H  #"@@ D  4(    "@ < Z, "@ " @ "D @42 8$    @  2   @8" "㿘 X @@ 2   2  R   N 㿘     T㿘    `  T㿘   T㿘` \<? >"h T P@2* T   TO " T 0$ 4($ 0H /d * % אH 00-?2 T H@ <$ @ T?2 H /d * % H 0 >p  ` $ DH8*` @㿘 ?   > 2   "  > "T  > "!! X T>#㿘 >o`> `""8ē*` @㿘 >o`> `""dē*` @㿘   D B>o  ":>o  "> #("  > H(`B ":H "# ?> #("ऀ ">o  "> #("  > H(`B ":H " ?> #(" ?">o!> ađ* @@ >4(      $ "     㿐   #\P   &㿘< >n`cX 2 @`!$ <>"T*` $ 8`/E >  &  @aĐ*$ @$ 80t$ 2 $` -` 2`H @ $ @`H> #4 <`H#4 *` * " *  * " * <`H&㾈$`>Ŏ#'<& `   /ɐ0z  $a  `"$a 2  ! "` a`  //0Z  >n4`$`2 cX@  " <`4`$$`a  2  "` ;4`@"a` $`a`    2ɘ 2@C /` &; /X`$` $`4`" </O P >t 2 >tt 8>t 8 8 < "   <ༀ2  2 <`@  2 4$  " , " @ `@" "  2   , `@  " "  @  2   N㿘> ˒"p"p?@  >>>#@cPm B`6@@ @& >r#.`@㿘> ˒"p"p?@  >>>#@cPN ^`6@@  & >Q#.` .㿘> ˒"p"p?@  >>>#@cP* `6@ @ @>/ .` @ 2 >% 0`"   > #  €   .` " > P "   * "@  $  .`"@㿘> ˒"p"p?@  >>>#@cP `6@@ @& > h.`@ 2"@>ސ ?@  +  ?.`"  * "@?"㿘  &   &  $    " $@ $ ?   @ 0@ 㿘  ?@0' &    ?&  $    " $@n $ ?   @~?0@y?㿐>mb> >#\ `Ȓ (  Q 㿘> ˒"p"p? >>>#@`Ж@ ` 6>>>#@`Ж84 뀠@?#> ˳2 `Y` ". q* 2  * & & & && & $&  b &  b  &   b  &  F b C bא`     @*㿘  >   >>>#@`Ж`! # b   b  b $ ?">  b> ː 㿘> ˔"p"p?  $ P"   L>>>#@`Жº!7@  2 >>>#@`Ж®!86@ `& ` `$ ?@ 0`$ ?@ 6`" @ `& `$*  " * ? ""$`Ñ. 2 `$  ?  b-o  -`$ b?$`$- b b b ] bX ` & `>>>#@`ЖJ!% `*``*` $``*`*  @`$` `*ݐ` * @Ք`$#$``*ΐ`* @ƒ `@ $`$" @( `&2* *  $ ?$" b$` ?$`< b9 b ?2 b㿘> "p"p $ "   P>>>#@`Жܔ!2 L` @ 2` , @ "   `> #  € &` 0 `,   L@@6`` *`  `> #  €` &`㿘   , @ * @`>@ 2?>"H "@@   & & & 㿘`P 29 "+`$> bx`$` " 2 ! , @@@` @@* `$`$@@`$` &`L"@ &`P`8 2` `8 ?&`89> `$"@"p?@ "p>>>#@`Ж&"v2@@?;> ˒ `J` / c.2  * $ $ $$ $ $$ $  b  $  b $  b $   6 b 3 b` ǒ W`P    `8 &`8 & 0H6! `L*  * @ "   `"@ "@  "   * "@  & &`L * "  *@a  ? $    ?$  $  ? "p` `$"  ?`L@2 `8&`P ?&`8&`L㿐`P V- @*  `2>"h $A`0 2=`(   4`(>"Y @   #\   @8  `  ">@>@?"@5??$ "`( @ @46`( &㿘> ˒"p"p? >>>#@`Ж'#\`6 2 >/"" " 4$>%" 2 @   &` `" &@㿘  b*   & $?& $  @*  $  8"`"@㿘  $@@* ,` `  8 @&@ 8 $ $ " & .`$8 $"  @@ە,`` - `  8 ? @R@># `  8 @$ 8 $ $ " & ,,$ 8 $"  <>#(@ @-  - 8 $ " ,`,`$ 8 $" 2@@@@,`㿘 6@9  5   * -    , @&!  *@"@  @?  +   ?*"    * "@ ?& @? #@@q ̀㿘> " > ̑: "`(> "cH@"㿘> ˢ"p`|`x" 8$`|>t! . @    b>#xd># } " " > HH`""`" "H @`x `@$`$`x> $ # `"" `" > ˆp|  |> ˖` > ˆp "` "" " 㿘    0  @D !  " ( 0  ?>>>#cȖ $ 0$  "> ϐ 4 (#  €@8@> ˔`> & bp`"` "`㿘  @Hp   & > ˒bp`p?"`p   0    .2 ." 0㿘> #H "!   @6 ,`@  6  @ "   `@&  2  㿘  @Z`"$ ``" `>>  ( ` @H $`  (?> Ԑ#d @4 (€> #  €@1㿘 (>` $ * @ @ >` 2  2 >     &" $& > &   @m @㿘`  >D - p> ` @7 @   `1 >>> В`(!\* @ "@   " ?" `"`"> ː O 0` .`@"@㿘  @0  ( 6' $ $,@`" , ` "  @Gc > ˒bp`p?"`p  , @> ˒! آ  & $ $} c> ˠ 6  , @ "  @G= > ˒bp`p?"`p  &  }e c> ː!㿘> ː"p `  . 6>t̀ > >!8#L $ ?$ $  "̀` >t> `#L>!h  "> ː!  $ $ $ ``*>t 6` @ : ! 8  c ( $ $>!. {ђ c $ >ڐ!Ȕ@t `  ?$ >t $ $$  $ $ >  $ , ,"`0"$ 0㿐> c  "c> "#> !>m""c> > ؚa X   #\> >#\!b 4   㿘@ " 㿘@㿘 ` 3 0&  ,`" 0 0"`0 0 ,"@    ( "> ϐ 4 ( #  €> "x@^ @)@6d  2 (`  & А㿘 `  > "x   * 9: 3> ːbp  8    +@; 8D  ;`   @ 2 (  >"bp  * :  > ˢ "x:`@d2`*  *`  2 @ `  ` `" @/\n >  g   $@a ` 2^ $` X"p :F4 @/3 C` "  49> 6> 02> 0 21 , 2-> #  €@/$  0 2 , 2 (  4 (> #  €> "x@ @Z@5"@` ``4`` 㿐d@g   Z  ?K@.Ɣ 4> "x@X`   ` @  O `* ` ` .`@  #\  @3  ? ( .c  4 (4 .  ( `!  >  `4 (&> "p  :D '      2~> ˀy> > "x@ `!  `4 (>h" Ř`4 (& @.B 2 (#\  @3! 2 .>@:"X 4 . A> ` "` @  `* `` .`@`2@/D (@D  " ( ( ̔?@D  (?# @4 (@40?> Ԑ#L @4 (€&> "p  :Dy 㿘 (   >>> В`p[$> #  €> "x@a @,`&@@4b  "   "  >>> В`9%     >>> В`+%  㿘e @D( 㿘> #`@ "`,0  㿘  @,  (&?  $*@" +  6   *`@-@ " (&  + 2 < $ 6  , @ 6  @  2  &  㿀> "x .@  : ' #\'#`#d? ",  &  ( " >>> В`%ϔ @C ?(# @2(>  d @> #  €@->  >  㿘 > * * b" * ` @ [>ߐ#V>ߐ#܀RP "!> ?F> "p :F !> #`& (`@2` ` (`` `&`>> #" !> `` &``&`` ?,&` x #``@2` `yL !>  >t & &&  & &  & & & ##`&  "`$$#& $ " 㿘  ?1&   >   >>>#c(p֔!9    & >> #"   ` $"`$ $ "  Jx  㿘  8 ( \ ` > v  c u X  `> *` * " *      0&@ @ `&B @ `<> b@  > v  c uz >@7̐#) > "p :@ D@ ,> ˑ,??   > v c uO 㿘 & &   2  $ >       > v#`" u- 2   $   @y  2  *  ` > v# `u   $ "@ @*&  `8 " `( ` > v# `t &   & `. `8     l   8   > `  > v#`tג >@7)#   > v# tƔ 㿐> ː"p `"    > v#!,b@ "b@> v#!,bD "bD    0  G "5#\ ( `! ` > 4 (bp`А "`   > v  c t > "h C > v  c tv >" W2     @/  > v  c t[ > ˒bp`>"`@6    > v  c tH > ˔p`" @A  > # "pؐ $ ` #> v>8#Ȑ`c t(   @c t  ܢ  $܀ P` ( " ( (?# @` 4 (> #  €X` > v  c s > ˒bp`԰  G"`Ԁ 2  >>> (`8ݔ!&@@ے ?& @0` > v  c sВ & >  L@@+%`  ">  `L ` ;"  > v  c s  > ˒bp` "`'L > >tbp!  `? bp'D".@ ''*'ؑH/` />  P`܀` `H*``L:`H 0 ` '  '@''` #> v>g#Ȑ`c sW @쀢   c sJ   $ܒ"@@*'`8  `(c  s6 '  '耢`H< @ > v c s# ư  1> vH 'HL H 'HH 2 8 > v(  > v# r @> ˒bp` "`P  (  D> v# r  D 0T>t*` *   > >>> (`8˔""x @ 2 8 $"2 ?@  .     `'D      L$ F  T L '  @# .` "`  "` ( 2` 0 2` , 2 `> #  €@)`@&.` > ` `4$  "x  .  `         . > "x$@.  @Q  > bT X?:"@ X@ XX0"?"@*  `&> `0 "> `( ! > @) > ː"p > ؒ`"    H   0`4bܟ@> "p` `  `  @#`#\` @LX ` 0 n`2n'L> ˒bp`X 'P"` 0$@8C  #\ @ T #`#d PP G'L C `43> `(  >>> (`8#"'L@( > ˒bp`>  "`8 H   04bܟ@?(# @2(> "pŦ`'L`-`@` ``>0>n!  0`@ 2< 9#\     @, 2 > v c qD >@3!(ؐ@(> #  €  "  `0?"`0 ?"  . 2.$ .(  @ 5.5(%Y>  U> ˢ"pa X$a   #\   @,d  2,  "> vU> v c p ph@ >>> (`88$@2`̰  ">`$`@30!`r@((?# @5(`Lܖ ` # ? &"p `"   H؀  0> "ܖ@4@܀ > v c p > ː"p h p  >>> (`88$ >@2!p,L  @'/(?# @5(> v@'ߐ> v c   L?'L ? >>> (`8d%1  8 @ L  > v> v#!,b@ "b@,bD "bD   pL !> ˔"p  "'P`  `4`8"   `#\  T #`#d LP ` `>>> (`8%Z > >!Ȕ   ذ"p ؐ & ` "`># o @ o   ܠ  & L (   `L` a"  > v c o֒  -`L`( LW L( > ː"p Ԓ`"   $  >>> (`8% J@'  L? (c @2 (`b > ˠ"p! $!`8 2L0 ׀2#\Ӵ     @*  LL`( L  L?(# @2(@&L> vc  or  >`$ @1!@'(!?# 5(> #  €LL`( L L#( 2(L  $@+ǖ  @+’'L>L! L#\8@?    @*  =LL"> v`(  @&|LL? (c 2 (> v c o > ˲"p`p`h@ >>> (`88&P@`̰  &`O`>`&`@1G"؀?"> ˒bpa"a@&  > #  €LL`( Ld L? (c 2 (L@&, bpa  "a `Lܖ ` 턒# H؀  0> "ܖ@4@܀ *L( "(7(?# @5(> vc  n > ː"p h p  >>> (`88&>2 @0"("؀ @%&. ?(# @5(> "x@  L(@%ΐ( "((?# @5(> vc   n^ 㿘   @ 0> "p  㿘 !> v>B#Ȣ # n1 @ # n( 㿈  >>> (`88'6 H@ > L >>> (`8`'D@\ y@> "" >"` @: `$>>> (`8'R@  (`@>`  >>> (`8Ҕ'U' H #> ː@/#> ːbp >ta8  2 2: *`" * > ̐#, @   @#@   `2: 2??* > ̒"@,*`*  * @ "bp@$|bp@@ > ρ㿘  > "t@8@5>t ` !> v>}#X`# mm  @w `# ma >t!   > w!@ > "D* @@* 㿘> "t@8@   㿘> "t@8@   㿘a,&` @{>t@Z &` >t!    "" >#x&`  @   D`"\@(㿘!,#>t @% ,a & ,a @&!,  :`0  88  :`  > 8(p(   : P㿘H /m * .  ,@   H 005& ,H 0!,>t! @ T  >#H /m4N 1* .N 1  @h ,@ * & ,H 0> & bp` "`㿘> #8  J1 2, 2J?* @ "@@ $  2J1  > > > Ȓ  C > bp``2 @>~ > @.#> 㿘> #8    .  ," @`2$  2  L 1   (  4 >t!( @ @@$`(    2 ,`> ˔p@* 2@   " @㿘H /m4 ,* . ,   H 00N 1 ?`& ,@h H 0> ˒bp& `>t "`!, @  @㿐> "p 2> >ɐ   @b#> ̐("c(@#@@@|o@*E@&+ 㿐` ` ?@@ | =#@u -> ˤ$ p @  8   a +>ta @   Tp Qp 4* *G F $@8a  $  $ >   -   > v#`" k: 2   $ a @ E@a ` > v# `k%   @   +>t㿈>'> " P> a" L > > > ̚`xH"`H"H"" ""> ˘"p#!L> " ` `"?"" ""!> #!P"# @%> Ԑ!#@$#E#'#`&  #\ ?@ 1? #>ݐ h#>t"! 㿐\`@> "t#\#' . #` ?@ ? "@> &@|  @@ 2 @> А@ז$@@4 >!㿘 >t @ %> >>>!0a@z!Kp &2  *   @H  @  >  ( "> ː 4 ("x86@ @'s> "p@@ 0+  (     $ 2 $( ( "p  4 ( @@  @'F 2 㿘 ? !> >>>!0a@!"p &2  *  4@p  @  %"p`( " `.>>>!0a@!  >>>!0a@! >>>!0a@!@& "p@@ Ӓ0? `<`  ` 2`$, 2)`$(%`( " `.>>>!0a@!̀  >>>!0a@! >>>!0a@!@& `2` 㿈> Ԑ!@ %> >>>!0a@8!p  H## @ . '#`#\?@ښ? H  >tD@@> !  H" 6  #\  @$ ?(# @2(2 `>@+"`? > > !4  p"ܒ4 @ p&@ϒ㿘> "t@ 8 @@ 㿐 2>  & >      > v#`" i 2   & > "t@ 8 @ @  > v#  h  @  㿈> Ԑ!@ -> >>>!0a@8ה"p +> ˔c H@ #'.@ '#`#\?@"? >tO ! ` H" AcĠ @' "(  >"p2(> " $` #\ @# ?(# @2(> >@*"`"ܒ4 @ p&@`ĤcĀ @ $㿘@ 㿈> Ԑ!@ > >>>!0a@8Z""t>  H#'`H@ '#`.@ #\?@?  㿈> Ԑ!@ > >>>!0a@85#"t H@  L.@ " @>   H H#''#`#\@{  >   > 㿘?ǖ?㿘H / * ' > "pW`?H p@㿘H / * ' > "pH 0㿘   i˔ @&㿘& $ ( & & & @& D& >& H& L& & & &    g & & & H/` /> PP "P "`"P& H 0 㿐  & >   j   > v#`" gw 2   & @  > v#  gc  @ Y  " 㿘 ?  &  H L@xj 㿘`@L "` "L$ `2&$` @ $`@" @`$`` &``@@2"`"@&&@$`@` &`@$ $`  $   $ " @}$` $ @2"`"@&N$  " @ 2@$ $` $ L2&$` ` $@`" @W`$`` &``@@2"`"@&&`$`@F` &`@@$ $`  $  $" @0$` $ @2"`"@&$$@ `$ @$```"` "V`" 㿘!2 ` 2'& &` ` &`" @`&`` &`@@2"`"@&&&`@ &@ߐ$ ``"`   "      2+`  2$  &   & " @&` $ @2"`"@&$ &@ $ @&`` & &`  2" ` &`" @`&`` &`@@2"`"@&&`&" &` @ &@" @q`&`` &`@@2"`"@&&&`@` &@Z$ @`"` ` "  ` & Z"` 2+`  2$  &  &" @.&` $ @2"`"@&$&@ $ @&@` & &`  2" @ &@" @`&`` &`@@2"`"@&&&`@ &@$  " 2@2& 㿘@2`G` B  " 2 $`" &@2$`$@@$`"ޔ ``" &@2"`"@`@$ @" ` 2" `@$    0`` $`" &@2$`$@@$` o㿘@   `  @? @ ` &` &`&`  &@`6$ $@Q$ $@  " `  ?@ &   "  20"   " "  `@`8`  8㿐 $ݒ? `@ ` (   L2  >>>#cXV `$"@` #   L2  >>>#cXB `$ "@>#>##\> #` \?y 2` $?  `? " ` )_   >#2? D` (@"+  $3```@ $ >#e?> \ ?!>#YQ?㿐>t!P> >T"T "`"` "`"`> >" "" ""> >" "`"` "`"`> >" "" ""> ̐">" #!Pa" " " > ̒ 0" 0" #> ː#>  h` " h"` `!>m"> >!4a #\    > > ha( `   z#\> >"a0#\ `  p 㿘 >c"؀ $>tH /f * ' > ˒#`h  "`hH 0   > V#", X! >m" >`p@_? > ̐"a  , X" >`p@_0 > ̐ hR , X Xϒ $ $&`( "&` `0@ B >`0&`  P  Lْ`L  ( & `$ ` $ "` "     L2  >>>#cX  $"@$ $  $ >#`   L2  >>>#cXՔ $"@&N&2 "`8   L2  >>>#cX $"@&/&2`8  R (0 `( €㿘 >c"؀ $>tH /f * ' > ˒#`h  "`hH 0   > }#", X! >m" >`p@^f > ̐"  , X" >`p@^W > ̐ hy , X X&`$$ ` & ( "`P 0@ B < 0`P `L L (   L2  >>>#cX# $"@&&2  & $ `$ &` "     L2  >>>#cX  $"@$ $  $ >#`   L2  >>>#cX $"@&\&2 "`8   L2  >>>#cXĔ $"@&=&2`8  ` (0 `( €㿈`4   04 5  `     > v#` a `?`   &  2'@" ϰ  2@ & >   V   > v#`" ac 2   & @\#d#`#\@1  >  > v#  aF  `T "`T  ?   >t>>>#c@$#!   H@" r`$@@m (@j`(e"`8` `0"@BZ@X`8 S`<O`@K`DG`TC`H ?`P >   7> b  "b `"`P@`P `$$`$    L2  >>>#cX  $"@$ 1$   2  & 2 ` (@"  @` @2 > b "b >c"؀ $>tH /f * ' > ˒#`h  "`hH 0   > #", X! >m" >`p@\i > ̐"  , X" >`p@\Z > ̐ h| , X@@$ $< 0$ $ ( $ 8$ 8  8 $ 8 $ 8$ <$ @$ D$ T$ H> "x *  Ք $ P$ L$ L$ P  ( & $ `$ $` "     L2  >>>#cX  $"@$ $  $ >#``   L2  >>>#cX `$"@&``&```2` " `   L2  >>>#cXȔ `$"@&`A&```2`  @& `$ @:&  > v#  _    (  >   @  "  $ (  >  ". 4 `  D` $ ("" @*$@   (  @* ""   2$""  㿐@?\' @  ?@ @ڐy'&@ L@     (     㿘  $w >* > t .㿀`'X'HXd  >>>#c` $r@  H>>>#c$sH`H @ 'H`LH@0@`H@ ``(@ $'H9 @  $'H@H`L@׀@ Ր`( "'` :'`ذ #\ H\ 2'``$ '  H $@ `"`$@:$:  `"$`*$ $ * (: `` '􀢠`$H@ *'H#\H 2o G?`k`$'H#\`H "`Y3?`'􀢠> >>>#c=$`"`*'*$'H#\Hʚ ?( $'H?@[H H?@?'HH`L@@ `( "'` *ܰ '`H&4#d#`#\㿐 H@* L8@82  @_ 2  &      ( &  ('&  $ $  H"  $ H 8 "9 ( ` 2> !􀢀 >>>#c%2 >  € >t!  H  $"@  (W"  8 @o $>t!  H  $"@  ("  8$ ( ?$ 8 @oo $ 2  &   $&   "  "   (`   L2  >>>#cX< `$"@&`&```2`" ` (@`  L2 ` >>>#cX `$"@&`&```2`  ("& $ '  *T $&㿘 f H "  P>>>#c&  >  bx $ L" 2 Y 8   (  X"  X ( `" X@  X  H /f * ' > ː# h& " hH 0  >m" >`@X > ̐"" >`@X > ̐ hu 2 H㿐> "t H@  * ' #` #\ `?㿐Ք ` 2 `$2 `( 2 `P  )  @ >k"$@ ( >"0̖>^"h "     >T"  >N"2 >E""`&  @"&  $ ""` ǒ  (    L2  >>>#cX   $"@$ $   2   (@`  L2 ` >>>#cX  $"@$ f$   2   &"  @?& `"` (   L2  >>>#cXÔ `$"@&`&`Œ >Ɛ#`    L2  >>>#cX  $"@$ $   2 `"`    L2  >>>#cX  $"@$ $   2 `@\``2`X&  @2 `&   $& "```"`   (    L2  >>>#cXG  $"@$ $   2   (@`  L2 ` >>>#cX)  $"@$ $   2  X  H /f * ' > ː# h$ " hH 0  >m" >`@V > ̐"͒ " >`@V > ̐ h 㿈> ːbp @2> >>>#cԔ'` '耏`" H>>>#cƔ'H' ) [ @'   '  & >   ~   > v#`" Z 2   &  ` &@` @ &   `   '  (` `$є`8   `   `8 ߀ ` "$ ढ`$@>c"؀ $>tH /f * ' > ˒#`h  "`hH 0   > 1#"/ X! >m" >`p@V > ̐"<  / X" >`p@V  > ̐ h- / X " ' ' ' ` `$"@ ' $ ' $ (`' (` "€  0@B   ? 0` 8' 8 @ <' < @' @ D' H' D P' P> bp` L4  ' L   $  " 2  ' L쀥 `' T' T% ` $   (@ `  '`   (@`2%ऀ    > v#`Ys਀`?` ଐ &ଐ  @ߖ   ऀ > v# YR ٠ ``耢 `" '&   *'& ' i  (f`W`$@k3`  ' ?&   $ "  "   (``   L2  >>>#cX `$"@&`|&```2``` (@`  L2 ` >>>#cX `$"@&`^&```2`'  '`  (@``" ऀ  > v# XĔ    > v#  X `  `K ऀ  &>ऒ  |ऀ  > v#`"X਀ 2ଐ &@ऀ > v# X      > v#  Xp 7`f `ה@㿐 2 H & >   |<   > v#`" XI 2   &  H@* L8@8 ` @`$'`"! ` 2 `$ `( `P 2 `8 2  "`8 " ( :`0  > v#  W 㿐   & >   {̘   > v#`" Wٔ 2   &  H@* L8@8  ` @ I ' (  2N `@2I `@ " ` *`8 7 ( `<&`<&`@&`<`<>  8  ` `$ ?t  `H 2` 2` `$`  @  2 `@" ` *`$ > v#  WZ 㿐4] 6 X  2 H & >   {*   > v#`" W7 2   &  H@* L8@8x   @  (   (s$ D "  * $ > v#  V  㿐 2 H & >   zИ   > v#`" Vݔ 2   &  H@* L8@8   @ L (  (4 6 $ T > v#  V   "  * $ > v#  V  㿐  >>>#c`{)e2! H 2 H  & >   zY   > v#`" Vf 2   &  H@* L8@8  27  > v#  VB ,  @Œ (   $@:    |  x   " * H ({ H "  $ H $   * $ 2   > v# U  2  8 2 "  <  ( 2    ` @c $5 H < `$ H $$ ( @"  (` (  (?$ H    $8 H 2  > v#  U    ("  * H   &  '> v U   ( @  H 2  $# < " B Us >y# 瀊`& z  @>k#?$ H " * H  H? $ H $ H $$ 2 H 2-  U9 #  瀊`& z  U(   U# >)# 瀊`& z  㿘  >>>#c`*c`  & >   x   > v#`" T 2   & `!` D (@" `H "`` &`H`$浐`@2`H `& > v#  Tʔ հ `  & 2  D > v#  T ð  (@  `< " ``H 2``$` " `@ 2`<> ː"p  2  H@ @(   > v#  T   (@"& `<`"``H  `8 2`H `2` `( 2 `H` `$  `H &`H`@2`<   &  )> v# TZ  D  (@`H 2`` `$`< "`F# TB >H# 瀊`& y  @>:# `< "``H?&`H`@2`< D@" `< " ``H? &`H` &`H`$`@2`< # T  瀊`& y # S  㿐 ` 2  >>>#c+N 7> v>"Ȯ  Sٔ  H@* L8@8    S ̰ ` `8 2`$  (`@"` " ` S  `` *`8 ` @'`P@  `(>>>#c0+l o`m>t!$ "j` `$&@ "b` `L V>   Q "9  4G> D> 0@> 0 ?>  , ;>  . 2   "3> >>>#cHF+" > >>>#c`;+#  €@ B> ˀ 4 0 , > ː:? %~> . x> "p` `4&@`$$         2` '`` @ c@ R 㿐D @  (@" ` @*  `< 2 `$@ ` 㿘> ̠ !4@ 㿘 @h @ `@d @d & & "`  ఄ ఝ㿘 `  @֐@u.@t& @㿘 @x` 2z`` 2` $`>`  vd``  > v#`"`Rq` 2`` $`` `$`> v# `R` `H`L` 2`@ $`>`  v6``  > v#`"`RC` 2`` $``@`($`H$`L   `L2  >>>#cX!  $"@$ 횐$   2 ` > v# `R 0 = @t@tm& @㿐 ? 6&  2  & >   uؘ   > v#`" Q 2   &    H L ͒ @cu> ̐!4&㿘ऀ 2 $>ऒ  uऀ  > v#`"Q਀ 2ଐ $प(L H F (D8`" ` > 2D> Ѐ " 4 2`     >c"؀ $>tH /f * ' > ˒#`h``"`hH 0 ` > ]#",`X! >m" >`p@MF > ̐"h  ,`X" >`p@M7 > ̐ hY ,`XՔ X P  $ H>  bx $ L" 2 c  (`"  ` " €   ( @ & $` @ $`"``" `   L2  >>>#cX `$"@$`$` $ >#`    L2  >>>#cXՔ  $"@$ N$   2 `+    L2  >>>#cX  $"@$ 0$   2  >c"؀ $>tH /f * ' > ˒#`h``"`hH 0 ` > #",`X! >m" >`p@L} > ̐"  ,`X" >`p@Ln > ̐ h ,`X  X`P  > ` bx`$`L" 2 Ϝ `(`" `8` "`8€ `8$`H $`8  @ & $` @ ( $`"``" `   L2  >>>#cX' `$"@$`$` $) >*#`    L2  >>>#cX   $"@$ 냐$   2 `"P    L2  >>>#cX  $"@$ d$   2 P "H  H    X H  P "-3( "@8  @ " 8>  t<  $8 $8 @  > `t`<`$ ` 2 8& ऀ > v# O 0T@p  8㿘> #(@ђ  2>t> @#>t!(> `2  : @t 㿘> #8` J`1   2 ` a 8`` 8```2J`1  >t!,@t("@*` n4 $@``=#'`` ` >=#X*` > ̐ @ 0> ːp !T>l#\lĘ lh> ˠ"p X'kv \ \ ` _T Q*$ X@~ǒ d$ LK > ˠ"p \'kY ? X `  _7 4*$ \@~ d$ P. > ˠ"p `'k< " X \  _ *$ `@~ d$ T >t!(k@ -㿘 @8 0> #88> ,20J1`+>=#*` >t  >t  6 !( :  6 !( :  "  6 6 2,> ˒bp`& ,`` `l"  & `l` & ` `" & `& (& & & & $ d ā N N㿀`` `@@ '^ ` 2+@   ה Q` ('    2 ِ'  А@  @ `2' > "t@ * ' #`#d#\ʘ 2 `   А@ (& @ > & ` `0?"`0`, sT`0㿐> ː"p @ `` *  8   2 a  9> v>! # M  & ( "  >>>!0a@!: $>>>!0a@x!  (@"p ` j `$@8`8 "$`(`(  8 >>>!0a@T!# $ 2`( ?/杔 > "p 40`P/  L˺$ `   /`O ` `0$ @ C  @  /j > "p Ԥ (  '# *w8#  M`Ɣ `@ `` `` ('#     ?   9> ː"p  @d@@ "@@ '@>@@ ɰ ` $   Ѐ@퉒's?6˒ 2`0  %`0U` 2 `(`<  D4  O `@D  `0`,?`%`0r `0> `< 2   `  ?    \`   @ N` @   D` ?`   7     2 " "p Ę *  : b 2@ ( #\;` d #h@ `'@` `0`,?`%`0q`0㿐`@`` `  "`> "t @ @$ .@`/ "  )> v>! # KӔ %# $ "@ KÔ "  `  `Ŕ@㿐> "t@`  <$ N >@58I   2 & >   ox   > v#`" K 2   &    > v#  Kn  ~ > v#  K_   U  㿘`@ `> "t   #   @ Q     㿘> "t@`  `#   Ҕ@   0   㿘> "t@`  `#  8 >? *    @    @    @  㿘> ˘"p @`  $ * @:   2 H  #W "   =   㿘> "t@`   $ * @ Wp "      㿘@` WU 2   {d  2 #㿘  n  㿐\ `Ұ /> ːp  :  2Ȱ 2İ `2@@ *  &@@  1@ʔ@@`??@ ?`< `?@`' # @ ` ?Ӿ   `? `?ӭ  ``< s q 2/ / - ` #`#\Y S 2 T 2  % >   mӘ   > v#`" I 2   %  "p`` 6`H   > v#  IƔ  @@@ 3  " @(@0> v#  I   `@H&(H> ˚ x> ˆĔX3@P( H (    2  2  $ 2 H `,2E`,`.@"`` > `@ `.? > 2`.p `.!0 @2 ``>  "`` > `@ `.? > 2`.p > ˆp  `,2`, ,(2 ,> ""  > ˆp  .2 . 㿘 . " .`"  "`> "# "@ .?# > 6 .bp`?"` .`6 ,  `0>>>"b`ʔ ր "> > &#&# &  "@"  .> ː 6 .bp`> d "`€ (  > !@ ? (# @6 (`.!0 @2 ``>  "`` > `@ `.? > 2`.p `,!`.@"`` > `@ > 2`.p > "@"` 㿘 (?c > @2 (㿘`(?> А# 2`(㿘> >t 4 "x82@2: *" * > ̚#,@ @ ` @ 2: 2? > >>>"bx!; *c," * `@㿘  > ˘#đ-  -@@  "   "$ > ː "c" > ː "c" > ː "c" > > u" # T# P# ,# X"" > >t!8`" >#   > ̐#, @  !8"@ > ːbp  bp,@J`H,, @@xZ 3>ta8 V> u > ̚#,`@"@( `>$@#8>#h,`"> ˒@x*` ` "(  .$ > ̚#,`" 4" 8" <" @" D1> ˖"p`5@@ ` 8 "p `" @x"p @ פHa8 > u#> ˔p> u@*@&!> >t*@&<  "P  0$      "(","`"\"T 4$` "X"L㿘> "p "p#"p"p ">-#x` ""p `"p* "㿐+> ˦bp)>t!@`,!> u#> u#@Knc #%!@c8  @ $#$c> u> u#">">#, "@Ր 2> >#! bp 㿘#>ta8? , "*  > # %> >Ȑ ,  2e @  @-   @(> "x *@&@    `#@ # a8 2?> 0|$a8 ,@ 7 a8` u   @ 2.  (> "x* &@ ? #@ @ U a8 2?>r 0K$a8,@  a8` D 䠄??a8? 8, "*   %> ̘,   &> "x *& @   # a8 2?>6 0$a8 ,@ ʔ a8`  䠄?І 㿘 =     㿘> "p > X >  >t> 8 >[ > ! S >P!@0^ > ̐,  2>t 8 `,  8>t8 `?` >Đ!`  > ,  8 `, 8- ->t"@/> 8*`,@, "* ?,?< 䀤$@$`$``$` .?$`$`8`$` %8@㿘>t!8   > ̐#,   @ "   )> ˡ,  &, )> ː# T+>  P, bp ->t,` @ 8 @  c  >!0c   "" ` H /f * ' #Ē?" X" P`:" T0` "` $  "@ bp$#`2 X  P* @` `2 X  P*  "`$2@  X  P * @"`2 H 0> u# ۱㿈->t>8!P 8 @$> > ̒c,`` ` @ ;` >  "/#\8`@ >'"8>$"P>  >"㿘\`   3> >>>"b#3> ˠbp 8  :   >>>"bz#  <@ >  @@  D   > i#   ` bp`  8` bp``,4`(`( > v#>  @> !@     ` 3`2> > ː#ē*@+`@ *@+ @ %@> 0 > >>>"b#͒#đ+`  +    ` ̀`>#` "`" "@bp`?"` (! `$?"`$ (! ` "``  "`H * I > 6 (6 *& & & 96 .`5bp >  $cđ2 `X@ `P* @H /f * ' &  & ""H 0 &   ` & ` " "  (  6 (` "`6 . ? (# @` 6 (>  @0 㿘 N` (  > >>>"bq "x>  $cđ2 `X `P* @H / * '   " "`  "@H 0  `"  "` "`   "@ (?#  @6 (?" *&  6 *`F *>  ( 6 *` & >>>"b > "x>  $cđ2 `X@ `P* @H /f * ' & ` & `"&`H 0 &   ` & ` " "  (  6 (` "`㿘 (`W 0 ?# @6 ( (  > >>>"bҔ "x>  $ē2@  X P* @H / * '   " "`  "@H 0  `"  "` "`   "@ (?#  @6 ( ?" *&  6 *0 " . .`?# @6 .|&  "  .>>>"b0x$ " .`"  "`> "# "@ .?# > 6 .bp`?"` . ! 0  `2   >  "#`"  "`> "# "@ .?# > 6 .bp`?"` , > ˒bp6 ,` ?"`  (?" @6 (&> ˠcđ*  & *  "@* "  > 6 .bp``$ "`>t!<$ 4w㿘 @+,` #?""` ( " (g ( ?   ? `$€  `c  >4 (`# 4 (`@ّ,`㿘7%> ˒p``$ 6> > Ĕ  Ĕ*@ @ 2> "#% 02` "`$` "@p ">  @ (!4 (` $`" $` `$`$ p $`"$"> v#耢  > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > >ȝ㿐> "> Ԑ!  > >>>#hcxK A"x>ta8  2 2: *`" * > ̐#, @   @#@   `2: 2??* > ̒"@,*`*  * @  >>>#hcx  C㿐!>t> ̒`<! `#\@ 6 > "b> > "b! "؅@> u> u"c"> ̒ 4" 4"` >t, !D    >t㿈  )> ˤ"p.@#> #`b'#\ ?$? 3> v#> `> u㴀 > u>> ͐##@:  "㴀@'>>>#hc( > 6  "b>> bP""d )> ˀ &   >>>#hc`  (  > >>>#hchw b"ܖ 4@"p޲@㿐'> ːp > ucc.@ > u"#e 9'#> b 2b $ >   d5   > v#`" @B 2   $ bM> b be"bb` > v# `@& p .@ > Ԑ!@R#@   㿈`'X X` @$ 4 ?@?耢4 ?쀢(?)> "p@@yb :  2  @ ( & q&"p@@yܐb*`&   & "p  < CB(U+ "N`. 2`( "G`( 2`( 2`(> !@ ?`(# @7`(`( 7`(`( ` +> # `7`(€ 2?&* &@ &D 4 耢4㿈'XX ` ` ;`#\`  &'@ &    `@ {  2 M K `D@A 0= `8@5!  `  `. > ` " "x@y `  `<   ``@ `@ `  '@&@ ߐ㿘 c @Z X 2@ . !"@  "  > "x@x    @`( "@dF @(` '?. ?# @2(> #  €@@ ( `$€  >>>#hc"# @ 2(>  d@@>  L@@@`( 2`(`㿘>m" >`@:p >O $& X& > ̐ 4  &  "@" c?ԁ㿘'> ːp  8: - 2  2 * #>m" `>`@:K  0(  4`"  0 2     p  H,Ӑ@,$@  H S  `. 0@ "` ` >>>#hc #H ` `( +2`(" ( @" >>>#hc#Z( @2> Ԁ ` >  d@ >  L@@@?(c 2(@( 2(˒  >  0  >  \ "> > !z $>K*         㿘 H /d * % > ˠ#> v# <@> !(>c#l: c 8> ː" @ar"H 0㿘> ˢ"p` @m` `: $`< : @ $`< `, @$`<$`<`< @mH, $`@ $`@` @m@ $`H㿘> v#> " H o@> "|> ː#>H "a+ %> ˠp! `{$! @"    @m @$ D `$ D  @@ D  p@Kp, `2> b> ˝㿘H o$*@e%> 4  4>XԒ" `4$4$`H 0'> ːp% 0@p8  : "@# H /* d % X@ H 0`> ˒"p`, > bE# 0b@`0p> "x@:@:@-5 *`2 2`* `#2`p*`# p'  ' `  ` !> ˠ"p  @ *`@  ` `' `%> ˠp! > ϐ $! @b@'耢 "`.Ȑ!, $!,`2``2+`(`  >>>!haxO!2`(`0  ?>>>!haxA!`$`04`.`( pa0 ]"a0a$  "a$  !0 R$!0!( $!(`( %!> `. 0 > ˒bp`p "`p> #  €-> ˒bpa  4"a 20% >>>!hax"#"p@@ * @4!hp $ `.>>>!hax~"E `0  "pE "p h l  `0>>>!hax8~Ӕ"X  2`(`" `.` "`.@В `" `. "p @u`  Ĕ``(> `.` 04`(@ € !> ˒"p` 7"` " `  `@ % @u` r`. "p @: '@(  2 `(?# @4`(.  '@ % > "x@u` @  `&''  "@@l@> ˑ5'' > ˤ"p4 $4   ;`   #\  `8 `$8$`. "WU@T'G 2`(>~6"` "`(``(?# @` 4`( q% > #  €@'$ & `$€ @  '耤 > [>  d@ >  d@>  L@`( 4`( '耢   . `'耤`J `H`㿘%> ˢpa -$a6``@6aa ~$aa  a`d >  #ܒ`> #䒒 > ˒pa  > `d > #> ˔"p "@D "@lh@ > p > ˀ "" > j#Ԁ f .`2   2  (   >>>!hax}o$2 ( 0  ?>>>!hax}a$`$ 04 . ( 2>`, .    "  .@X  ?"  (c 4 ( . > "x@tL   }  @@  (?# @4 (> #  €2> ˒bpa< "a< 4 (`4 (㿐 ?>>>"Вb(} f !> >>>"ВbP| g"p"p` . @@r"  G8"p ( , @ Ь @)> ː"p!>t !86@`  2`@: *" * > ̐#, @   @#@   2`@: `2`?^"p  !8`32`@: *" * > ̘#,     I2`@: `2`? 2@"p@r> ̦, c,"* `)@* *  . ""p*` * @  4?  `@ '*` *  . u@ @='*` ,  (2     $ * *`@ > ː# @"` "@> ˒"p`?"` (!" *`$?"`$ *  6 (6 *6 .& & &`& `"'` @' > ˔"p@<@ > @@ D > ^#e㿘T = .  " >>>"Вbx{! ` "`&  "@ 4 .$> ˢcđ*  $ *  "@* " > ˒bp``$ "`>t!<$`4 2 .㿐> u"#> "b> >#  8 >   > ̀` " D> # ">>{#>  #\ \ k > u "c>{ (> >"`P#\   rt > >#`X#\ x  rj @㿘> u  "4 "$ $  $  $   "` " $ 㼔㼀 $ 㼐 "`"$ ;u \&  &$D &$H @2 $ "$D$ > ˒bp`d "`d> u) "! $@ 2$D`$D@ $H "dH$H@  $D"dD> ˆpd d  2$@ 2 㿘> u#@  "$  "@ ; \ 2㿀> u# #`#d#\   l ">zҐ `&$,&$(> u " $( &$D$,@ $D 2$( 2 H`-> ͐  7@  > "԰  &5> u# `,```#  $  :> @qx* 2`  $ Ŕ$ `$п$ $Dd` `2`&԰ D А``2@> ~" A ° @ * > p$w " @>zG    $* 2  D'''''? @    ( 0 2 < " >  ~"b` \ 9 ޒ    h0Q`̒ `  \ 8$̠ \ 8ߐ  @g$̐ $ $$@< 2? $< `C$$Ȓ^ \  8$$$$$ ">y @1 % < 2$C$$9 \9ݒ \0z 2     @א  6 0+> ~d@b @@  <  2 4  > * $"@*` `" @?! @ bX+ 3`    ` D bX  L&dP&dL< * -> ˛2&`p@ @gG* <  ?   `>t_ aTd4 "aT> z #\ ? \ i{  &d0 j]  "b>y b(> # X D  (:` p`* ` , <$d0>x j;  >>x!zU!0$@>!PzP(Ӑ`> ː ? &`bp&d`h  "`hb@ 㿘`d( d,&` 2 `d(d,f "d `  ?&`d$@" d@>>>!pax$m < BrdWd@> ~d@"  @ d> ː"p h d" " hXd@ >x! > ud( d,ki#i:d08 \㿘>X> h!ؚ ;P㿘>X> h!ؚ ;D 㿘 T: 2* @ > ˤ"p@oL*   } 2d( 0 (& 4& 0H /d * % 5H 000$ @o< d@* 2` <  >"x H /d * % d@ꆐ& TH 020@㿈H /d * % 9> ͐"p H 0 % % % %% >`<4,  ,  `H `&`@$L$@: '@e q씒 ?>w"0"$LH /d * % % < @e `Œ"4H /d * % 7> ͐o H 0`0 @$ 0$ <$ 8$ 4$ H=  $ T`,>Y!P"c!$ ,$ X$ $ \$ p`d 2`<$ `$ d``""@$ ``<`d""@@8$ d`l 2`<$ h$ l`h""@$ h`<`l""@@8$ l T$ t$ @H /d4 * %  !   % /$Tdw@<H 0 >D@TH /d   p  * %   ?`%  `""`0&`4(&`0"pȒH 0㿘  ! $$P&  &$x&$0@\`t "`t  $$P6 $x2$  ?& 㿘 t>m"  >bX@/  < @`@"@ " $`@ ?$  4 2$  \ > ѐ> ͐#pu  "`@`0($`0 $`4  2' 2#> ͐"p`ϗ 2 "  >>>!pahvu& 2 > ͐"pF}$㿀'> ːp d $] > u#`"P``"G`   "?$D$ $ 48$D$0   #`#d #\ h 2)$D$D`@ $H$`"dH$H@ $D"dD$$D`$$H` 2`$`"$D$`$ p $$ l "l$($`2 ` `2` ` & 㿘B d$"d$㿘?94> ˢ"p`d  >>>!pau&2 $ >>>!pauה&6 $(>>>!pau̔&$0& hȖ  >"w<$ "$$ `l"$`l㿘@?@+ 㿘> ˠ"p t'D  $ t>>>!pau&쀢2 p  ?$ pD@    p $ p㿘)> ˔"p66>`@l` `* 2` @?@    " H /d * %   > v> `# ` +> m~aH 0`   `> !P !&`0&`,&`&`T&`H&`pH /d * % 7> &`\H 0"p`.&`8&`<&``.&`dH /d * %  t`" tH 0> v#> ``02`@ @@>N#&`0&`X-, ǐ`02` `{H /d4`\* %`\  ` a`\ "aanH 0㿐> "Ԁ>v/#0J  \>v&#00A 3$̢ \ 3 $̒ @bJ $`$d@ /$@  \ 3$d $d>d#H !> v>t#X# [ d@d4 \4 \0# 㿈> ːp    @ а  . & ''p$@86 ` đ* ` *  *' & ##`#\ ?ϖ? >& uF# `& đ2  @"@`" đ2 "@$ İ 㿘  Ԁ@> & "p`> ȑ, "@: `   :$04 $ B ; @b 8  @  % Ȱ  p`  ( ( D Z8 "<>s# L= #G$>@ 8 Ԁ > ˒bp``* "* 5  *` #* @#@ aH ''' #\#`#d#h#l  @ D #`#\#d#h#l   @ D &28㿘 >s  > "t@ 8 @ 㿘> u"#> u> >"cĐ t@  0K 0   > HtВ  & >p" T8 > < 2  > c$*" * `@ "  " <  `݁ ` q&  "m> u & ( ("`,"& , "_&  `!&  > c$*" * ` @> v  `h@  @ (  @e   > v#@C "  >t  "& Up& & !X& &  & &    & & > `& > u & ( ("`,"& , "&  UI " 㿘 ? <&  @  ?` & @    @ h0+`&     @     & ""   (`" , ,"`, , ("@  " >r & U=㿘  <  ?&  `H&     @o    & >Ȑ " S@  2     & >rR " &  (`" , ,"`, , ("@&  T㿘 (  >r7!> #  €`&@4 `"&   " >r !0  b"   (`" , ,"`, , ("@  " >r !h "$ T$  `> ˒"p`@:* 2 ' 2 * #p '  '`'"'`  8 ;    ;`D    ; @hАd2`*  *` '2 @ ` `H   B "'  = ܀`2 ( 4   $ 4  (2   $(  (?# @4 (    ? (# @4 (> "p @ :E " ؔ F'܀`` 4<   $ 4`22  $ `, > "p @ :E ` (   ) ` & #' `"  ( . > #  € (  > !@ ? (# @4 ( (`2`  4 (25 (    ``q`? , @2ڠ> #  €Ѡ`"Π (  4 (> #  €> c  4 ( € *7;`2'#\'a` ```"`>pƐ!`   ֑*` *2 @2   z  .@q  **2 @2   `````Q` ``( "`(R`(?# @  4`(/ ;i  `4`(>  L@`? , @)> #  €M ````(  4`(" >  > q!>q"'> #  €:`    4   "   & >P " P   ! >R   >& 㿘> @4 > $@>o"`@@  B > ?p 8  @  ; F;`  @   p 8   @ ; ;`F  ?㿘@ 㿈d @5    '  @? '`( !   >  2`(&@> "p :@ D ޲` 'u s   l  @ 2]> ˀ W 0( `!  `2(> " P>@`2(&@@ ⻔ '#\  皚 '>"@@ '> ː  @. `( Q ? (c 2 (00?(# @2(>  L@&@> "p :@ D ` p@6   '> !&  " OԘ   4 2  $ @?  2 2 |  & 7> ːp 'г.@ D 4  $2   $(  $&@ %> v ?''쀊`@'''''  S! 8  `  `    @ * 耦`&@`p pȠ@ p  `. "@\   ?  & `P `  㿘   "   `& ؔ !> v# &  #`  㿘   4  2>  $( >   $% > 㿘%> v'> t + #> uc" $c> u# #> u "  X2 (  2 (   D  $ ccȀ $ 0 0"`$c ( 〦 > u#Ȁ $     1   " (`" , ,"`, , ("@  =$  0 t * 㿘 >t!>ta >&@&`&`"o 㿘`2>m"Ȁ  .@     `.@ `.@㿘` >m""@  @      .    㿘`> nԐ#@ 㿘>c"$  `@_ `?@`> Ϊ" ` >n#P0` `40@*K &`0>c`@Ő&`D> "&`D`D> %> p" >cx@8`0&`4@ 2 *@&`8 <- '' @#\#` ?  >>t! @ >m# 4 &`@>  4 !`p @>`<  -> `T    Т@-> p@bo`@* @ `8@bh* ?p$`0: ? 0$ І$`@ :`@>`< 2?`T  ?&`<&`8 H `0" `0*` ?  "6 `0 <"``0" H 0 `0>@#`82`4 `2m3 a4  >@_ c8 2'a4 ''@`@q@P >c 'W @>> ˄"p> 2@> *```<"p"0@( 0 0 > ΀`<> x"0@( 0 0 4@㿘>c"$   `@^ `?㿘  > 0& ">> mz @> 4mv P>c"$  >mk ` 㿘`> mb @ P!>c"$ ` 4>>mS >fU"@"$ ` >>mA 0m> a4  >@^N` 2'a4 ''`%>@ $`@a> &`< *  &`8> k@r`@'>lN %l@e > mk@m  @p >d'TV N `4>a@pl@] 2@B >@]a 2> b "b@: >d'TU @g >㿘` >>c"$ >> `(@bv  >>l 0l 1>  >f$ *  & >k!! @]$>fT"@㿘` >>c"$ >> `(@bD  >>ll 0li 1>  >f$ )  & >j!H@\$>fTǐ#@P>c"$ ` $`>lB 0P0`4 @'Ք &`0`@< @'ϔ &`45>@ $`0@`D &`< )  &`8>!pj@x`0> >"!l `a4  >@]$`( 2'a4 ''> #>d'aԖ 'U&> 'a'U 㿘 < 2`4>j}!? ? -   ="@ <  8 2    * *  2  &`0P2` >c"$ 2` ` @r> ><2} > <@@"t ` >c b$''`' $> "d. '䀢  ?@> "p@'  ` '`'?'` '8`"' > @\|`  8>@\s`  2'8>@\j` 2'8 ''@'   "'耢`">d@'>dTT 㿘i 㿘a 㿘Y 㿘> "x. >c"$*` `8@'@@  >>   4 i!> >j!  *@  `" @  2㿘>  `?>ii!2. >id"(@ 2"@ 2 & > ".`   >f#(@ 2  (5  2>i>"P@[9 >f#(&@!D& 㿘>c"$ '> bp"bp?`  *0 ҃`6bp @ 2 bp?*@bp> "t ? # @& 㿘> "p?@> Ԑ!@7 㿘>  P> "P )H/` />c"$ > ?8` **H 0 02> ?8`** > ?8`** H/` />c"$ > ?8` **H 0 > #>cclː(2 > ΐ P 㿘>c"$ "   >0>0 >"h>"x@[`?h"㿘0?8 @%~ >c"$ ?8 >   > ΐ > *`">iҐ"> >g aPG > "P f 㿘> ` >hP"H > *`**@H 0 > 㿘>c"$  > ? > #@Z   t 8@ 㿘 > ""   @%0> Θ! > *`* @ *#`Ē@ @ > "! #> $c5> Ē *  Đ *`   ™#  Ā`* > ##>`">">"iF 0 c` >`$ci<"㿘>c"$  V` > ? > #D@Z>    8@ 㿘>i#(  0@$%> > "c"$㿘>c"$ 2> ? > #p@Z "   ݒ 8@ >@Z"`?㿘%>c$` >#0  >@hc8 2>>gk#@hӐ#H>@YcX  0 @$a!> ϴ#> # a  # &a  0 @$K(> ϴc > Ԑ!  $ > > ΐ? a> >  "c$" > *  *`  *  > #!"`Ё㿘>c"$  > ? >@Y"   Y 8@  >#`" >#p@Yx`?㿐!>c"$   ?* *   @# ?   @#0? ?> > "`"" "$  ?0 @#ϖ ?   > !> " $# $#'$@b d@6>f#x#> @: @d&#> #>h#㿘H/` /  > ucЖ    "c > ucА?"cЖ`?H 0 > "p>  В > # > Ԕ ! > >c$g> Β `* `*  `*  `*  `*  `* 㿘> "耢 !!>c#l`d>g# d> "cВ d$#l@S!"@!> >c"cp Đ *V  Đ *`O  Đ i*`%>cl"@@Yy  >g#ؐ d$l d@R>c"cp#> c c l$c c @Ya  c > g| d$c c > "#@R3 > : b`d  :  "!>c"$  >c#p>  ̓*` >  "+ ""$  >c#p?`*`  "* " b> Α: "$#`""$  㿐H/` /> "耢  >  ` 'ː 0>c"$``>  '`? 'H 0 ~ 㿐> "耢 !>c>e @"$  >  >   ' "$>  ̰ ""  "`0" ? ' > "? >  Ԕ "$  >  ؑ* "@"$ * ?"`  㿘8`(< ;`; :9 (`/`+* *`*@  ( .  `.` . . `D@`E   43  F, @  `2!m!n`@`>?P(P? ` 4 . (+ &@ (.`& +`. ( (㿘> #(Ta@QȐ @X4 @Q* @X+ &  E& &    `?  >, PR  4  6>`P* R@ $`& & 4& Ta@W@Q.& @W.@Q| <& @W <&@Qs * @Wߒ & @Qj*  @W֐&  @Qa*  @W͐ &  @QW* @WÒ  &  @QM* @W  &  @QB* @W & 㿘>  ЀY`?!  >e h ư!@ > "耢 @>    `@- `-Ԛ> "c(!> #(  >e $#(`#>@%>#(, "#(6>>  Ta@Pߐ > el>ei x> "耢  > c( ->  Ā )c(@2> #( !>  Ѐ >  ' `,',',',',',',',' ' `,''㿈@@㿈@F'@$> ąH> ΘĄ (  *@`@ Ą (H > ąH> ΘĄ (  @`*@ Ą (H 㿘!T!@PD!@V@P=..`@V.@P6 <.` <@V.` @V .`'2>>!l!m`P.`>  "c> c        & c "  .`.` `; `7  3'  2!m!n2 8    6 ? >   ?@* (@*   (*   ("@㿘> "耢 k0=H > #(#(& & H 0 > uԀ@   > 4> cԘ&c`"? & ?/! && > u"c c"`㿘>c"$  =  e9 %"8@p .1> #    %!q `  # , `d#6   @ " @]㿘#> c` 5 , !> #$ #@  @N* :  .@>c#l@O 2c>  C @N* :  ۴` #$  㿘#> c  !>  $# >! B $#  2!>  $c㿘>  > #`"#" Dy 㿘>c"$  >@Tm!`?㿘  0@ > "`>  >*cE!㿘> J  ">  @ *@s"@㿘`@TD `? &`0>a0@  &`LX:   @2`H &`H`H  >D 0>@!x>c"$  0 >!8>!@> "`(@T`H>`!Ha0`@@S> ! `8`< (@ga`@ h`4>P dc>bА!h> >> ϒ !pxb> Β J ">>b!x>b!` "`H@.`H >!xH/ /aD@/dH 0㾐'pp:   &!> ΐ "a㿘>a> !b     >!>bu! $ > ,!bl: >! <-> D!ba: %>   `&c> !bT:` >`&c l :` >"P>"X   s h> b=" >! T> \"`: b2`>b-"x㿘> D" 8 <` @  ""`l0= . 08" >&"`d"`"` "`"` "!X"!H"!L"!P+"!T "`l"   "` "`"`"`  ("`l"   "` "`"`"`  ("`!"!"`l"   "` "`"`"`  ("`㿘!> ΐ!" !  "" 6y # !?00 $}0+!@  d !& & & & \!& d!0  "_^ @ !,! & & & & d& \b@ !$ @! & l& & & d& \& `& 㿘@ >b@, & h& d>bД @%& \>b@ & 㿘`? >b@@$`& >c@  >c@ >c $`@  $` `  * & + "@>_#0 * $`l$`>$`cH$`@  ! &!㿘!  >c"P @> > > Xa_ (㿘` >c@>& >c@   2&  & !>& @.# y%>@( t> o#@  & 4> c@ & ,`  ` * ` * `"& 0>#_}& 0> @ |c 4& 8 8& $@ q & L> `@ k& D`  ` * ` * `"& H> _N& H> @ M`0& P Lhf P 0& < H 8  ,&  D@ 8  $& 1 >`H@ 1 & > `X@ +& `  ` * ` * `"& >#0_& > @ `h (&&!>@  0 @  & d> `@ & \`  ` * ` * `"& `> ^ْ& `> @ ؒ`& h d h& T >`1 ؁㿘@ Ā( Ơ㿘@@㿘 ւ>!  @ & T&!>`!  T &!>!LaT&!H&!\ T   & 㿘 > T  #@2 >_!@, 㿘 &   Ң @|㿘 H H:  < @&!\& 4& \& &! &!0&!,&!D&!4&!H&!L&!P&!T@Z&!X&ƀƠ㿘 H ?>H` >bX@ 2?`4`` >bp@ &??>c<` >c"$ ? ` >b@ ?`4`` >b@ ?'> <`# `!?bX@ ?>> 8bp@ ??>> <b@ ?>b@ ߔ?> #P)>c@"$2``?2``?2`` ?2`` ?2`& 8& <& @& D`` 4 2 \`& 4 \ 2 ` & \ 2! `& ! 2`` &! `` €`"!0 2!0"$ !>"@  & @."@ z & !0 2!,` &!0!, 2!D` &!,!D 2!4` &!D!4 2!8` &!4!8 2!H` $&!8!H 2!L` (&!H!L 2!P` ,&!L!P 2!T` 0&!P!T 2!X` 4&!T!X 2!\` 8&!X!\ 2!`` <&!\!` 2!d` @&!`!d 2!t` D&!d!t ` H&!t㿘> !Ԕ`!` 2``?2`` 2` `@ 2`>x^㿘> c " "cH/` /  > cP@``@u"`` H 0> ΐ "a㿘>c"$ 2    ` >#@O3`?㿘>c"$  > ! 2"`>\#``2 > Β 0 @ > "!>]#㿘 >#>#>>]#>> 0H]> !`>>@ h]ڔ>\l 㿘>]Ӑ >>]̐ >>!(@]Œ`>\R!h㿐>!8€` `>!]2`> c̀> cА  > ?> "#c"㿘 + #`!>]!> cԀ "c>!]y> Ԁ + > c̀ ""cЂ$ Т@  㿐>!8€ ''|㿘 4 > ΢!ġ. @  `@$ ` " 㿘` @NG "$ >c"$ 2  > >c"$  >  >b8@ ?V`  `?"p  & 48@ 㿈`> Ρ,! @e$ 2 a0`@"a0>["@`>\"P0`>"p\  ```P`0>" '耤>"'2,>"',,> ΢a@> '' ,&&&& p/> & &  > @&#&> #ؒ  &.G.J.H.K @V >uE 2 @ H /k * , @; H 0\`\ \> u܀ > u> u ""> `4@ > `D @  >#">>Z"bȐH``0Ho o @  @ H 0㿘`" >\/" >\)"؁ 㿘>       ,@  @z "L |   $ L |L آ@@    `> 쀢  >c"$ "쀢` ’ 0 㿘> a쀢 ( "aH /e!> * &!>      . @  @v`  H 0 㿘@i @e   * 2 :@G 㿘`2  .`>Z8"@G 4 @G: 2 <`. =. <  H( @ *I@*G *I *G@@   *H*J*K@  *H*K*J *J*H*KH  㿘*3>cb$ "  b$ "   㿘*3>cb$ "v *b$ n 㿘>c b$ " b  㿘*>c"$ U 㿘 >c b$ " I  㿘 *>c"$ < 㿘> !>c"$ @  /  2>c>Z"@j㿘H/` /#>cb$    "#>cb$    H 0㿘H/` />c"$    >c.  H 0> > ?߄ @( `(  " " 㿘> !㿘> !ǒ`> Є Є " " 㿐#> vc   Ho o   c    cH 0% H/` /1>c"$`> " $ *c P"$`> " $*H 0 " 㿐`/H/` /> v#  0T@H 0> v#3> ` ``@M+>€cP ??`>Y#`0=x cP@ " >`@ 2>#Yߒ0&>b€ > c@^>@Jb Ox `J@ 2`J@ :J` ` z$?@%>€ >Y#`Ix @ " >@ %>>#Y0ݒ@>@Jc > ""h$ @>@Jb ?Ox `J@ 2`J@ :?J` ` z$?`L`HJJ@ >Y`    $ ?>YU 0@Ԩ   > > "a T >  -  >YC P ,`>Y: `0,  > ΐ!Ԓ " > "!@&`` @㿘` 5 % ` % `. 5. % %֒ 㿘   p  0``Ԑ 㿘ؒ 0 0 @E˔  O                      } y u  q    g  c  _ 㿘`0B  8  p 8   @@  `€   `@ `U 8   @@  `€ "  `@ 㿘 0  N L " ? . L `@? \ * L * L * L㿘       ` p ( H  d p t  p $㿘>c$    " $ $  $ 2>> А @I@ "     ?  㿘`>W  㿘@  @  " d@ @ @@ 㿈 2&`P80 @^ &`P`p&`l &`p&`&`d`d&`h> `">@ђ`l>~ &`0 `0 @Q&`4`P 7   &`&`&`   7 + ` " 27*`p &`p`P&``&`&`@   X@  X`   X>  " X>Wv  X&`|`p  @ @n >We!>`C#a >4 !(WZ 8 7'>c"$ >> В @Ha *>}  " #c 04    >}  <@ >}@  >}'>}c`=>~`p`='>  '>y@8   ' @ 㿘$ pg   * @* . * & @ @   #> # Ѐ 2 a"@   > @ΐ >  >   >!PV 6 > >V!h& >V!p    `? p   *@ ג 㿘  > 0!x  V?>V!?&`&` T&`Г,`" @  @ @> "`0`&`&`XC32&>@#!>|>m" )"@&`@=>|ba<ϔ"<ːa㿘 D> t`:( t*@ "  T &X& 4 < 0@P& ԕ:`  $  @ B& @*  :& 4& <  T @A>  & @> <! V H /d * % A֐! <!!H 2 $@*0  l >U!@H 00 0(& 0H /d * % jH 0㿘 $ d&!H&!h!&!h""h@ 㿘!` $!  &!&!!"a!!"@`$ " &!H&! h!&! h"$ h ܐ&`@& `$.&!0>c#l*!<@ $ l㿘 p "   *@  *@  * p   *@>  >Us"㿘 p   d    * T "   * * *0 * T " 2 * } 0 y 㿘H /d * %   $ & H 0㿘 $H /d4 * % ?& d l @x H 0㿘a"  Ѐ  $  >b S ?  *@  2 > Sb8?$ ?㿘 a b?   ? $?  *㿘> bt  :6I bt*@  `p2`` ` *` *  > * `  Ж2 ,  "  Ԁ " # ?  $ $ 􀢠$ @' ` *@"     $  $     $ > t2   ( """ ଄("଄("ଐ ਄"ఝ㿘>{>"@!ؚ 㿘>{>"@!ؚ  㿘 l >T$"P0@㿈 $> "h l T`>``>%#>!#>T!p0> " S0 > P >#\ >#` >#d "#hS#0S㿘 dH /d * % > !0 "& l l & l@<H 0㿘H o*@ e@' H 0㿘 "&  H /d * % @ H 0 㿐  > lS# l? k& >R# d`2a0& lʰ $aa`a"a& haa"@$aH0@2H l`>y"*` & t$`<a$`T:$``   & l* T` * @ " ` "`9! ?$ ``$` p ` & l>c#l`a`9:`w ` ?$` p " `0@2`@A$`@@=;  $`5 ` 0   & )    `# 2  `@`(  ? h& l$` & l& `x`0B@ <`x>c#l 9V*`&  $````@D`ܨ`$a:` @8> "p  !: 8$`<, $`@@>b%`^`[`ؒ@ >R H`> 0 & ` @ & `/ *@  > p> x#\>` 8`R|  & l& $&  M _- `@ ` X   R   L   F >   | 怢 " `: u ŀ 25  `-@ `l ,  `f % a    `[   `U   `O   `I    `C  & l?=`0>c#l 8*`X 8  p ` & l>c#l @=h 28wG `0 ??  >  2 > `@ (  >  >$`> ?8`* * *0>c"$ #> `!?8  ,,` ` ,,`08r <@`00" >  !>    D   | @2? t!>  " 0@> > n >` ` Q    | 4 x ?  & |> Qk ~& x x  & x & l t " x` &!>>`Ȕ; ?=| >QL!p& t??& x | > ` ?  & |> Q6 I& x`耥``ܐ " `$``$`ܐ  $`؀$`@<`$@c dS d>c#l 2`@ & l&  & 7:`W 7   & l& & '    `!  q& l>c#l* 7h@ 8 7  p ` & l>c#l @  >?  >  > @B d$`` " p >  㿈 d0& x`` t   6 `0 `0  p   1& l/& l ,& l" &!>>@; `Ȗ?<  > P > > > "#\#`#d#hPj#`0 ($`0$`4 t & t? 㿘> "t6  @ "A@l"@@"c  p@E 0a ">@Qe e@ 0W !@"2V  `m@`q@ 0H )"=@* e g@ >  Ȑ1!7 5   @89 " *>{ Ȑ@8ob@#   @ 2 n @ Ԑ 4 0 & $ 㿘> "t4` @  Ԓ  Y t  t 7  &, 2|@@R t $D$,$0 pm``i`> * `$H $T$<>!hOTH /d * % 0">c#l>* * .  #H 0 # H /d * % H 00(24&" 㿘> "t 2 @Ȓ!@?@?ޒ""$ (> a$ 8Ԕ  $ 0Ԑ $ , @;$ 4 4 > a@; !,4 HԖ  $ $ < 44 J 8$ X$ $   aW4 $ $, ;94 >{b@@6 >!O 㿘>c"$   $ A >  < 0   p  ? *@/   *@㿘 >N!@  >Nِ!p `p2```   *` ( > ( Ё/> =%/> %/>  4$ 4   93   @2 $ _$ 6@  , ,2 @$ $ +>cb$`-?8 -0-?8 - ?$ $` --00 $ 0& @-a! Ѐ2 @ , ?$ $ @-a Ѐ 2 @`  ,` @$ $ $ +>cb$`+?P `-`0+-?P%/> @̀㿘`> N8" >@bJ@ >N-" 3> b̐ @” !<: b>N "0!@>!<N"8 㿘>c"$ 2 2 ` D 2   & D @? `?P`   "`>M"P0g`>_^@b`@@&`0>Mp>b@y ?&`@ 2 a4 H &`< L&`8)& D  >@>a耢 2'a4 ''#>@Cb @AԒ &`<  =  &`8>"LEb@@Ob@0@  @ >'|6 @? >㿘 < 23`0`4=#  ?*@2`&a@M&a<>c"$ "`0>L">*  `  &`4&`0@ &a<9&a@ `4@ >"@  `0"@ ``@ 0( &a<`4`@"&a@ `0 <    8@  @  `4  "  8  # ``@ 㿘`$   >>`"># K a@B  2 $& 4& $ 4㿘> ". >#0M  4  `"  @>"0L   2 㿘> a@ a<: 2` >L#@ ` 8`? h` >b`83F> ,* "* ` 0c& & &`4 > &``?&`\ ߐ# ,` @ *  @> PL `\  >`   ` > "  ` "`  "`>  " `\ >`  h>    "` >  "   2>   >Lp p>@=` >@=|` 2>>L_ >L\ u1!> ">>>cԔ&&&&l  *  &`0"&`p`p*&`l &`|&`t&`x&`d&`h P 2`\ & X`\ 7 @ o# ' ''БH /k * ,  1 . 1H 0&@ȑH /k * , @} H 00 @ H /k * ,  @` H 0㿘?> 2 `  &>Jg H.   0㿘 4 0H /k * ,  `. @ . `@ @% >c#l>n +  \ 2  T 1 ` , 1, !Z  T`  X >J% @ 4H 0h?> 2 `  6 *@ 2 0 `  4`p $ $     H /e4`p* &`p  $`lP`"'@ "'H 0> K@  '' `  @' ` @ ' `  'БH /k * , 1 ,1, H 0$`@ \ 2 $` # %$`$`$`$`$`m-rdH /k * ,  @d x> $ p pb$ l$ t  `, @H 0H 0 `h>n `*` € 2`p 㿘?2  > c.  0 p >n h `*`  €d p Ӑ 㿘?2  > c. >n 0` h*` 㿘?2  > c. >n 0` h *` 㿘?2  > c. >n`0`` h`* @`4@ lg\ d H /k * ,  ]@ "4```y@8`x@6@ `z@`{@7  `\@ " j@(+ `m@&`k@*$  0 0&P $``@u 0 @r 0 @0@& H 0㿘 l? 2`  > * @ 4H /e4 p* & pA =V  H 4 P & p*֐ H\#  H , P Hs H o4$ *@ l$ $  p  & p, `1 2   ,`1,`!Z   @   $ $ H 0`l?0> #(H4`p(`p " " `p"`pH 㿘 l? 2`  > * @`( 4``$`@" `  `   \  @,@  " 텒 2ퟒ H /k * , @x 3 c 5 ? !   " #" ` 4`@`@ ` 4,3 `d,5  @"`@2`,4& & & @ @   $ $ $@@@> $ d $ h   , , ,L    `, @> "b$ d$ h@a H 0@@  , @  4 `G `H*`F " `F `I*`F `F `? "߄ *`?㿘 4 J`` 5 * *5@     & & "@w 㿘 4 ?2  l@ " 58 m k@" 5 @@" 5@* } *5@     & & "@F  4 `5`   `D2 @ 2 㿘 l? 2` >  * @4 K 4 H /k`* ,`    `*@P    ***L   `*@ H 0 㿘 4 K  58 %  @ % @ *5*% %쏒 㿘  p | tn 쭐 p 욒 0,@,``@: x셐 $ p$ t  , . L   d `,   `,  1   . 1J. !㿘 @  & @ $ $    p @   $ $  1  . 1. !%  ,  , . L㿘 +4 `\  `Q`2 F D F@ . D E  `@ . E$`$` ,`. L㿐H /k4 P* , P& X T& P& TH 0  >! >!(`2>>! !(#\>`EԐ 㿘 l>n%> `h `*` t "  4 |@   T X `& T` & X>c#l*"@  8-h*``p  `,` * $ `@@  p  @ P X `& P` & X>c#l*"@  8-B*`@@?2   ,` > "* $    .  @: x2 @6& lH /k * ,  t% & t t h@     `. `1  -`15-`!   `. H 0㿘`p `&`p &`p `H`Pp" >n`h ` *` @㿘 4H /k4 E* , E D, EH 0  G >n`h `*`  €  H  . >n`h ` *` @0. 㿘  0H /e * &  .  .  . H 0㿘1v㿘>@6a8   ` @  " 㿈` >b<`4,C>`h`L,>`h&h&h&h&`> ,`* "* ` 0cx& & &`0 > &`t?&`p ߐ# ,   *   >!HE `p "!>   >>   >"`#"">   " !> #<  * #<&``*&` &`&`&`&`x&`| P 2`p & X`p  @ #0` @ H /k * ,  H 0@  1`. 1 ! H /k * , @ H 0>cH /k * , @ H 0>!XE`0L"$ &h>  X>@ap  >@6a 2h̐ &hh̀`  '>D!h> ">hD!hȀ >hD!h> "Ѐ`a '>"*` 2"> c`>'!D'􀤠> #l@m>- &h㿘 0$ > ! c+ >!D 0H o+*@l@q 4 3 ` 5 @ ``, 3, 5 , 4(   & & $ @듐(& x & |(  .(.(, L(   ( `.(@y@ H 0( .(@@H/` / ?&(&(@ ##`   @@N( `7#y#`   @@7( `"!(Ȁ 2&(̐@Y #[#`   @@(̀?`?>D"H 0㿘(  ` &(%.(`"   0  .( .(  (     .(>"(CΒ 0&(ȁ㿘H/` / 0@ "@` *@H 0㿘H /k4 * , ( ? & (@ *@((  &((&(&(H 0 @ 㿘 0H /e * & ( 3 /H /k * ,  .( 1 2   , 1, !  H @  (  & & (& H 0H 0 0 `G `H*`F (" `F `I*`F `F `? "߄ *`?㿘 0 J`` 5 * *5@  (   & & "@ 㿘 0 K(  58 %  @ % @ *5*% %秒 㿘    熒 Ő p 粒 0,@,``@: 睐 $ $ (  ,(. L (   x (`,(  (`,( 1   . 1b. !㿘 @  預& @ $ $    @  (  $ $ ($  1  . 1. !8  ( ,( ,(. L㿘 >G `2 F D F@ . D E  `@ . E$`$` ,h. L㿐H /k4 d* , d& l h& d& hH 0  >">"`2>>""#\>bP@ 㿘> #<   0"@ @  h l `& h` & l>c#l*"@  4(*``5@  p  @ d l `& d` & l>c#l*"@  4(o*`@@       (@k: 2 @6& H /k * ,  %@ &   |@ (  ( `.( 1  - 1m- !( ( `.(H 0 0H( `E `D*`EH  `H  *(0*(㿘 H /e * & ( .(D( .(ǐ( .(H 0 㿐.` &(` `2``2` // (㿘# @ #@"(!? # @  #@?     ɐ  ܐ&   @㿐>c#l /@5#蠒 $ H /k4(А* ,(Ѐ  (Ԁ ' L`2 (@H 00   &(&(В"  L'LH 0㿐H /k * ,  /&(Ԑ &(БH 0`> Є ЅH 0"H  "@"  "@"㿐(Ȁ /   (Ā   (Ā  / H /k * ,  H 0㿀 ?>>Ӑ"  ` @&`$ &` N'`$ 8 " 028`4  5?@1@.?2* `4 ' `4'>>''')' " `$ "0`$0"`4&`$`$"4"D`( &`(  '㿘" >>o" / $ + 82 0` D2 0`` 0>>K"* " 0># >A  ـ㿘" >>3#( ( $ $ 0  8@2  D2 " 4 4$ 4 4 0"@)Œ  㿘`"  > : *` @ #P2 ?b >?^#x 㿘`  "@ @`㿘 $ & 0 & , L  " 0 2 L 㿘 $   L  0 2 L㿘 $ & 0  & , L  0 2 L㿘 $   L  0 2 L㿘 T  `2  8  4 $ #@# 0` (*`>={#> * @@  $  8 8 T 8  8 $㿘 X ` T? \"`8  $: 8  T 8 $  8`  T  4 8 $ 2/ # !$ T'  X`>c#l>`& X: X  @?`2?` l& X>a$>c#l2`@ $:`?㿘 ( !H /f * '  X  ? T& X`4 $ 8 L  TH 0㿘 T` < -` 2* `4  8 $ T`4  $ 8 2  h 2 d & h d h   & d@ & d[ ?? ?㿘 X #!| T  8 $  8 cI#  c   T 4 8 $ @ H   X d T 8  8 $㿘 X  ?& X$ l㿘 P@㿘 T  0@2  <  ,@2 <`  <@ $@ 0&  ,& 㿘 T  ,` `    0 C" L, C  L@`$ L `H /f * ' H 0㿘 X   T H*``" Ŗ  \( H*``# ߻  \)  H* `#  ߮  \' H*``& ߣ  \%  H* `&  ߖ  \#  H*``( ߋ  `<@4@   H*`& h`+ |  `  H*  `+ & h n  `   H*`& h`0 b  `  H*  `0 & h T  \  H*``  J 㿘 H T`  -㿘 X # l   (""4# # & 0&  0 ! A ! :` ( c  㿘 >>`0 <  (>&`H>a$#&`8&`L&`P&`T  &`X@ &`h`T  4`8`$? b &`\ 㿘`( `u "`"6`0e^0```H2  [ 0_`H2   `T 4 `8`$`T$`8 `8`$0L` < B `T 4`8`$`T%b`8 `$`8U02`H2 4 1` < , `T 4`8`$`T`4 `$`82 `d`h  $`d@$`d^ ? 0 7 =A 㿘 T  $`,$`0 T  4 8 $` T`4  $ 8 " T`, $`, T  4 8 $"`0$`,S `0 $`0H 2 T`0D   4 8 $ .  T 4 8 $ T`4  8 $ "!`0) `0    @`0 `0 @$`0 `0   T  4 8 $ @`0  $`0㿘} T  4 8 $ T`4  8 $?b  T: 8 8  $ ]0 ]| ]| ]| ]L ]| ]| ]| ]| ]| ]| ]| ]p ]| ]| ]| ]< ]| ]| ]| ]X :` (Q c  㿘 >>`h ;P X (>&`H>b#&`8&`P&`L&`T @&`X`T  4`8`$? b &`\㿘 ( `G "`"*`07002` H2  - 01 H2    T 4  8 $ T$`8  8 $0` < 0 H2   ? 0    㿘 T  $`,$`0 T  4 8 $` T`4  $ 8 " T`, $`, T  4 8 $"`0$`,? `0 $`04 2 T`00   4 8 $ T`4  8 $ ?`*`>! `0 `0 `0 `0 @ $`0`0 `0 $`0㿘Z T  8  8 $ g g h h h` h g h h il il i j j j j8 j j j j j j j p p p p p(㿐> u耢   "> >!`#\   /Ø 㿘H /d * %   >  4     ``@?> ΐ!0ʒ ` @*  ?4 & H 0  @>: H 0㿘>m"  >`@{ > ΐ!2I   ` 4 ?# @4 0  `@ p@*c b  %h/#\#d#`  @   . * *`  @>9 Ȱ 㿀 @2 @*4  ##\#d/#`  @[ x@* a" @ //#\#d#`   @C 㿀@*  /@* :` @% ` @% `  @%  `$@%  # $/#\#`#d  $@  2+` ('@ `@""  ````   :    :8 : ##\ /#d#` @ 㿀 @2 @) c /#\/#d#`   @њ 㿀@)  /`//!0 ##\#d#`   @ 㿘>m"  >`@m    @0> 08@ޒ 2 0@@ "    & 0 0& ,  `" $ 4 0$ 4 <($ 0$ @ ($ @ `@ 2㿘 & , $ ?& & (. X   2 >7 2 >7!`@@ "=   >08'>05  & >7!8H /d * % `  ̘   >H 0 0 ?@U ?" & ,6Ӑ!p㿘`d`>6ǐ! `Y ]$` \$`$`$` $`$$`$`$`0  , `  * @*` w? H /d * % H 0㿘 ,`<*`>! < @=?28 , 2  & ,  ?   "@  " > >!Ȕ  8  ??&  & , ?& ?  ?  @  ,>7! 㿘 ``4@?  p qp@ >"7 `   W>!* ($@"G$(L ``?# @4` @d `=   ` ` $,T?/ ` ,"@I?!E    )??``?# @4` 4?` ܰ     ?  " @. 0@ >"87! `    > **` @ @ 7"P>7"p 㿘   >" > "x 6㿘  > @ 46! @>6!0L   >6!HL   >!X6ߒ  ,  @>6א!p ,  ">>!6Β>6ː"p   * *`  *  >6!L  p   * *`  *  >!6  @`@,# >!6L `>!6 ` @N@, >"6`A@,   `L     L "  )>"(6n`>"`6h  "`6c ?2 >"p 6Y >6U"?`` ``>6J"p㿘#> uc@&Ւ  ` *     ``1> u#"Q 1> u> #*  @,Dc1> u c M p@>> >h_ >Z >U >#   # @ 2   @F`` #> 6 E1> u A "@1> u`;>"$*`  @>">"*>3 c5 # !c >"@ 5 1> u*>cȗ25ޒ 1> u@+Ŕ  1> u*>c25ϒ 1> u# sH s` s s s s㿘  !@& !H /d * % > bb &" "b& H 0 㿘H /d * % `"  "` "@H 0  H4> ΄(>  @2H㿘>m" >b@칐  0` >5%#0<Ґ 2! >5#(01 , [ X, Z ,` *`>!  ( $" $ $, [ , Y X 47 (  >4#H        ,>4#p , [㿈  >4ސ#X ` < @ aɐ>4ѐ#K  2 E  ( `>4#; `2(`` ` #d#\#` ` Hl H /d * %     0">H 00 0& 4(& 0H /d * %  H 0㿈  !"] a ayax ! "j  !^y0!so `& `!   &&&&&>&  &&>  ` #ܔ &L&4&8&P&D+<? `0<?# @6  6   6   @6 "'   6 @*@% 'В"#\#d#`      @㿘! @0!@ "@ !@ 3 09!@", !@.  ! ! @0!@!  """ 2 """ "    ` @ , 8 D \ P h t 㿘`>3U 0  㿘>c"؀ 2`> " t`.&`0 2`0 6`0`6`8 `$ 2`8 *`$`8>33 @`8 *   &`4>1 P`8    `4."@ `4 >1 @# `8 F `?@e?㿘k㿘O㿘 8 6 4 4, @ " 8  8 & 4 4 㿘` @2  "@@"@ `㿘?!>  H   H.   H@`  H @X  > `H 6Z `H. @ 2 0R ``  `&H `@6D  `$ &9  `$3   4.`@   @4% @"`@" : .` 4  ڒ 2` @ 2`@ဦ@ ` @ " " """  " " """C @  \  "*  2  *    *  \_ \* @ 00* @ 800* @ 0**  @`*`>1ǐ!      ` `@2  `  >> > >>  p>!>0:! > paH`5В ``.>!*` >(!X>%!`>"!p>!x>!>!>!>!>!> !> !>!>0!>"А ,  ' p "   #\#`#d>"P>"`#h>#l" 1H 㿈4..   (   20  (d +> > `  `t$ 4 #> v 4 4 , , `x   `x `@"```` 0|  w> `x6 :#> v l : >  p: 2 #> v`x@ʔ : #> v> , ``x@[`x     ? # @4   ? # @4   ? # @4 쀢 "`x  4 `x  , 8,   ,   4 >' ' 4@ "`t >D0 Ȓ>0"hS 㿘 2 '5 @ 2-`2)@%`` @# 2` @% `  @" 2`@%@` @"  @@'ϲ@x@ ڒ 6 U ///#\#d/.`.@#` x\@  6 Z(///#\#d/#`   | , D X l 㿐>b  x㿘> &``  $``$` 4` >  `0`&`&`X@O`"   2``А &``"">>##`&ad>/ϐ# 㿘H /d * %    $ $0"4("0K  $2$H 0 %> *  6%>  > #$>!@ U  `%> Ġ  > ">!@Đ = Ġ `, 㿘 0㿘? 2  >  2` 2   0   ` :t K0n !   ;! _70Z``4` ! 2F `  4`@S 4  Ȑ ̒@  `+ ,@ $ "      *@$  *@$    @ $ 0`?# @4`   ”!`?# @4`㿘?2  @>  2`_   0>  r05"      **@$  **@$    $  Ԓ !@ #?c 2 `!     Ԓb 2Q> 㿘 D'? @2  `@>  2` 2`Ԑ =& 4  2`Ȑ 6& 4 <(@#%  -& 4 ". < D   `А `̖@ @ $ m"  >c@塐  `?# @5 "0 `$  $"`$  2   0 ( <$ 0$ 4$ @s ( T@" 4  D ` " <*  @ <?@! b$ @ ?,@ @^  0@  /4`4`//// @J  0@ * (4/4`4`4`//////  0Ґ!0#\#` 0@( #d < HU    ה ># -  2o 㿘  0`  `0`< `@ 0" 㿘 D? @2  `@>  2` Ѐ "  ( <*`" 4& <``@㿘>>!L! 㿘>>!L!  㿘? .!!@!F.@!@!@!? K.@!ْ K. ( ( ` ((  jX? 2`@ >  2`      Z! @"Mc@c@Cc@c @=.!,c# @"58" p ! `q@") !@"# # # @`m @0 @" !@ 0!@2@2   @"2Qc@0)c@"!dc @"!d!@_ `s c @c@ `j c@"G c@Ec@ `\ c@"& c@" ;c@c@ `I c@" `p@ `s@q `:  #@"!d2 #@ "!d# e e@ "e  r @ ` @Y #@ ` @ "!d# @k `  `m@T`q@ސ `  e`g@`f@D  h@"8  #@q `  !@ `耢 0#@"p 0#@0#@ `׀ 0 @2@ʐ `̀  Ȑ ̒@՘ 0 Ȑ !0ʒ `& ȓ*`` & 0   Д$  Ȕ @  а $ x0` € @` € #\@)!d` € @ ,@@O qˑ*   8Le   @[ [  $ ?# @ `*`2 @7 0H#$ Ք # ; @1  2) ``" "*  @<*@ #@  $"?  ?# @ `*`2 @2?  $ ?@# @ `*`2 @6@@?8א`>    y#$   @ݚ @ ,  $` `?# @ `*`2 @2  $ ?@# @ `*`2 @6@@   8 &邒 0!d@ !d    @     !d@     !d@     v@     l!d@     a@ ]@ X Z S Ԓ T M O HV "B !>2 $ 9 Ԓ  3  @ + 0(2?#ϒ @"2@!d`@Z@    Ԓ㿐@!@"`ؠ d &(&0&,`@ d &4&8`Ԥ  ?"  >c0@E  >c@@>  6> cP@7` !W  &&!,&<6H6J&X&&<6 &6&.@R    @ $@``z,`   0  @ k`Ԩ  $   *   *`  *   **  *`   ?  `   `$    *   *` *    * *`  *   2+` +`"" " "  ` 00  $`Ԁ ,  @Β  * 6 ? 2  @?`6 # @ `* * >aL@Øp"( & & (2; ܠ @ b h %/#\#d#`    2% * *` *  aa(& * *` *    c8& "&  ܁x @\ Ô@6`6`6` E6////#\///#`#d   x h@8 46 А@ 2/Ӷ 4Ҳ@ &.  `  `  J  ? `  ;  .` #\ `@x\ @   G/#\//////#`#d    x @ Ԓ K'/#\/#`#d     㿈'В"#d#\#` Ԓ     x@  B`/ / 7` @( //#\#d///#` ؚ x@  C`/ / c7 (/#\#d///#` ︚ 㿘   ښ 2``# +    ̚  㿘   ? `@T В @P@` >#*`  a0  (//#\#d/#`  i   װ 2 .`` ԓ*``0  (///#\#d#`  L  ʰ `I ` ԓ*``0  (///#\#d#`  0   `-``* ԛ2`!0 2`2` ////#\(///#d#`      Ԓ`2 2  2  .` .` .`Ք }m 0{` ԓ*``0  (///#\#d#`    d װ _.`` *    ///ђ/`}A  a0#\#d#`  Ú  A $ ` *    ///ђ/`}!  a0#\#d#`     .@  .@ ` ԓ*``?0 //#\#`#d        @F  T@B@`a0 Ԕ  T(///#\#d//#`  T`  M` @# ?+`*`@  + ** *  3((*`  ` @ 322  4@5`  `  .........& &&.  p@ג  @Ӑ` Ԓa0@  (///#\#d//#`     .`.`p@ (@` ԓ*`0@ ( (////#\/#d#` (ƚ  `|0( 㾸@ ( @ @a0  (///#\#d/#`  ퟚ  ()* &``|,  p@S (@O a0@  ((//#\#d//#` o  *&``{Ӑ  㿘@` >#@*` Ӓ=a  㿀 >#x%f @ @ B b  (/#\#d//#`  㿀>#%@  @͐.@ b  //#\#d/#`  P     ``/ɔ P    ////ʖ P    Ű .@.`.`.`P  n  ` `/`@////ɐ/˒  p"  Ԡ#\      //// b p" #\ Ԙ ؖ q    .@.`.`.`P"  Ԣ#\  W  " N #\ M  ɒ@` `/` /͔  Ԙ //  x @ Ô@ /#\//#`#d    㿐>`  㿘> &`0` >"2  H$1"@x?> Б2 `  6r Б. @ 2 0j ` f  2` 0 d 2X 0 * H $@ >  t@Z > P# C 0@   *@ "4/ 8 L  > (>  T >> (  H#\ H 2>> ( #` P#d P 2>> ( #h> L `# T 8 $ 4? c 2 ? 0 > Б* ?0` 2`㿘? 2`>  Б* @#F #D #H  ^  #H"Q#F"?4#D"+8H0 #E"(HA0 #A #C40 #B"-0@0 ,@~ (@ $4"  "?@$8   48" "H"L"P" T "@Xx@ 4M `4I +  H`?@4A * ` ?@ X8  :  81   `` ` @@  4, ,``4 4` 24 4`//////`/ / 0ab#\#`#d   ꕚ x@`4l `4h ` 4d +` H`?@4\ *` ?@4U + `?@ \L  @ : "G  @ :  8@ ``   ``@ @  4, ,`,`4 4`4 24 4`4///////// /`  / 0ab#\#`#d   $ x@ * 0  H `?@ '  :` @֒  4, `4  +24 ////쀋 / / 0ab#\#`#d    㿘 H.`  S   ߜ$ 8 @I$ ;` ` ` *  z ƒ   ߂@0 "` ` `*  > !   i` `-@ @v` ` x @T 0a6`67  7 (////#\///#d/#` n h@2 ؐ@. #p0` h//  //#\#`#d  L  >D ؐߥ, ,`, @  +(  (+`+  @  $D$T$8$H$<$L$@$P@  @ 0`////#\#d#`    >!!<0X@ɒ \@Œ  ,@ , $ 0 ` 2`㿐> `& d   `& d㿐>aT  ~㿐> &`a< `0 .ad> $`$`!8`&`&`X` @U`" >#>#&a ` 2`` 4``" '>  `А &` ̐#> `t `ae`@ an`@ a` @    a`t``>!  >  >0>0 @@>!#\ 0  "(0> "80"P }>m>"@h  &a>"x o 㿘H /d * %    $ $0"4("0w  $2$H 0 '> *  6'>  > #$>#P@`  '> Ġ 6! > ">#P@Đ`ܖ Ġ ,!`>m"@ 㿘  0㿘? @2  `> !$ 2` 2   0    ` 5t  =!   ٔ f`   4` 汔! 2J `  4`!@  ؀ 2 3  ̒@   `+ ,@ $ "      *@$  *@$    @  R$  ?0`?# @4`     [!`?# @4` 7 $㿘?2  @> !$2`    0L   "E"      **@$  **@$    ($  Ѐ "  ! €  `   !@ 1?# 2 `!     Ԓ" 2 ܐ ɐ 㿘 D'? @2  `@> !$ 2` 2`Ȑ B& 4 <(@  9& 4`    /& 4 ,& 4". < D   `А `̖@ @k $ m"  >b@'  `?# @5 0 `$  $"`$  2   0 ( <$ 0$ 4$ @v{ ( T@4  D ` " <*  @ <?@ b$ @ ?,@ @  0@  /4`4`//// @В  0@ * (4/4`4`4`//////  0 X 0 2: А & :"`#\#` 0 ( #d < HԚ     V >"  2g 㿘   Ѐ @ ?#  0   0 <  @ 0 7" 㿘 D? @2  `@> !$ m2`  Ѐ "    ( <*`" 4& < ``@ v㿘>># #ܚ 8㿘>># #ܚ , 㽘? @ `2` > !$2` 1 `     .  !@"! !@"8  p !   q@ " m@  0!@2    `m@"e e@ ";  `p@`s@$0 r@& !@0 !@"vV `q@i  h@0 e`g@{`f@ x0 Ȑ ̒@ 0{@z 0tsX!0p Ȓ & ȓ*`` h&T 0 ΐ a Д$  Ȕ @7 ̰ 2  e g@2 ? @2  @?`4`# @ `* * > Ȓc @Z ̰ А  $ 05"4   А -$ А ?*$   㴒@ " "  !22 @"   Jb㿀@ >!@ ;"`&(`&0`&,`uY&4 &8 d&8 6ad  >>bА@ b@ an> ae  @@r`&<` (6H2` 6J&&&Xu &&  aW6&&.{? 2`  ?6  +  *6 >c @㿘 Ѐ  ! € x@ Ò  @  6`6`6`  //////#\#d/#`  ۚ 㿘  4    ? 4 ? ( `7?  3 ` / `  > "u-#@!?      >#  >ܐ#H  ђ  >#`ђ ? 㿘?2  @> !$R4   /? `*@2 `Ԑ  2?`  , `Ȑ "(? tV2`   % 2?@㿈'> v4 2p ? 2` >  !$2  $4 % !$*@ (@% S @.` @Ғ.    ` @ > v? =  7@ @ ޒ 6` *6`6`6///////@ ϒ   @&  #  & & & & & s& (& & ,s& 0& $`@@  $4  _(*``  @*@ @  b  # //#\#d/#`  Ⲛ  2Y    "   >#$>#F Ԓ   . *` *   &` &` "&` *  *` *  &`&  b #\  &}  2`ѕ*&@*`͒@&` &`&` @2  &`&@&` 㿀@  , @  p  , //#\/#d#`  ,< P"&`   &` @  cp  ? ///#\#d#`  ,   ʑ* ˓*`  &` &`  @ &@`&`@V(&` h.&`!d Ȑܰ  B ː   &@ ` * `*   *`@ &`&`ˀ  ґ* ӓ*`  &` &` @ " ` " ` 2 Ԑ"&`   &` ` r@@ `&` R . ː  &@  *`@ *  &`&`ˀ  ґ* *`   *  &` `&`rq@ro ?&`7`   5 ˒ @ &@&`   *` *   *  2 &` &`ґ* ӓ*`   *  &` ` "  2  ` ( "%&`    @2 Ԁ` >>#i > #d > a  ߊ @ 2 "&` &@&`&``?&`x @  "`!@ Ւ aba 5/#\#d#`     >  (. 0 А @& Ё $ $ P P P P P P P P P $ $ $ $  4 d H x 0 X㿐>!bܔ  t㿘> &`L!x $ $ 4 @J>!"`X `>!#>!"x>!ߐ"5> t/   >!t@` "`d>!̐#a>!ǐ#```$>!>!#0`0#8`0 ">!>!#`#p>!#Ha&a&a&a ?# @4 㿐>  `X L  & X& h& 4@& @㿘 X l  @    *@ h " ``$  * ` ` ,  *   㿘? 2 > ad  2I ad*@ 2 L0A`2   >!#xJ 6   ޗ  $` 4`%  D`2 0 @Ԕ  0(`@S$ D`   0  $ 0 @ `?# @4`㿘?2  > !d6 * @ 0 !   @   " L     L @  L   2  L @  L @  L? c 2  㿘? 2  > ad2 * @  0@ 4` Lh `e `@,`$ 0*  l@ h $ 4 @ T   4 "@ H"@S ?@| : @ *  t d, < 0 ?$ 0 @  ,`@K  0 *  p@ $ 8$ 0@ >! F!@ 0 ?($ 0 4#\ 㿐 0( L @q @ @ @ $!@` @ @ 0? 7& 0 c 4  L"  P 0 `" 0"" < T2 < 0" 82>؇( 0 `" 0"" 8"" 8`" 0 4  `2 0 ` 0" 0 `" 8 0" 8" 0 < 4  0& 0 0 0" 0 㿘 D? 2`  > 2 d*  <B@ 0 " P 8@ >! 8#   &  T T    T>!#  & 4H /d * % & $ `( $& (`("@#"`(H 00 0(& 0 <& @H /d * % nH 0㿀>m"  L>"`@ ` `?# @4`v0!  $` ("`(&! (" 0h"`` ``?# @4`6`"# 0 0@  @– " 0 0 ( <$ 0$ @$ 4mU`  0$ 4 < 7$ 0$ @ 0   0  <($ 0$ @$ 4 0 m& 0:` @  0@   0 > /& 0'/( 0   / 8@` <2  <2 2 ///# #\#d#` < H ݣ >" ג ` 2m`㿘? 2`  > 2 ad* @`L>` `: 㿘? 2`  > 2 ad* @`L>` ` # 㿐? 2  > ad2 * @ @ !4` 8 <  ` aa 0 !7  @X @ 8 6 8& <& p& |& &  &$ t&( &, &0 &4 0 ( 6 0(" H 6 H6 J64 J4 HV`o>#$*` @(   @N &@  @   @>   @   0 @J  @D } @ u Д  0*@9$ 0 0 4$ 0@T b`2 P 0 ?`@  T  @ S  T@$ 0M  0 $ 0 0$ 8 $ 0`B  , <  <  L6@ޒ >!# , <$ 8 0 %$ 0 0 ?!$ 0 `  V   ,`0,` 8*  p"@ @   <* * t @ *@ 㿀2 @   0 `/ 8 `/@ې: 22///66/// Lc #\#d#`  x`L  % @ђ a0h /#\#d#`     * *` *  $`T$`P0 @ L @ a0 h/#\#d/#` ˚  &*`*@ **  @  & \& `. d 0  0 ?& 0 @ j  40 @  4  L"7 @[  /@T/   03 <//// 0 "  @ 82 2 /// @ iܒ!0#\#d#` ^ 㿀@"  `/ 6/b /c  L #\#d#`  ? 㿀"# 0 8`0B 0"0>`4 =9`     " 0I 0""' ? =  `4 ?߀`6 0 ?& 0 0  ?& 0 0"` =& 0 ` 0   ?& 0"  ?& 0` @ L66`6` ///#\//#d#`   ښ  㿀`( `  0!"! ?& 0 0 =ϐ =& 0 @ L6`6` ///#\/#d#`   ڪ 㿘 0 %$"  %  & &` 2  N x`  ٖ 2" 4  `2 @  @7 L6 /#\/#d#`   \ x   0 =& 0@  /`/!06"#\ L#d#`   6 㿘  4 4 0   7 7 * *`  *    $  p2? 0 "L $ 8k& (  @ ` 0 $ 0 ($`@  ` 0 $ 0 ($`@   ` 0 $ 0 ($`@ "  4  2 4>" (!  4 "  (  2 ( 8>$ 8 ( $@*;  0 2T  3`2L$`@M & (  @2H  `C =`<     8 >"" X 1  `   `>" x ߔ$ & ($`@   2? 4 "  0  2 0 8>$ 8&2 ?"$ 0 $`& ($`@ ?㿘$ 9  6  '$$`8(`82`0`0    ?$`0     H 0 2`8A   㿘`"!@>" n !@>"j  㿘`@x   >"@r Ȁ "   > "p `g3&`48Z@ P "8, 2  80 @Д &  %>"&`D@F ##>c>"@`Р>"@;` >"@5`耢 2 `D`D* "`D "jK" #>cb$ >" @ " >"`@??&`T&`T`T &`T>"!`D< @ &`L `>"@">"!>"$@>"(@">">"א!>"Ӑ!>">"ΐ!>"ʐ!  >"Ɛ!(>"`L!0>"!@` > @!@>>> b>Ð tc&`l&`x>>>> `&`p&`t&`|&`b$ I&`P 28`0l8 >"@`Ȁ  >"8@` 8@ 2'8 ''@ `P ">"aH@@ޔ   >' @ >"0>"@n`  >"`@u!P &`<"# 㿘 D@$!@耊d! ?i{  D$ ?   >" D@!X>"ax*!K>"'! D@ < "@ D Ȓ`"iY D @ ?"@ D@ "@ L  `2 L D " L@(@2)& H D* " T   D " D D@0 "& H D " T  D@ 7@("@& H㿘 㿘`@  2 ֒@ 㿘t  D  D 㿘 D@$"! D@耊d! ?h  D$ ?   >" D@!X>"ax!>""! D |` "& d& h!>i!  >"!@@ z  d?@@*@" 8 & `'! >" `g!>c"$ 2 d ``   d @& \ & X>" " d D"  L@2 D> bt d `@  D@ *@ "  D@" >! "@  D  " H㿘`D`<@)>i!  `>">""0"P`>"`D>" }"`D"` # P ?`H 2`D>" "@$"!`L@耊d! ?h3 `D$ ?   >"`D@!X>"ax" >" t!`L @`2`D`D@ @@ "@`D@ "!`D@耊` ! ?h `D  ?   >"`D@!X>"ax" >" C"`D }"`` ($`H! "#>"  bȟ€ @€  * @  € @€     @€  ! >""o 2,``  € @€   * `@  @€  * 2 ````@@2`` @" ``,>i!  >" @# € @€   @ @€    >c>`daH€>c"$ 2 `h`X "`h`\@```h @""@`d@"@㿘 D >" }" D>"P` " "   l@ 㿘`"!@>"  ڐ#`!@>" ֐#p 㿘`@  2 ڒ@ P "8, 2  80 @P &  &`H8&`L @ " >"c@C??&`D&`D`D`L `&`Dc>"# :` &`@ 28`0h8  ''@.c@@   >' @ >"㿘`"!@>"  a#!@>" ]# 㿘`@l  2 a@ P0  @ߖ &`<D&`H4&`\4 2&`L&`@@m @ " >"c@ǔ?&`P>" &#0Y >" #0R>#`@??&`D&`D`D`H `&`Dc`P :` ># H># P>#`P  (&`@ 28`0ϒ8  ''>#  X@@``@q@P  @V >'Ԑ @ >#㿘 @#>#@H`h H  & X># p  01 @ΐ& T @`h X@  T $ `< 6 T  X`8 @2     " `8 X  @"`` T㿘`0(&a< X(   \` @"&a@ `0 T   X   `4& X#``@ 㿘`< $   e ?   2`P>#  ;`0@`H$  `P$```H@*`$ `P *``H@$`d$ $ `D @ 2  < $㿘 ` ` `bH@`;a㿐 @  2$ > ;S 09$   ܐ@   2( ? $ '􀦠&  @S     @ǒ   2(8  b$ $@&@ޢ㿘`@ `?㿘4``L>#  0>#`@C?&a>Ȑb$a0  @7 4&a<  @1#`&a H @+ &a&a <@&a>#`@!??&a&a>#`@??&a D&a D>ab &a&`<`<&`@ @a@Sa>>˔Pऐ @v ?@zh #  ! #   #&a@ ! #   #&a@ & z ! & t  &&a@ ! & i  &&a @ ( _  (&aĀ`  V  &aas``daA >&`L >>?bTd" $$$4<$>#a! 8 >#`@ `@"&㿘b $ <@ < $@ @I b 7b "  ,  & & $  ?&  , "  b* @ ?* b 8@,"a "@"  2  <$6 < 2  a$b"`b 6 :$b$b㿘"8 6 ="$!"" !" "! c !" "!䠄?!"# !#   c !# ?㿘H /f * ' ɐ@H 0㿘>#a     `$ 㿘!  !而` !!`@I`@"  ``@~` @{㿘2      `  `  >#!H>#!P>#>#!` !8>#! 㿘 @ ` >#!H>#!P>#>#! А!># ̐!o" L "`a"X  *`" #``6X$2:"  """"<2<"?!"" #㿘 L 㿘" " , @ &&"  @?* @ " *   "!`  " @ &"  㿘 L!H /f * ' b@bDbH@ bL@ `@  `#b@#bD#bH#bLyH 0>c#lː"$㿘 H /f * '  a2a1;a a H0!5=0 !69 = < 6 <  @H L0; <@  2 < < ?/6 <  @v@.0$T Lƒ L`4@Ő ]! Lؖ $  H 00H 0㿘! L!!ܑH /f4" * '"  "  @ &""   " @ &" " @"*  + @" "  ("   " "*`   + " 4" "  "@  "   $" &"&"&"@h&" @!(!*  $c!!*`@ $c!!*`@ $c $c @?a  $b  $bP $@"$ "($ `a!$ $ $>$  $a_d? $ , , $ ($a$ $ &"$ $ $b,$ 0b  $b c  $c < @ ;4c#l"$N!  "   #d"  #d #㿐!!`>#"  0  $   '$   'a=   &!?  ?&!$'0>#"0 㿘!      >#ܐ"`M1? @ @ @ݒ @ڒ  < `@Ր?< `:@ `@̐?`! @W@U @R *?@@K@I@G@@ @ *?@@ @@㿐a a $   '$   '`  6  ># $   '$   '`  6 "`b` 㿐a a $   '`  $   `'6  ># $   '`}  $   `'6 "`4`㿘!     >#"`% 00@. @+ @( @%  <@ `@ ?<@ `:@ `@?`@ @  .2`:@ `@?. `*``*`` `#d #d#㿘% L>#"xђ d  T"`*`  Ð 2 P T  $ T , `$ P ’;㿘 ɐa !"  0 2  & & #&`  `   ?&`㿘!` X  M I  _ ?     ># ;"|` ` ``*  !b " b ="b ?*   _y ? N $ >#  "* 㿐! L "!l7777' @  ?    @;n # 22?2``$ 22*  * @3 2  א$c@$cD$cH$cL < =6 <㿘`@ `?㿘 L`L>#"0i>#c@K?&aԐ0  @D 8&a̐<  @> &a&a <@&a>#c@4?&a D>͐ &a&`<`<&`@ @4a``d[ >>&`L"Hbh>?a `"$$>>$4<X<   # #А $#>#aԐ# ]8 >#b@l `@"&㿘 < $@ @= 8 "  ,  & & $  ?&  , " `7 `ܑ*   8 ' ,`" ̐ `"@a"   $ <$6 < $㿘!Ȑ !,   ^< ?    $@@   ^, ? @ 㿘ڐ@㿘># c@   & H /f * ' H 0㿘!! *`2 2! `#߀@c?"  @  " @1 㿐! L!  "X !? &! *!( ' 6X!쀢 "2:!  &!<$ ;2<&  㿘!!, @ &&! @ @G  `! *`# " !`  !@ &! 㿘`L@   >##X>` \  $ \@ \  $ \@ >##x+` \  $ \ @ >##` \  $ \ @@ >##` \  $ \  @>##` @>##` @  `  \a!$ `$ \@>$ `  @ >$ ` \  $ \ @ >$ 8ג` \  $ \ @@ >$ X˒` \  $ \ @ h `  Ta!$ `$ Td T !$ Tb T !$ T >$ x` T  $ Ta >$`  T  `` $ T$ ```@ T !$ T` T !$ T >$ ` T  $ T` >$ }` T  $ T ` >$ r` T  $ T ` >$ g` T  $ T ` >$!\` T  $ T  >$!8O`>$`I!`e?㿘 H /f * '  a2a1;a a L0!5A0 !6= A < 6 <  @L L0? <@  2 < < ?36 <  @@20(O L L`4 <  @ T! Lϖ $  H 00H 0㿘!Ȧ L!!H /f * ' !䀢 ! @ &!!@9!܀ !@ @ &!!@-@  * ! !, @ "   ! !*`   , " 4 ! #"@   $!!$`!($` &!&!&!&!$`$`$`$`$`0$`4 `[!$`$`$ `$` `$ \ d  $`,`, "$`(` , ,,,, , ,@ؐ ,    d[ ? $!  !,!,!,!,!,!,@;,<  `@ {a4< , H 0㿘% L>$!x d  T!ܒ`*`   2 P T  $ T , `$ P z㿐!Ȩ L <" ,    d[# ? $     ,? 0M <"6 <!l7777&`@W  ? @   @;n # 22?2  $ @22*  * @5 `2``ؐ ,    dZא ? $    , $  #"`@ ` "` "`   㿘`@z  >$@t!  >$@n!  a@ 㿘4``>$D!0`>$<!08  @ϐ0&bD  @ɐ<&bP  @ÐH&b \  @T&bh  @`&b>$&`Lb@? &b &bb  `!&b >$b@??&b @&b @b @ @~&b`0̒>Ӑ#&`<&`@`<@ a>$b @B  b>$ِ"8>>Ր#,a>ְ`P!&`&`>>&`Ȗ&`l<???z `t   "   "` ` V  >ѐ!>>?ch"  $ $ $ 4 <$ $ $4U8`@> "@ >$bX@ >$a@ &㿘 < $@ @6#8 t@?* $8@,`" `"@` " <  $< <$6 <    & & $  ?& 2 ,$8㿘" "@"    Yn "    2 |>$"`!  | ?& |㿘H /f * ' Ӑ@ːH 0㿘>$bx ǔ  `$ 㿘H /f * '  ږ   H 00[a2@a1@9a @a@"<F 0!5@;0 !6@7 0;< 4<  @s0-@  2<m< ?"4<  @b@Z0g 4 @  PH 0㿘"( 2 "0"$ @䳖 &"("0 2 "$p!@", @䨖 &"0"$&"<&"8&"4  "0@@@*(" (" f &"@  "0*   "@ !# 㿘"" ""@" ?#$"  "  ?$@@!!*` @  $bP!%!*  $c ! !*  $c! !*  $c$cc$b0$b,$b$b"(%`"((% " @  $  $ >$" $!$ % ,   %  %@X @">$"ڒ $c @X b  $$b " 2"$@b  P`$b c `$c |<5: @ ;5<㿘"  "?#" Ȓ "" W&" 㿘" $"0Wߐ `" `>$" 㿘" $#0Wʐ `# `>$" 㿘>$ y" 㿐" HLD @  ` @$ `"H"L"D"@"4` X { 4 <` $ X "<?&"<"<  ,`"$(@T  6 <&"4"< "4 : 㿐"@ , @T $T@"$!'@T_   `  "$ TS2  &"@ 㿘  & *     & * ?" >$>$8# ې 㿘b?a" ֒ d@f@㿘.`* * ",* @   `2LH /f * ' V> `*`@ ?2@  4-  "#8@ <"`<<8"`8> $#($0,I4&0 ?6> "גH 0PSH /f * ' V> `*`@ ?2@  3ޒ  "#8@ <"`<<8"`8> $#($0,4&0 ?6> "H 02d 㿘% >$#  T",.` @ 0  T $ T.]  P , `$ P z㿐"  % C 0. $`       >@ `>@ > `> > `>$`㿘"  " % *`@.` $` ` @@ U< ` @@?  >%  B ` 1?#=  $` Z ?U R O L  >@ `G?>@ > `??>$`B >*? 630㿘 < d 㿘 P &` |&` "b "b  b "b  ̄2 ̝㿘`@  "  > "p `QY&`48@ 㿘!>% 8 @7 > b&`4`?`>%Z @0 >% ` S&c( 2&c80 @ &c&c$ [ >%`h@ؔ &bc$>%`x@Ҕ?&b" &b&bb耢 `$ 0&bb@斒b@`&b&c & <`@C 8 &c " <>% >% b  ` .`.`.`  `@€ _ "`-&b .``  `.`   ` .``  `@€   `.` @`.``   &bb#@;b`&b``>, 8>, 8@&b &b@&b@#$&b@&b>, 8&c  >:`c`${c>:w>:`c(&c c &c@= >%`V`0 "8 6> >%`@랐 />  <@   #>  `@2>  @Z > > >%`@~ >  ? >  `@2>  @B > > bԐTb `&b@6 #*` #*`( 㿘#  t@㿘#  l@㿘#  x@㿘#  |@㿘#  @# D # H a ` ` ` a4 `㿘> "Ā> "  㿐```t>%>%>c"$`l`& 0& 4& 8 (\ 0`2Y 0> #@ L 4 P "N 0'2  E"G 02  E"A 02  E2  `"6 02  `/>א#4*` $!##$%$"!" 0J "$   $ 0  %  0#&@%& 0& 4%& 4& 0 0RD 8 & : 7& <>%@`& 8>%@`& 0>%@` 0& 4 8@ܐ@R% 8R# 8 & : >%`@& < 0R 8 &  <: @&& < 4>%  4R <& @J   J* (J А 㿘%>c$`! 8?& T <& | 0& d 4& \ & `!>  X>%@aؒ " X>%@aђ P$  T> #   " Q` P "  T P P T@3V 㿐>c"$  D@, H " H& D& H H & x6 & t D " & t?& t& H& D t` & t x` & x 8`  > > > > "#""##`$ ` !> > #Ȗ Đ T@  x! T   @ x t T@*> > """b㿘 8 <`:  %>+P@  @  @ ` "АP@  @  @ `!> #Ȑ  @ #Ȑ`  @ !> #Đ  @ #Đ`  @ @#``#dd"@@d`?"@0 d0E" Ed0 # P2   P`#dd2 #㿐 ,   `I > β"` 2 #\     0(    &` &@@  &` ɒ ƒ   `#\`\ &`&` &` $$ $ `  $ $ $ $ , (㿐  "ޓ       㿘@` `>%>%>%!Xah;!f"`N@  `  `, @ @u  @&` 㿘>%!В >%@!.` <>%@!` `">%>%{!>%x"㿀` R .` < L  8 2 0E   4耢 "8#\#` 2 & 0  € 40#H /e4 p* & p    0    `@ 4$ l$ pH 0@; 㿘@ 6 @ p "@ l&@@` *`  <  ``@^ `` @Y   㿘` >n h `*`   € > Ė  > b>ܐ"@ <Ė,b "@Ĕ  <@ @  *@@2 2 >%U" *`@  bz 㿘` H .``< 2@ > ΐ"܀@";   27  / H /e4`p* &`p"$`p&H 0  "ב` `0 €`4>%"8`l`       㿘@K  *> > #d@$> Ė 6`> b>ܐ"@"` Ė,b "@`?c*   * "`㿘`>%"P  㿘 @  㿘`>% "P 㿐>% @)"` &">%"h" h`;&"> "؀  !> >%>%>%!Xahr"" " #\>%>%>%!Xahf"#`     V& <> Βb` >%`"$""@"k >%"Œ` <& l& p >%#& 0& 4& 8> #@  = "`@&@ >c#l* * "@*`& :& >a̐ t&  &  @!> #   >m>"@   $#㿘#> b؀ "  >%>%>%!Xah"퀢`4  >%>%>%!Xah0"  >%>%>%!Xah@" >%>%>%!XahPה"&  >%>%>%!Xahh͔"> Πb"b>%$ $ @#$  @> cd>  $ "$b؁㿘?2 > c  2 c *@  Z * < 2Q  J> p>2 `8`$ $ Т` $ l"  p  " p8 $  a# %$ $ $ $ $ $ @ J p>n h $ p*`` € `" ` "  ` 4   4    $ 㿘 ?> c 6 W*<@  "'   " H /e * &  @ H 0 >n h `*`  €   " @    ?&  $€> "Ѐ   $€  > bȐ ?& > "@ > *"́ 㿘 ?> c 6  *`<@   >n h``* `@ 㿘 ?> c 6  *`<@   >n h``* ` @ 㿘 ?> c 6 >%#*`<@ 㿘 ?> c 6  @?+*`<   >n h``* `@@ 6 6 @? 㿘 0 4 @ 㿘b@(  L"<#K "*` #D"``0#RE"y`0 #Q"V"`0 #PI0 #U`0   :& 7&5&` @ #`` ?&`  `` &` @ Ӑ` "`0`t`0` `@Ґ@ Đ`0 `0`4@ `0  &8`0@ ``4 x@ `s`$ € 0m`?a&`(`0e  2`4_ -`S`0`>c*`" l*  @z* &`*" *  @q* &` C&?    $`` "٭`t` >c#lK @#` $`$``#>c#lK @#` $`$`@P 0@d  `0`4@㿘 `@ ca@"  #V@NcT@@ 0cb@X@$ 0 cO@   #S@ cM@": 000#N@"k0 #U@# 00A#c@u 0|@?u mҔ 0hcD^@ X  T  P(K$K@E  Ȑ8G "&8 06 0   4  0**" *  HU <0 * "@*` `HJ < ?2 " 2"@&"@&s 㿘 ?> c 6 *`<   `0 `4?㿘> ? # 2`   * <    㿘> ? # 2`   * <    D㿘> c   lc *@H /e4 p* & p  H 00 H 2 o " p o<* @   & pH 00& pH 0 H  `% P  >%>%>%!Xahݔ%@֒ p2  ( @ Ð@ i   А    P  >%>%>%!Xahﭔ%@    H /e * &  p>ccl ? & p` 耢`&`:` V  H   p  ?& p  HV H 0H4 p( p" pH `$ `( ` ࠝ㿘  ` `   㿘      h>n`*@ €`㿐  >%>%>%!Xah& p F  B}* 2  o!<@ 8@>@  >n?#@` 2>n ` h *` ` * 2 €0 +   2` ?>n h``J`*@ '€ ?㿘" >%;#4 " *>& ƒ  < ` >& ((   """ ?>& X" ?$"$ p$"$"@c   ?$"`   㿘b >& xI b , >& `< ` >&   "$`lb ?>&ސ b ?$b($`p$b$b@$  $`p``"b > "  >"h`` # r㿘" >&塚!@ " ? $"$ pб03*>&!@)  < ` >&!h   """ ?$"@  0> "  >#d` 4@ #h 㿘  ` .` <@  H /e * &  p` l@`2 "2 "H 0 i   H 0 ^ &"&"H 0  p 2 l?&"I &"  .` <  2 @ t 2 .` <  " @ g@ q  .` <  2 @ g  " " > "  >  `#  2 #㿘 2  p>%>%>%!XahH'9``` 0 @   $€0㿘  " &  @  "&  &   " "   @"   " ` *`   <2  (p?l㿘$ H /e * & p ! Ș p` >&H 002` .`< ) H /e4p* &p  >& $ ! ͘    ?$ H 0㿘` p "``"` ԉ 㿘!> "`"   @b  "㿐> "؀ /> " ">  <  > ΐ"     㿘>   6   *@> ΀` ""`0 $> `4€> "􀢠€> d>   > >d>  ""㿘> "  < 0  `@4㿘`2 p  `  ?  0  p 4`㿘 @` 0   `"  t 2& 㿘 0 ' 4  H /e4 * &     t &   &  `?& H 0㿘㿈Ch  #X@2&?  @   @0 @,     @\?㿘  * 0  0 : @ 0 *`:`@ 0@㿘 ".`  `0/*`0,` ?&@   0 0@@WP@f@S@@@O0@-@K @@㿘  0  > G "#@> *"&  > *"9&2  &>& (   * >&0&!> #. <`"@  E5 2 #@:`6`<`2`2 2 "2 $2 &* (!>  㿘+> c p@ ` * 5@3@׿.  :` ?@ ` c.``p: @ ``? ` c `p5`D` @4 `p   ( @0@ c p `(  @0*`(㿘'> ㌱. `p6 ``@l@ؐ`0``45  '㌡,  p4 , `4   w @L@ݸ@` `@㿘> # p  D .`* @6`. 2   , 2  , ,`@, 㿘5>  p @`"  @݃ "@ @ -2 8.`` -`p5``0@4@g .`:   - ? ?  㿘/> ㌰  p  @A` %@-2 &  ㌑-`p: @``0@ּ4@(  2? 㿘7> 5>&p@   `@  "@. 4  @֒@0`4 *  .`2 @8 ㌑-p2 @``0@o4@ې * ߐ 2 㿘7> 5>&p@   `@ܼ. < &@F@ܲ0`4 *  .`2 @& ㌑-p: @``0@#4@܏ * ߐ 2 㿘'> ㌱. `p6 )>& ! @@l`0``4㌐ `p* @`.` 6``@`p@`@Q``0``4 *  @ 㿘> Jb̀ !>  *b#`p ( #@ː # p `( #D`# p2 p2"p 2$p"2&p"`2 # p `( *`(# p `( *`(# p `( *`(# p `( *`(# p `( *`(# p `( *`(# p `( *`(㿘)> #`p ( #@~ # p `( #`# p`2`  p`2`" p@ ` @^@ʐ 0` 4  # p "#`p #& g# p ` " 2` p`" 2`"p` 2`$p`"2`&p`" 2`p " # p `( *`(# p `( *`(# p `( *`(# p `( @*`(# p `( *`(# p `( *`(# p `( *`(㿘%> `p  @  ( @ p `( u` `p`B/`4 `p   ?@2"`p` 2`$`p`"2`&`p`" 2``p "  p `( *`( p `( *`( p `( *`( p `( *`( p `( *`( p `( *`( p `( *`(㿘!> #0 p `( *`(# p`( `"` @# # p`" 2`㿘!> # p ( #@# p ( @#@# p ( @}㿘#> c p ( r!> ;#E c p$@ c p  @2 p` 2`"p` 2`$p c c p$ @2$p`$?2` p`$?2`"p c p `( *`(!> #p`$` :#`" * #@( #p`$?2`"p`$2` #p`$` #` #@ #p`$2` p`$?2`"# p `( *`(# p `( *`(!> # p``$ *` `" * 2  #* 2 # p`2`"  ?*` 2`#*` 2`# p`2` 㿘!> # p `( 2#> `"` @#@ # p$ :#"@ * #& * j2 # p`&2`"# p&@#>  $  *`W2`# p`$2` #> c p$ *E "ِ c  p * @ 2" p2 8`"rc`*` a2` cp " , 2 "p2` " * !2 [cc p`"`c  p, 2@2" p " H * 2   Cc c  p?*`"2  p2` 0c* 2  cp` `, 2` p2 ` *`ߓ2`cc p` `c  p, 2"@2  p @ *` Ǔ2`cp `( `2`p 㿘!> # p `( 2/> `"` @#p # p$ :#"@ * #& * 2 # p`&2`"# p&@/>  $  *`2`# p`$2` />  p$@*2"@"2`p @ҩ@ҥ* 2 ?,`"4` 4"`p*  `"4-`p "2` * M2 , @҃`㌢ p   @z* 2 ? ,`4` 4  p*` -2`  -` p` 2 *`"2`p `( `2`p 㿘 p `( ` p `( *`(㿘!> # p `( B *`(## p  ("@" # p "  ("" *`* @ #p` 2`$p` p`2`$p`"2`!> # p ( ## p ( @#A# p (  @㿘 p `( " p *`( p "  p `( *`( p `( *`(㿘1> #  p  ``?"  "  H* *`2 ? $C> #-p2 @``0@Ѿ4@*> Γ-`ȓ2`* L@ 2`#`p`@``@? -2  ,@  *`  .2`-`2  #> Γ-`"ȓ2`* 㿘> J"> ΀`"@ۋ* `> #>n p`  `h*  € *`  㿘 > #T 0#P 㿘 8)> ΐ"@` H /e* &     >,`2` >}?,`"ԑ4`  `!> @H""y 4` 4 > ΀ "b>'姐!%"> ""ԑH 0㿘 p (  㿘 > L >  ##`@M  2  $ ( ( (   t   h l  t t t t t t t t t t P t t t t t t t t t t t @ t ` t t  , L L L L L L L L L L L L L L ( 8 L L L L L @ L L L L L ( L L 8 L L  L L L L L   L L L L L L 0 Ā Ā Ā ` \ \ d \ d \ d d d d d d d d d           d D d d T T`" "`$" `" `" " " " 㿘#> Πb $ ($ $ $  b>   cĐ @  b`   @ 2$ $ P$ T$ X$ $ |$ x$ t$ @㿘  > ΰ" ( " >'>'>'"bhⵔ ̔  \& ( & $  & P    & T@H   & X!&   "& t  "& x  "& |  "& @ @`㿘 &@ & P " T & P T "  & T " t &  t " x & t x " | & x | "  & | ">  & > ΐ" 㿘`  ` 0@0@ c0 @֒ & &   0   `@㿘> cĐ `> & 0& @& D & , P& 8 & 4& L& <& H  @ϴ   :  t P *  * P t  & p& h& `& & & & d& l& \㿘 0 ! !'` H L  " ? &  T "& XJ    2 ?   & X& & X@  0&  ?& 0` d `* @` `*` d &  \ d* @``* @` 0 " X  X 2"   ? + *@* X *@  4  @   X 2 " &  0 & 0㿘``y>!*`  $0p `m 0 ?& 0h&  0&  ?c& 0 P" X  X 3@ " W`@:S& J 2O& 3@ ?`@:I& J 3@ C&    2@ ""@  8 Β 3& \1& \>'➐"0* ,   $& ,"& , H L  " ? &  T "& XJ    2 ?   & X& & X@) 㿘``^Ǡ >"*` &   @Γ (. .    &   4& &  8 <& &  @ D& & * d  쀢"  \ `& &  Ȗ &   & & 4  & 8& <  & @& D*   d"   & \& ` 0 |& 0 0 ?x& 0&  H L  " ?  &  T "i& XJ 2< c& X@ 0^ P2  >'>'>'"b}! P*  M& ` J& \ G& ` D& \ A& ` >&  ;&   H"@ &  T`"0& XJ@ ",& X  2 ?  $& X"& @ 0 &  @ ( "@ & & &   &      `۔  >( dd( d tdxd|(" ``5ฐdt(" 㿘`ۀ`5% > *`    d t* "             @8㿘``6@/      Ā ( " ā 㿘``\ @7  `0 9;  ` *`  ((Є " "   "  " $ 4|0  ``p`q `t   " " ā 㿘`̀`}> *`  X t   .`    @` 2 @    "  @ 8 T *@X& X X T 2 ,  .`  @ <  2 @:     `  @ 8 2 @*   T * & X2 ?  8!& 0  :&   @:    E 4@` @*  * & &  㿘`?߀` > *`  *  *` * ?А "   & .  .    &  & @   㿘"  0 ( 2 0>'"Ȁ @    X*   "* 0@   )` ,`` `(>'ޙ"> c* @ €& ,`2@ 0 @    X*     4 h h h h h h h h و h h h h h h h h h ٘ ٰ  D ؠ ؠ L T ؠ \ ؠ ؠ ؠ ؠ ؠ ؠ ؠ ؠ ؠ ؠ ؠ ؠ ؠ ؠ d ؠ l t ؠ | ؠ ؠ ؄ ؄ ؄ ؄ ؄ ؄ ؄ ؄ ؠ ؠ ؔ ؔ ؔ ؔ ؔ ؔ ؔ ؔ                   \ ݀ ݈ ݈ ݈ ݐ ݴ L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L㿘 L@ 8 "  H   @ T H@ 5k  H @ 8 T`  H@@U  T`"& X J@    2 ?  & X& & X㿘 L@ 8 "   H @ T H 5-  H  8 T` H@@  T`"& X J@    2 ?  & X& & X㿘`"1 ``" XT T"DP T  2 "  * *   @ 8  " `<`   8 T`4  @@Ӓ , T   8  T " @’    X`*  @ 8 T     8 T " T @ʨ  T`"& X J@    2 ?  & X& & X㿘`"``" X0"0  2 "  * *    X`* 8 @ 0   8  @ `N `N *`* @@`m"F < `M `f`L6 `C"u  `H`A"; 4N `@" 0" 0`J`D"r 0x`Kz0"u 0`h`X" `c`P" 0" 0"j `i`l" 0}@'"p@ 4p`r"v `y`n"= 0!p@0@ "4u"q@@w@" 0K@1iu@">'~t@ c@J@0k@"d lh@"' 0a@Aɐ p@Q0Y>' $c 0S 0O1 0L @I,` @ !@Ր `@,`0= @:,` @ !@ `@,`0. @+,` @ ,@ `@,`0  @,` @ ,@Ő `@,`0 @ 70  @ 70 8 00   P   >'>'>'#(c8۶!V $>'cw   >' PJ >'`#>'#>'#  D $\   * P>' $cQ 0 cȀ`"   X 2# 8 #  + * *@  X ,@`ו*`"   H" 8 "&  T "& XJ 2 & X"  H L  " ? 8 &  T`"z& XJ@ "v& X  2 ?  n& Xl& "   X 2 " ? 8 ]&  "  @  08" "   "  L@8 H  `"  8 ?&  T`"& X J@    2 ?  & X& & X "   X2@@ 8  0 ?& 0& "  H L " @ 8 "$ & L`L& H:& L& L& H`"   X 2# 8 #  + * *@  X ,@2"`*`"   X 2 " 8 *  *  8 @ 0ƀ >' $cM 0 P`2  >'>'>'#(c8z!Ҁ   0 *@ @ 0  <@ @3 D,`  `/(> (*`  ?@> > #Ġ c     ? ? ? ?  ?  ? `@җ,`@j e& D& 4& 8& <^& @?`Z>#Г*` >' $cݔ 0N 0   H"@ Ȗ`>'  ۱ $Ȕ09>( $`>( $`꾔 0/>( $`긔 0)`"     `?  8 " ` 0& L & H  &  & > #c& <& @ & D& 8& 4㿘`  "  @` `; `  `  `` `   `  ```  "`"  2  `  @  㿘 `;`6>( P 2  >'>'>'#(c8e"@  Ĕ   J `/" `94 đ* * ?   P*?  Ė&   P*?K &  >(!,`0`0"`0`0   㿘`0`CD >!4*` !, " ?2 3 1 !, " ?% !, " ? !, @" ?  @@``` @!, " ?   $`0㿘 ,    t   $ >( H x, ,       $>( >(!H |, ,       >(@ 㿘`   >(>(>)#c؎ ,      $ >("H,  .`*, @ >("x *      >( @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @  m(0  *`?Æ0> ̅(l(0 *`?Æ0> ̅(mo(0 *`?Æo0>  0 7mЅ(0  *`?ÆЅ0> ,( "*`?Ç0&(>(>)Ʉ@>)ƄH>)ÄP>)X>)`>)h>)p>)x` *> v(88" *0<c{>)6cbu>)bb"{  bbn>)b  bp  Q>) bbT>)bU 0wE>)cJ 0oJ>)cc"O  cc8>)c> [ GcM S >  cc>)c  0D>)c 0<>  6">)  >)>)"! ">)>)">)>)؀ ">)>)  耊 >)>)" 㿘&   & &  @㿘 U 㿘` c (H /e * & > $`>) !  ;@`@`@ !`" H 0` 4 4@.` * @@ ``$#$@  `0H 0 #H 00 4` .$@㿘 H /e`A* &`A   @ X H 0                      @ ` ` ` d      D l <    < < < < < < < < < < `  " 㿘`>)ײ"X `       㿘&`h` &`d`  `" >)>)ב"h?>)׋" " > v!H&`0  $ $@&`0`0"@ `0>`c`0 " ?&`4 ``0&`8&`&`<&`T&`@ ͔` "`0>)"> ` &``l- > ``|-  (>)> v!@  > v>)>)>)"b!aD " >)>)>)>)"bմ!"aD,#8% &`h>)#P#`>) #`㿘#> va@  !> v>)>)>)"bhՕ!$!H!HM>>>#$ $ `HL $a@㿘!> v!@  > v>)>)>)"bu!̒!H"!H"`8"`$!@㿘H /e * &  `2  hH 00"  6>c 0,    , h & 0>c  /t#l@ђ#6H 0 㿘  `. & _  d > vaD" "aD>)>)>)"b"$ @  B> H /e * &  ? +&   $   8$ ڐ   " $     !$ >c#l>)* "* ͘ >)#U H 0> Ė 6 > b>!8@  Ė,b !8@   A  㿐 7`2  0 h " 0裒  0@ ` h< 0 c€  w  @6 >c 0,`  `m h@& 0>c & #l. @#w09 T 6 @`` ,    ? @$ 2" >)cȔ Ԩ 0 q$ H$*"@ *`@ *`$ $`2` "`$`ܐ`  `!$ 㿘 h 碒 <`  ? 4 € 8& <㿘`2  4 "   h " 4 € 8㿘?> T2 `  6 T. @ 2   ` 2 T  2  & Tΐ @& ǒ  㿘?2  > `T. @㿘`  &  @& T  㿘?2  > `T.     $  @ `$ B 㿘?2  > `T. @㿘  & @  ? & 㿘 "~@"}@" 0  v@" `T0  @ #`\!$` @ @ ? 㿐 #@$c@ "ư | #@E#@" * 4#@ "y l#c @>  4@>  4 #@ "1# #@ "s #  #@ 4@  4@ "Y #@2 40# @" 4  4 c 8 l  " p & t &  x & & 4   8cɔ l "" "" "   ""   && &&  ~ > ۔    |` >c,#l@9#耢 " ` >c,#l@.#耢 " `" &  "  && x   & &&p D k> Ͱ  :@@H*` *   m(  @  *   0 $  0? 8&*  *(3 0&?+ # !2 0 !  ? ߀" 0 @  '@ '  0$    8@㿘?2  > `T.  @]> `T 6?`T* "`Th`T `T?㿘> v!D  > $ h`  @@  㿘` `h d 2(   h "  h   2 h @ & h  & h>)# (  >*  !`  h@ 㿘  > `T 6 `T. @2    T  > ` @@㿘  > `T 6  `T. @` @㿐> v!@  > v!D  1>   2 1>  ?`& > v<> v!H*  < 8@"</> @ " `*`2 !> v!H  @> v& "a<㿘> v!@ > v!D "> v > v!H € 㿘> v!@  > v!H`  `x h !0'ؒcYޥ @'䀦  '܀ 60"''0 hcZދ㿘.2 <! 4!!  @' @"   0`  ` * "` @   0     0   * " @ 2 *`=6,@-@ 0 0 " 0 h p k l  "  0 h d _ `  6 2V 6?Ò@`+O>#l*`  h D6?Ò t @  h <  8  h 4  0 =6$@ ?%@`? =6'@ ?(@`? =6*@ ?+@`? %  㿈 `'H!  ?Ò " @ & `2`2` "  <@ 4 € 8 " < &  6 . * @@ߔ  =@!`H`?Ð"@`}> *` H   & ?& H   |& ?y& H v   r& H n   j& H   b& ?_& H   X& ?U& H   @N& ?K& H   D& ?A& H  !:& >7& H 4    /& H +  "'& $H 2  (&   h  H H`` 2G `  "@  H "$ $ l $ H 2 `"  ` @ b2`d2`h2` " <@4 €8 " < !` 0"`" * 2  o< 8@> @ 2 $# b        @  * 2  o4!< 8@ >  `?# > > <c". 4 >ab$, %=``,  *2 a ,    ;& &   2     ;& & 6  , =2`!@2  ` @ b2`d2`h2` "| <@4 €8 " <` " *  2@ ? & c @   {&  ` @ b2`d2`h2`  =<@4 €8 " <=* 2  o:< 8@5> 2  ?# ` 2+6  0?* 2  :, 2 ` `2 ?  * 2  `8?" " 6    6 6   6  㿘 ` @ b2 d2 h2   <4 €8 " <`     ( "  ( P㿐->  9   > ` %l  , *  > @@ " "  ฒ@%S ? * @> *` @%E Ш  %  <$ : * @>  *`  @   @  $ :  4: 2ߙ<1=!-(0 @#* =(0o< 8>   * ? 2 ** 0>*  *2 㿘`0>"H.` 4a666$666666 6666 6 6  66 6 6 6㿘4a22222 ? $ 2+  * 2  o< 8@ >  8 `8`8`* >2  v+< 8@   +fb+ * 2  o< 8@>    ?# = "< a @a@a@2 2 .`)  +* 2  o< 8@ > 8 `8`8`* >2` @.``@ ܞ>*! e 0  *j`2T㿘 . @~ . * & 7 &@  @4!2 @ 2 @ 2 @ 2 @ 2  p ?   `  2  2 >* !H * "  `T Г,   (G* 2  o< 8@ >  8 `8`8`* >2 ` 2"(< 8@  <(< 8@  > @ " ` ( *А`X Г,   * :* 2  o< 8@ >  8 `8`8`* >2   <>*|!x 8@  @ " `*`2  * 2  o< 8@>    ?# = +`<  @@@2  +` @* 2@   () ,`* 2  o< 8@ >  8 `8`8`* >2` @( ܢ``+`>*!x@ *  ,` * @ *aTа @"` 㿘 l ؔ   l@ >*& `  t&  㿘    2$ 9 $ $ $ $ $ `` $" ``$ $```h "`D  #  € "  ? `#   * @`T`X`\  " 㿘  >*! `  2 2 h>*! 02    `" @  "   ` €  0         "`"  "` "@{  㿘` `  2     " 2  0& D 㿐 ca@s  "}@  v@`D  #`@"`Dcb@"f`D0A#c@"g```D  `0H /e * &  ``` ?&@  `H 0 4  .` !vf $ *"@ *`@ *`$ & ݘ  " & B    !$S H 0Y  U P M H   *"   "@  2 &3  @ -$`L!$` &@ 2```h 2``    2   @ "  2 2 㿘`?    `" 2  @ "  2 `2 㿘` ` `h` h "  hB  2 h= `& h>*! ʂ` ` `$ `` " ``  2@` 2 @``€ 2@` "@`2`2 `2>*" P  h@ #< #< #< #< #< #< #< " "( "H # " " "@ #< #< #< #< #< #< #< #< #< #< #< #< #< " ' ' ( ( ' ( ( ' ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ' ' ' ' ' ' ' ' ( ( ( ( ( ( ( ( ( ( $ $ $ % %8 $ ( ( %h ( % % & &p ( ( & ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( %h ( ( ( ( ( ( 'l ( ( (` (t ( (`" "`$" `" `" " " " > > Ȓ " H " 4" <" L" $" 8" D㿘#> Πcݚ $  c> >   c̐П@ @ c`   @ @ 2$ @ $ P$ ː㿘  > ΰ# P "& >*>*>*"HbX ߔ  T\& P& 㿘``O>"T*` ؐ 0F  C?A& ?&      "" @ 8  @ <   @  %&      <& &   ?& >*"0  & $    & @"㿘` @ 8   @     &     & @& 㿘``[2  (& 0@v  㿐``34>#*`  ( "   # 8  @   #  @   < (`"    "& &  ("   "@ 8 &  ("   "@ 8 &  (`"    "&  (`"   8  ,?`&    8 ?&     "   <     <X"  ( "   " 8  @  "    < ( "   "@ 8 @   "@      <"@ 0z ( "   # 8 @  #  @    <" @ 0[ 0  D@ H' L,` ( `/>"ē*`  0?@9> > #Ƞ  c      ? ? 0`@ ޗ,`@ && L& 8& <& D& H> > #c> > #c (  8 & 4> #c& D& H & L& <& 8㿘``0 `9`; 0  0* ( *` * ?А"   & 0 0  & 0 & 0  㿘"  P 2>*#    "/@`#`" $R `     >* $D  & $`ؐ#0& $`2@    㿘 `  @` `; ` `  `` `  `  ``` "`" 2  `  @  }(0o < @ 8> @ 2- @2 -`2-> v(ll-(0 * ?,(0 * ? -o(0 * ?Æo0> ԅ( ",v(0  * ?Æv0> (2j"* 0<"\>+&#"a>+""^>+""R>+"U 0\"F>+A>+"8>+"1 0N<>+##(>+#"< 0>%>+## 06,>+ ## >+# 0( >+# 0 >+  >+>+ "  (0>+8>+@" >+H" 㿘 > &@ c &Ғ 㿘``"0G0     <& &     㿘 4` &    <  0    "  4  "   <  4 " &  4 5 5 5 5 5 5 4 5 5 5 5 5 5 4 4 5 5 5 5 5 5 5 4 5 5 5 5 5 5 5 4㿘  *@  #    @ !    @  >+Ŏ#`?  @ O  4& >+ł# ?@  2?@ 㿘H/` /  ? (>+#   ( `  \& $ $    & 4 $ @ & 8& 4 8 4& 8 4& 4 4 2 @K & D $@G 8& @ : $@<& H& L& <& $&  ؒ2 & T $Ӓ& X ( $ (` & P Ȑ @=   (` %& \  <: "  :  ?@ 8&   ":  \ " @\& & d  \ @Ɛ"@S* & `& d& `> > >>>>>!XbĔ(4#`& & & & & & & ̀&  ( > > "p !ܒ & & ?`>  H*` @ (@} (@ (@] (@ /  ( ( ?& (H 0 ? & (H 0 㿘 2>+# @ ː    @ &@   &  & " > >   2`>+P 2 2**` #      (* # 㿘  $ <:`:`  X֐ @ Xѐ  <@ʒ `$Đ  @@%  ?""" " """"  " ?"ۖ 㿘 T X `$ }@x ?W ?@?㿘 ( "  ̟@ & `& $@` (` ̟€& (0 ( ?& ( >+-P>+)P"h *h? 0~**⪐h"UUU?""p"h ****h 0a ,    /8? /(( -     08? 0((@ .     18? 1((@ *`4(*`@( 2? @?( @*`2  2` ? @ `0(*h *h $ ,2 2 "@" "㿘> h< @2  (    :  \:     <`$:: X   H@`""@"`"`"` "`"`"`"`?`  ""@?`@ 㿘 $ X_   TY   " $$@ "@::`: `8"2 0)  8*  82 8" 8*"822 㿘 T X ?   < h@@ <$``??o> "??2 0`??\> 2??2 0M?K *??2 0<` "@ `& @&>>??/ `*`2""""" """" "*22??2 >`"`  >>>#h<"`"`"`㿘  c X_ <  @  $  l h" h l@ 2 ?     P&> 8 (@` Y,>,, a@8 B @ @ &@@9 `3   *  *` * @82 @ @&@@    *`  * *` @2 @ @&@@ | @  * &@@  t&@ `>, *` >,,88 @ S @@` @ @&@&`@F  `#">   *  *` * @8`*  @ * 2@ &@&`@!    *`  * *` @*`  @ * 2@ &@&`@ -@  * &@@-@` @ @  &`&@㿘 ` fb?  h <@ XZ > `$ @ + .>,@ ! ??=8 ?   #? 01>,`+ @ >, *  >?/ ?/     # `#?  `? #?2 㿘 `   $ X  < `$ @ *,>, a??-@ ?  #? 0">, * `>,*` ?8 ?8   # ? #?2 㿘   X $@ V >> ? ?@ ? @:   "``* >, , * >, a@ * "#+ @# ,   #+@#*  "@  #>,  ; # ??@0e>,`(`@ +>,, `@  " ?<? 6   >>   "@   ??5 @ - :   "`?* ? >,>,!,  @ *   #@ *  @` @ @ #@#`  :   "`4#@* #@ B :   "`* ?>, *`*>, ! @* !#@+ @#@ .@ #@+@#@* `"@ #``; #`??2r 0 >> ? ?@?  @ H :`   "`@* @?>, (`* >, a@`@* !#@+ @#@ (``@ #@+@#@* `"@ #``; #``࢔ :   "`4#@* #@`* :   "`?* ? >,>,!,  @ *   #@ *  @` @ @ #`#@??2n >ā" 㿐 X @ Tݐ?  h?  < @ <@  ` `$` //;  + 2 + ` P& `(`8@ ` `*  ` @*`  *  @ 2 @*+ 2 `   * 񀦿$, > ,"  * ,* /`  * -* .`* 0  * 1㿐 Xd @ T_ 7 7  h < `<  $ ''< `3 2 -  P7&8#@ ` `*  ` *` @ (*  @  ` 2* @`*3 2 `   * $4 > , "   * .* 1* ,* /* -* 0>>" " 㿐 X @ T 7 7  h < `<@  $ ''??M @` + + + ??2 : ? P&8?0@ ` `*  `*`  ` @ * (@ @ 6 WW+ : ++ : + + *??2 `  *  &@.@`.@`.@`㿈Ŕ0: < h@?*@* 2  2 *  * @ ('耊 '#'?#?  @* () (`@ 3`2+.  @0@1 0`6 @ ''' @2   (   \   `$# < X  H@ $@ΐ, , &@ǒ ** &7: " 谆?&@&`&`&` &`&`&`&`&` `$ "  谆?&@&`&``  6 . @ &@ `Ͳ@㿈 0 XĐ @ T  ?  `< h ?* / ?  ? /  $ / @ ('耊`'#'?#?   @* (..`@ 3`2+,   @0@66`4  @ ''' &@3 ** &>H   @? *@`? *@`*@`" 蔂"@"`"`"` "`"`"`"`"` `$ " 蔂"@"`"`` " ? *@`? *@`*@`2  , >  * .* 1* ,* /* -* 0>" 㿐 X @ T ? ?  h < `<  `$` ''=  # 2 , ` P& `(`8 @ ` `*  ` @*`  *  @ 2* @*# 2 `   * $$ 㿘 8  ( $   >0a @,  * 㿘 (  8  $?? ( ? 6 ? , ,  &  (??㿘H/` /> v!t     $ ( 2 H 0> v!p>  "!p > v!t @` "!t> vt"  22 㿘H/` /> v!t -`  $2#`  2   (2  @h 2 H 0   ׀H 0?㿘Ho o 9 `,  H 0-?  " ,"  `0"   H 0?  " 0   * 4 &@2`?H 0㿘Ho oY `&@` &H 0` ?㿘Ho o<  ? ?>0R"* 2 2`H 0 @@((>  :`6 `62? "(+?&'?6"? "`0 `0   **` ? ?㿘@`!"  - +' *  @ `@'  ` @  `@  ݦ`   㿘@`!"  + )% *  @ `   `    ` ڔ  ߦ`     23`2(+`@ #@( ` ("@ "`("`("`("` 0 "@ "` 㿘* * \ *@  *@ Ŗ 㿘`&` @ 24 !>c"$ 2V` 2+  2 %  ?"$ 2  2 6  E" 4 @" 4  ?倢  `@ &` 㿈` '>c  $   &`L 0@@ 0  @s &`P &a40 @s &a4&`P &aH   6>0 >0""P>0"P$ @`L@  >0"8&aH>0 "0"0  >0bH@d>0"P,>c$ 2?> #`L`*  J`@`$ $? 0> "h@`?a8? &aD @ # $`0>0`4"X> "t `@ aH@s* @?&`X `&`pa> ""$``"`""> ۔? a(j> > "b>'''' A@"$ 4_@"% <@@?0#F@ C@B@ E@ J@  "" 0" 8" ""? > t :    &?`@8 2?@ (?>c$aH a< a8( a8 ?㿘>c"$ !D @ L@0*`Њ@@ Ъ@@0#Њ@@ ?Ъ@@0H/` /`!4 `  `!4 ` *`!4 ` *`H 0 㿘!L  T&'&!  @ !L  $!L !L"!L 㿘`@   >c"$  L> "p 0@r?@ Ғ 8@ 㿈  >0"h>0r"p>0ڐ">c"$  0> # " J  a( 0a(   &a(  $ @rW&a4# @rQ @&a8 @ה   #$> "t`@ * @r< @?&`X `g&`p>ba> #P$ $``$ `>0$ $ `0"`4>?> > #|c>'''' 㿘#A@"+ 4#_@ "- <#@@?05#F/@ cB@" !8 #E%@ #J@"#?cC@"!8? &!& 0& 8& &&@s @ 0? 㿘!<  T&'&> > cȖ !@ !< $!< !<"!< > t :    &?`@8 ?@ >c$a, a((@ a(@ ?H`!4!4(H 㼘@``!"  *`;    *  "  *  $  *  ` l 2`  e  ` ^  㼘@``!" < ` B 25`  : 2-` 2 ,`#  2@ `  2@ ` @ 2@ ` !8*` 0 !8 @0!8 @2d㿘` @9  >0@3" "   > "p   & 48@  㿈      6>0  >c$ ""$  >0>0b@avL  "   >0b@ajL 2>0"#>0@b >0b ː"> "h0 `? @pY (&a@  %a4   > ` `a@  p 2 `   *  `  + a4`  a4 ǔ >!&dD&dHdD@k0 a@ $* aD"  @  $ s$  $ $ $#q > "t `@ * @o &`X>0`0"`4^&`p `0#  >aPa> ## $``# `#  # `0# ?> |>`a(g > >  ` >''''R 㿘#A@"+ 4#_@ "- <#@@?0=#F7@ cB@ !D #E-@ #J@"+?&cC@!D$?  &!& 0& 8& &&   2 @ ? 㿘$T  T&'&> > cȖ !@ $T $$T $T"$T > t :    &?`@8 ?@ >c$a8  a4(@ a4@ ?㿐!@ #\!DH`!@ `!@(!@(H 㿘!@  "    !D `*!@ !Q  !@(㿘`&` @P 2 >c"$ 2  2    ?"    @ `@ &` 㿈` >0`"&`L>c"$   > # " J  0 0   @n&`P a( /a4 $ 2 *a8 @ $$ $?$   #$> "t`@ * @nn @?&`X `&`p>*cda>  $ $``$ `>0$ $ `0"`4>㔐?> >  `>''''Ж 㿘#A@"+ 4#_@ "- <#@@?0@#F:@ cB@ !8 #E0@ #J@".?)cC@!8'? !#&!& 0& 8& &&  0 2 !4 ^ ? 㿘$8  T&'&> > cȖ !@ $8 $$8 $8"$8 > t :    &?`@8 ?@ >c$a, a((@ a(@ ?㿐!4 #\ 1!8㿘 t Н㿘`&` @ " >0@c 2' >c! "$ 2 2 Ge> "p  ,@ma?@ ?"  a ` `@ &` 㿈` 0 &`La4   @mA&a@   @m:&aD  *@m4&aH @m.&aL @m( &aP   `* >#*` `L@@  >0#>0#>c"$ >0>0#   >0c(@]>0`#00>0#H[>c"$ ?> #@`L   " J "$ "$? > "h`?aD>"`&dT&dX:dT@gה `@$ 2 *aT @* $# > "t `@0 * @l &`X &`p`0#  ѐ>!cdb`>" >">#>">#b @"&a&a&a&a &a @)a> !$ $``$ `>0$ $ `0#P`4ߖ  ``0# ?>!֐`a(c> > !<aD>'''' 㿘#A@"+ 4#_@ "- <#@@?0=#F7@ cB@ !T #E-@ #J@"+?&cC@!T$?  &!& 0& 8& &&  K 2 @y ? 㿘$d  T&'&> > cȖ !@ $d $$d $d"$d !H?? !P`   !D`@"!@" " > t :    &?`@8 ?@ >c$a8  a4(@ a4@ ?㿐!@ #\ 1!TH!H`!H H 㿘!H `0 02 ?#ߒ @`"!@!T !Ҙ  !L``?""`㿘 ]!L` @ @ 4"@  4"@H T`$ `$O `$J$ $ $ $ $ $  *`3$  ̒$ $! `$  d$  4 ` ?$  d?$  `$  d$  ` 4 ?$  d?$  (  @㿘 n!L`k @@g D  4"@  4"@ S `  `  `  `$ݐ$ $ $ $ $ $  *`3$  ̒$ $! `@$  d$  `?$   d`$ ?$  `$  d$  `?$   d`$ ?$  (  @㿘 `P!L @@L D  4"@A `  `  `${$ $ $ $ $ $  *`?$  $ $!?  `< h $! d$) `$)  d`$ ?$) `?$) (  @㿘 `!L  @@ 4"@G$`$`$`$`$`$` *`??$` c?$`$a> < h@$a @2   ( "  $i$i ?$i `$ d@$i `$i  d`$?$i 4 ` ?$i`( `@㿘  !L $   $$$$$$$ *`$ U$$ d@$ `@$  d$@@ $  ` @@ $( @!H(( "(㿘`&` @ 2 >c"$ 2  2  Ē ?"  {  E `@ &` 㿈`    &`L @i`0>cb$ ` &`P> # " J  0 0  ?@iJ&a4a( a4 $* a8"  @  $ s$  $ $   #$&`p> "t`@ * @i @?&`XJ `a> !$ $``$ `>0$ $ `0#pp`4>%l?> > !Ēa>'''' 㿘 #E@"P?#F@ "J?#H#@@ ?0A@<#A@" 49? cC@"#!8  #G@+cB@!8)? #J"@ "!&!& 0& 8& &   2 !4  ? 㿘$8  T&'&!  @ $8  $$8 $8"$8 > t :    &?`@8 ?@ >c$a, a((@ a(@ ?㿘z㿘` @ 2 ` >c 0@  >c"$     㿈>0#>0c@YJ@ >0#> "h?@8`?c 4>0#`u@04D>0#`l 0>1:`g 80 @g  "0 <<&e8&e<&e4   &e@&eD&eH&eL&ePa(|  $D#`@D*` `? &eT&eX @gΔ &`X`0>1`4/ &`8@ eD   a4"  @  @? `&`p>'ata> " "$``"`"" >&?(>m>&"@ > > "LbT>'''' 㿘#A@"( 4 c@@c_@".%TV? #B@ "/!4 #C #L@":H?@*!4C?%T  <&:&& 0&%T   &%T@? !+&  <* %&#&@  @ߒ 2@ 2%T@V   @O   㿘%\  T&'&> > cȖ !@ %\ $%\ %\"%\ > t :   2?&? @(8 2?@ (?>c$!, !(( !( 㿘 8`2  X%4 A>'*a & 8@ @%4 q*@%@@!& 8㿘 8  >  t> "`` %4  A  @   *㿘@``!"  + )% *`     `@  2` @  2`@  ߠ `   㿘@``!"  , *& *`     `y  ` r  `k   .`   *`%Da4 "@ `㿘*`!7* !6* !5* !4*  㿘`@| `?㿈>1`@@V>1X8>1`H@VJ@ )>1>1L P)>1I X> "h0 `?a4s ! ! @eҐ&a@ "!@e̐&aD# $@eƐ&aH$ #(`0 &`8:`4 &`<`0&`@e `?&aT`8!> ː"p `8   @eaT&aL`0 "p `8   @e&aP @&`8aL@?&`X `&`pa> ""$``"`"" ?ז >m>)"@ }Wa(\`0>1`4`Ð `>1`p@VKJ@ >1  X> > "Ԓb>''''Ӗ 㿘#A@" 4 c@@c_@" <,? #L@" " cC@cB@  0 && & 0&&& * & @    @   ? 㿘 8`>!T' !D."`\!D " X!@ "`p!@?" T!@"`X!T !L@z !T' !D."`\!D " X!@ " p!@"`T!@ "X@!H "#!H?#"c(!H[& 8' !D."`\!D " X!@ "`p!@?" T!@ "`X!T @!L!T' !D."`\!D " X!@!" p!@" T!@" X!T 2@!L!T% !D*"`\!D %"`X!@?" p!@c" T!@" X!T 2@!P@m  **!H "*& 8㿘> t>  @2'? &$? @(82?@ (?!8>c$!4(!T @ 0@ 㿘!X  T&'&!  @ !X  $!X !X"!X 㿘 8   >  t> "`!H ` !H2` ` 㿘>1@v `?㿈> >1 S 0c  c "dH 0&dHdH a4>1> 0` m80 @c͔ &aDD< @cǒ &a@> "h  `?"!# > "t `@ * @c aD&`X&`p>1&d` `0 ` `4>+ l&dL&dPdL@^ aD ``&d`"` " `0#4  >*PcX>+!`>+>,>,>,("p&ab&a&a &a@/&a a> #0$ $``$ `a($ Z$  @ ` > `0#? >+Ő> > #\cd>''''ޖ 㿘 #E@ "\? #_@ "> <#@@'?0N#H@"J?E#A@"% 4B?B@ ")!H#L@"7? #J@"2?-C@!H+? ('& 2% @! !& 0& 8& &&  - 2 @S ? 㿘$\  T&'&> > cȖ !@ $\ $$\ $\"$\ > t :   2?&? @8 2?@ (?>c$!8 !4( !4 㿘*` !H* !I* !J* @  dH (* aH aIdHaJ( dH ( @ dH ( aHH!D`"$`8"߆ D 8H 㿘!D     !!D "`  !@  "$` !@ !@ !@ !@  0 4!@("b$!@"$` !@ !@  0 4(!@" 㿘   8?4 `/$+ d @0 3$` "@ $`o*  "   $ o@? /*`@@X"@$`*  "   $ o@? /*`@@" @ $`@0 2@㿘  $ ?ݒ dؐ@0 3$` "@ o$` ` /*  #  4@ ` o ? /* @ X" @$` ` /*  #  4 ` o ? /* @ " @ $`@0 2@㿐  ې `  `  `  $} d !@0 ?$$`#"!@""!@ o*`$$`@#  `$ /@ *  o!@ " !@ $$`!@0 2!@㿐 ╖ a@0 ?$d`#"a@""a@ $d` @2  (  "   /*  o `$ d ` oa@o*`@"  4@ ` o /* a@ " a@ $d`a@0 2a@㿘   $  d   $ ` a@0 $d`!"> #a@""a@ o *`$d`@#  ` `$@ /*  oa@ " a@ $d`a@0 2a@!D "$` 㿘>1@!`?㿘8  @`0&`0*`0>1 ! *`0 㿘>1@!H`?㿈a4>1!PВ 0H 80 @`_ &aDD  @`Y<&a@aD> "h&d\@ `?@ " @ >1@@ >1   !x ` # "X> "t `@ * @`! &`X`0>1`4 `8&`p!>.#&dH&dLdH@[ aD `&d\"` " `0#4  3>.Ēa`8 2a>/ @>/>/>0>0a!p&a&a&a &a&a @Ia> #&$``&`a(&W& @   > `0#? >.5> >  `>''''N 㿘 #E@ "`? #_@ "B <#@@'?0R#H@"N?I#A@") 4F?B@ "-!H#L@";? #J@"6?1C@#!H/? +& 2)  8 2% @ؐ! !& 0& 8& &&g  Ꙓ 2 @ ? 㿘$X   T&'& 8   > #>  !@ $X!  @ $X  $$X$X"$X > t :   2?&? @8 2?@ (?>c$!8 !4( !4 㿘*` !H* !I* !J* @ D*`""\""D"\"\*`* H?D"\ @( D"\"\` ?H!D`"$\8"߆ D 8H 㿘!D     !!D "`  !@ ?"$\ !@ !@ !@ !@  0 4!@("b$!@"$\  0 4!@("b!@"$\ !@ !@  0 4(!@" 㿘   ?| `w$s d @0  $\"@ $\o*  "   $ o@? /*`@@X"@$\*  "   $ o@? /*`@@" @ $\@0 2@㿘  $ *?& d!@0  $\"@ o$\ ` /*  #  4@ ` o ? /* @ X" @$\ ` /*  #  4 ` o ? /* @ " @ $\@0 2@㿐  % `  ` ͐ `  $ǐ d !@0  $$\"** !@* "b!@o* $$\ #  `$ /@ *  o!@ " !@ $$\!@0 2!@㿐 ږ a@0  $d\"** a@* "ba@@$d\ @2  (  "@   /*  o `$_[ d ` oa@o*`@"  4@ ` o /* a@ " a@ $d\a@0 2a@㿘   $5  d  0 $ ` a@0  Z$d\"> #** a@* "ba@ o* $d\ #  ` `$@ /*  oa@ " a@ $d\a@0 2a@!D "$\ 㿘>1@JaЀ`?㿀>1a@M>1&! 0>1!` 0a4 J     @\ &aА @\*> bh$&aԒ `? #>1@N b > "t `@0 * @\ &a&a!&a!> ˠ"p`@0   * @\u &a`@< * *  @\k &a`@` * *  @\a &a&`8@ʒ $ @2 `b*a @ a؀@?&`X `y&`p>2 b,a>  l$ $``$ `>2$ $ "&d&dd@W= >2?>m>2"@p ta(S]a>1@"(@3 @3``02` `#\`4`v `> >  `>'''' 㿘#A@"( 4 c@@c_@"*!Z? #B@ "+! #C #L@">L?@"*!G?!  @&>&& 0& 8&!@? !3&  <.&* +& 2) !渒 # ! 2 ! 2@ 2!@   @   㿘!??#"h!" " 8")& 8!`` @ `?*@" ` `"`2& 8>2b,%& 8㿘 8 ’ >  t> "`H!Ԁ`(! H > t :   28?&5? 8 @8 @ >c$!8 !4( !4"? @(8 2?@ ( ?>c$!D !@!@ 㿐!А #\ !㿘$  T&'&> > cȖ !@ $ $$ $"$ 㿘!h  ?   "h!А! ! !԰ "(! 㿘>1@"X >1@"` >1@"h   㿈>1bp@K|L ">1"x> "h@`?>1>1"`ٔ 0~b@ &eHPH @Zg &a@D< @Za T&aDa4 >5 L&eL&ePeL@U_  @ $# > "t `@ * @Z? &`X>1`0"`4&`p  `0# %  ^>4`ta>  " $``" `" " `0# " %"? >5?>5 >5 $pa(Q@> > ! a(>'''' 㿘#A@"* 4#_@ ", <#@@?0>#F8@ cB@"%H #E.@ #J@",?'cC@"%H%?"&!& 0& 8& &&@z!H  !H@Β 2 @Z ? 㿘%\  T&'&> > cȖ !@ %\ $%\ %\"%\ > t :   2?&? @8 2?@ (?>c$!8 !4( !4 㿘%H  .`!K* !J* !I * !K* !J* !I* .`!H* @ 㿘@`!"P ! ; ,   `@f  2?`@^    `  / ,   `@G  2 `@?    ` , @` @-  ״   㿘@`!"Q   9 ,   `  `   `  1 ,   `  `ߔ   `  , @ ` ̔  נ .`  *`H!HDD$ @ ``"!@!@ 0  㿘!@` " `  "` ϔ! !@  㿘>1@ÒbЀ`?㿈>1b@I/>1> "h0`?a4ɔ >1b@I*: >a@>1@I"aD @X&dL>1cB@I @X&aH>1c0 @I &`8>1c@$@I&`0>1#cP@I&`4`8`0@͐`8`8 & `4: &`< &`@`0>1`8K#`dL@?&`X `&`p>6a(a> !|"$``"``"" ?2 a(O> > !a>''''H 㿘#A@+#_@ "2 <#@@?0H#FB@ B@"% 8 #E8@ #J@"6?1C@"  8/? +"@ 4"@ 0"` 8"` 8 @? !"` "@ 2 @~!L   2 @!L 2  @! ? > t :    &?`@8 2?@ (?>c$aD a8 a4( a4 ?㿘!L* "L* #L* @y 㿘$P   T&'& 8   > #>  !@ $P!  @ $P  $$P$P"$P 㿘@ `!"@(` ' 2!`  2 "`  㿘@ `!"@(`  2!`   2 "`   @aH(""aH0 ( aLbLcL aH( @@ aH( aH(  `  㿘>1@c`?㿈>1c@Gc>1Ӑ>1c@G[>1ː#> >1#Ò`0n"h0@`? $@VQ&a@>2`0@G?J g" 6?π  >1, #>2`@@G<>1c@>2`H@G4 a4Ô > "t`@ * @V &`X@@? `H&`pa> "$ $``$ `>2$ $ `0 P`4m`?j a(M:> > "0b8>'''' A@"$ 4_@"% <@@?0#F@ C@B@ E@ J@  "" 0" 8" ""? > t :    &?`@8 ?@ >c$a8 a4(@ a4@ ?㿘!D  T&'&!  @ !D  $!D !D"!D !@     !@`51 ก㿘>2@ϒ`h`?㿈0`Ta4   $@UA&d@ .@U;&dH P.@U5&dL  @U/&dD  @U)&dP>2`x@FJ@ ">2 > "h >2`?&`8`$@F&`0>2#`@F * `0&`<>2&`@ &`4f > "t `@ * @T $`$` @?&`8 `&`8&`T>:>:>:>:>;>:`Ȓc> "К`"$`$`$`$`$`$`#$`@`#`D##>:ࠐ2 @  @s a(K> > "b>''''A 㿘#A@" 4 c@@c_@" <$? #L@"  cC@cB@  0 & & 0&& & &@[ ? 㿘$T  T&'&> > cȖ !@ $T $$T $T"$T > t :    &?`@8 ?@ >c$a8  a4(@ a4@ ?!@( "@( #@* 㿘`$HZ$@  @"  @ 0  @    0@z$L?n?"n$.#$.$. 4? 0*`? $.$.  $. P$.$.  4  0?*`  &`&` &` &` @@>+ P!@"@#@ @+@` @`+` @ *`>9a(@W0 $.?$. c?$.#$. 4 0?* @&`&` @@ &`#$.㿘dD$ ` #I ?    >2 `㿘$D`& ` ` @"?&&  & &  㿘$D$Ð  #@!@$"@  * @@ * @$ `  $  $ $D `" 㿐 $H$@ ԩ V`  `  $P d   J ?`$E?@\/ $n. * $n  @  @$ $ 㿘  $H$@ \' ` $! d??  @@.`   P@ % . %` / %`%`㿐> `PȐ#\ $  +` 㿐  P#\w 㿈 @! (   H@ @@  P& * &   ?* @&`&` 0  P#\ DH 㿐#\ D o 㿐 #\c 㿀    P#\ " 0S   dHd@{` `$w*  , @` Pn&`8`(ӵ@  P& * & ?* &$` "*@ $` `$* $ 쀢 * $ 쀢 ??$㿘>2@`Ѐ   >2@`Ȁ   㿈>2`@B>2Y > "h`?%> >2 `K 0fp` @Qޔ &d@ @  #<$>2a@BΔ  a4`@ >2! )`0D Xp`@   *  @Q@?&`X&`pߒ `a@@#><mb0a> #$ $``$ `>2$ $ `0!h`4`><?a(Hʒ> > #@cH>'''' 㿘#A@" 4 c@@c_@" <-? cB@cC@!@#? '&!& 0& 8& &&!@@  @ 2 @h  > t :   2?&? @8 2?@ (?>c$!8 !4( !4 㿘$D  T&'&!  @ $D  $$D $D"$D $@ (ǀ`$@Ƅ (Ɓ㿘.`!@@* `* `* @ !@" @$@`(< @㿘@`!"  - +' *  @ `@  ` @  `@  ݦ`   㿘@`!"  + )% *  @ `鶔  ` 鯔  `騔  ߦ`   㿘N , 2 N  @>2a@ 2 >2@Œa@ pJ@ , 2`J@ `>2! > >2!`0#>2"haȐ`?@A `" a>2!ؐ($#''' 7@@Җ >2r"0  @P&dP  @O&dTa4 ꕒ &`8 &`0&`4&`< &`@`4>2`0P"> "t `@ * @O&`X&`p@]@? `aP@ʒ#>>aa> #"$``"`"">> p&? @ a(F> > #Ȓc>'''А'ܒ}8 㿘#A@" 4 c@@c_@" <-? cB@cC@!P#? )&!& 0& 8& &&!P@  @ 2 @  > t :    &?`@8 ?@ >c$a8 a4(@ a4@ ?㿘$X  T&'&> > cȖ !@ $X $$X $X"$X ` $T@ @$T@ @ @$T@ @㿘!P* "P* #P* @] 㿘@ `!"@(` * 2!` " 2 "`  㼘@``!"( ` 2!`  2` 2Ja Eb @ $P:`($PaPbP*cP @$P`( $P( $P (2 @㿘`!4 @Nx  #05 ?? @ @ +`*2 @ @3`@ @ * @ +` 3  3` ` ? +@?@` 2$P*@  @` $T"@ 2`2`㿘"LD@  > "`$ 0>  $ @     ?"L D >c$"H003f#"H0㿘 "L! D@" ""L D2"L㿘 "L D*@ " ""L D ?2"L㿘!Ԑ `  `1  " >c  >c' >c# "$ 2 -"L " - "$ 2 -"L    -"$ 2  "L "  "L>c"P $2  %D # %"`㿘>c"$ !"L``D `l@ "L?"T`D "` "L p@"L D@ @" "㿘>c"$ "L !      0 [0B0?㿘"L  D !Ԑ  >2"  >0  >2"X 㿘`@  " "`Q 8Dy@ 㿘 >2b @/)>2"`? @(>2`?b@! 4`? ">2"E0>2@"&a&bP0  @LҖ &bH ` 4 "`@  2 `P 2  ` `H&a`L>2&a&a$`Pb@= &6a >c"$   a   a @v??* @ @* >2"&a&a`6a&bL& @&bT '8>B"@&b4b,C Cb, &>i!\@   <@    ` >i!\@Ґ ` @$ (֐a#>cb$>F>F>F>?>?>@"bܐ#aДp&a&a&a&a&a&aĀ&a&a>@ &a>?#Ԡa&a>?>?【2Œ   # 2ǖ 2 #0#b$ bL   #2  % 2   2 2̒ 0  % 2 2Ò %b$>C!쀢` &b8bL ">?! &b8&b<b8@F a㿘` @V 2 4 6  2   ? 0 ?  㿘 L 4(@\ d4(@ L(@?Ȅ 2(@(@(2(@ L(@2(@㿘 L d,A , L (( L(㿐`P􀠠"p>A>2>A>A>A>(#Tc|L>˜!@&a&a&a&aД &a&a&`H0 @Kg `H&`L!?'> Ԕy > π" L>2R#P `HZ &`D>2H#X#> ˨bp`H  @l{2 bp`D  @ "`H>27#h&`@aԟ€> `D" &a&a 2 >2##> 8 "ܒ  @ ?&abp`D &abp`H" J&a>A>A>"c 8L>0 @&a&a&a&aВ  &a&`H&aؖ(H@J&`Lh@?4  @ * " `H@J &`@&`DhD !4hD?*4@ ? 4ga`D€`H`D`H$|# &a&a&a&a&a2#0Va'S@= `>2&#0JY >D">H>C?c"$$$4<$&.ϐ.a> `@*@ >2#  `0>C H&`0&`4@E 8 4 8>C H&`0&`4`0$ 8  >2cH@ ` @"$ 㿘>2c   `@>$ 㿘!!` ` L(@""!(D>2(D#(F  (D!4(D! ` @ @a `P `@``@` >3  ( `@& ! ` 2! 㿘"! @c`,`!  ` ;` > |`?& - | $ 2` * @  +  2   2 +` *`*2+ 2`2* 2  @ @* 2@  & 4  4  4  4  |@ @ F&" *!*2 3  F ! #@ +`3 +` 4 @㿘#b bؒ {6 6 *   >3 @  4   @& '& >3 ` >3  x >3  >3    &  >3     `& & !܀  " "*` @&! ` 2`@ ?"@& & & @ P㾀!.`!''2"`? 2`*  ` 2 "@} &`@x &@   #& 䀢 !> v!x "$!x    |'''| $!x P+㿘!"&*@ @ >3 `" @Ɛ0!@# `` 2` * "2@# &*` ?# @2@ &㿐 <`@=%@ 2p`d6 <@ 0`| @*@ @ 2* *@  2@@ * @<#@@  2@@* @2 @@*` $`@" @ ' *  +  + @ +   3 @+  3 @+  3@(@``F#@ +`+`3  0@+  `F#@ +`3 +`a 0@s  $@` V  $`$`$ `?$` Jb@b* @   @      *  2  %(  >3!`ܐ. 2  ; <"@@} <@ @ *@ . . 2  2@ `2`@@ ?"@$@ $@ 1"@ l"@ h`| "@""*@ @ 2* *@  2"@"@ * @"<#@@  2@@* @"2 @@*` $`@" @ ' *  +  + @ +   3 @+  3 @+  3@(@``F#@ +`+`3  0@+  `F#@ +`3 +`a 0@  $@4`㿐H /f * ' ! !ԟ€! !ԟ€! !ԟ€, @$@' `, ` * `*,@ F`$, 2 , 4` D @"@ ' ,` * *!ğ@!ȟ@ d @ !@ `@W H 0  H 0 㿘H /f * '  >3!  P ;6 '  @`` @& >3!(l ` @ >3!H` `6 @A H 0 "x!`' 4 !!Ȁ@>Fqb4>c#l @v* q q0@   㿘<%6`6`6@ F&@ *!*2`@ 26`  23@@ 2`3@!@ ` `$@@>3!h`@>3! 0` ?>3@ !`>3@ !ے 0>3" Ք㿐!# !!ԟ€`!  3@v3#< &>3T"(!,!,&`* @&  "ؐ,`"  `` ?    @ + ,`!"   `@  ?+ ` @6 ,`!``@|j*  F "@*`2 *` 4@,`  !?* @ ` 2`",`"  `` ?    @6 + ,`&"   `@  ?+ ` @6 ,`&``@|(*  F "@*`2 *` 4@,`  &?*  ` 2`,`" %`` ?   & &  & @ &  ,`"  2` @%' ! `*` `* *@ ?  F ! "  !b̚&bԘ?&*b&bЕ2*&  3 F&"@*`2 *`! 2㿘6@#6`<c! 6` *` !А#`**` ** 2`@ 6` F &@ **2! 3 f >3@ 2 >3 "@ 㿘!< F#$ *`!*`2  4`4"4 4 ! ,  ,  @,  ., ,  `, ,  , @ , , ,  ,  - >3 2 F>3 n"p0J!$ *`*`2  4`44 4 !А!     >3 >3 N"0*/!@   `q F! " * @*!2 6 3`  !@ `ޖ !̀`@ 㿘  Ж 㿘 H /f * '  a@" <a @"  <C a2@>a1@ ; (!1 6 <  L PB0,@ #$! < 2 < < ?6 <  @00@)+ P) P`4@   H 0㿘!  &&  4   @{6  "   "6 a P  *@ #*`@ ǔ  & 2    &!܁㿐" "樑*@ @">3+ @ `2*    @z@@   ?`А Ð?"  *` П"" |#!0|ڒ |֒ @ &`2Ғ  ᴀ@ @  @  @   @  @  @   "& & ᴀ@ @  @  @   @      "  2 &`s   r  # @  @  @  @   @       C A& ј >    "& &`21  ᴀ@ @  @  @   @  @     `  & @ &`  र??$ &@   ???0P & & & '     & `    (8&  @  2 & > #@ 8&   & &  $@&@`Ӣ"в `W- @@2 *`  !"@"  @П&@ @   П@&@  @П&@ % 2 `2@x!""$*` ?# @2 @x $  g h4 h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h f g4 g4 h h h g` g g h j m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 j j j j j j k k k k, k8 kD kP k\ kh kt k m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 k k k k m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 k k k k k k m0 m0 l l l l( m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 l4 l@ lL lX ld m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 lp m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 l| m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 l m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 m0 l m0 l l l l l l m0 m0 m0 m0 m0 m0 m0 l l m m m0 m m$ m0 m0 m0 m0 m0 m0 m0 m0 j㿘 <""> v>3 "!|"۫ H 0"& 0 0 ?& 0㿘`> v"!|""`(`?*   *  `>L`̒ax@m >3"P`+ `6"@`4`>3@"`>3`F#`6 *254``Ȱ  64` F4` 3,` / ,`4`"$ (㿘` @v3 2" "    ? .  Ѐ` "@D `$   `  x 0 @@ & &`X> "x*` &`l>3#@&`p + `\  " `x  @j#&`|&`x@uf#`x &`|&L BR  &`t>3[#H@uV&L  `x+ `t "@ `, `x =@ `  *``x`4 * `x `s * $`x` .a2&`.a3.a4.a7.a6.a5&`&` 0#\#`    @  2`x>3#X0ϓ,   S,, * `t* @` " >3@ @>3v#>3s#a5? `.a5ea5a2 .a2 ,`t" a2 esa20>3 # Ua5? `.a5eca5a2, .a2 , * `t* @"`a2 2#`ePa2#`#\    @1  2a5 ? `.a5e:a5, @*``t@*` a2 .a2 ,`t " a2 `e$a2` `@ ϐ>3#0F>R#&`0&`4`0 >4`@o` "@i0 8 0 ?耦'?2 '`@2' @+Ő ' m   '@i6" @+ a8>Xcj?>c#l*j>@ `    㿐`0@t> >  ؒ`&`&`X  6`6`&` \&` * "@ 2"`ؑH /d * %  `֒  b `ր >4`>4 u``ؐ 6`#\#`   @j   ! !5? `.!5dr!5, @*` t@*` !2  .!2 *  t " !2 `Bd[!2`B`>4> 06`" @ >4 H36`>4. ``ؐ#\#`   @%  2!5  ? `.!5d.!5, @*` t@*` !2  .!2 *  t " !2 `d!2``@ >4 x`ؐ#\#`   @  ,  x  2!5  ? `.!5c!5, @*` t@*` !2  .!2 *  t " !2 `cې!2``@ >4  6`6`6`6`.`.` <#*`2 `}2 `ؐ#\#`   @  2!5  ? `.!5c!5, @*` t@*` !2  .!2 *  t " !2 `c!2``@ >>48  #``ؔ #\ @j  2!5  ? `.!5cs!5, @*` t@*` !2  .!2 *  t " !2 `c\!2` `@ >4 <6`֪`0.`nɐ  `>4`(!``*`ڒב4  &"#\>44 : !8`ؐ#\#`   @  2!5  ? `.!5c!5, @*` t@*` !2  .!2 *  t " !2 `b!2`"`@ >4I!p ``ޒ`ڌ ?ڈڄ`ؘ#\#`  @  2!5  ? `.!5bɐ!5, @*` t@*` !2  .!2 *  t " !2 `b!2`" @ ]>4!P6`֖    ?#@`2 `ܐ  " `܀@  `2  `倢 ~}`~>4!gH 00)`ב"  @)=  >3"@rd ` @"$ @h6`  bR`֑H 0? 0  > đ2 * " ` `` ( ("` ( ("`` `"`㿘?2  > `  6  `đ. @ >4!`a 㿘? 2 >   @2   đ* @  e`f@"N  m@"We e@3 0  h@3 0  n@"`g@O 00 e@u 0}| H /d4 * %  "H 0e  Ȓ֔!_  Ȓ `& ȓ*`` &!  @h M ր I G4 E  "  Ԑ 4 ?# @4 Ԁ2 3  @h , ր  ` 4 ֒@?`4# @ `*  *  >R Ȓa< @h$   @ $ H @㿀 ?>  6 2  M đ* @Gր  آ'  @e_" ?'Дi@e|"ր  )  `6! . @  "   *@$ *@$  $㿘>R>!<!ؚ AX㿘>R>!<!ؚ AL 㿘?2 >    2  60?đ* @    *@2  Ȑ r " ?,` ?( W2` 2  c ?㿀 D? @2 > `@ 2`  đ*@   T &   (@t) <  u& 4ր  آ'  @d" ?'Д@d"ր  "  < D  " < O& 4 OȖ @g̀ $H c"$ >  .` 0t.` 0r 02 .`  o.`  ?.``.` .`   ?6`   ?.` 0Y 02 .`  o.` .` .`  .`  .` "6` .` .`0B` .`  0   o` `  .` &6`   2 6` .` ` .`  (@rې.`  @r8 @rӴ.`  @r0 `6`  (@`  &` $@`*   = .`㿘` ` \ 02i !2 25!2 @^  2^ !2 (!2  !2  ]R 2M !2 >4 !5!5  ]C 2> !5 >4!2 2 2!2!2 2?>4|Q"( .!2 J , *  t* @@. \     #`#` #`$#`(#`#` #`#`,#`#`#`#`0@㿘!2 2?>4|"8 .!2 M ,`*  t* @@ 2$>4|"P("(& (?"D \ 2`  2 * D `T`ȓ*`   H @b< 2"<>4 }J"`!2`.!2 `- *  t* @"`!2  ^N!2 &$($&(( "%"(&:   $ $ $$ $ $ ($ $ $ $ $ $ ,$ 00@   Lj@`0@  㿘.`*  X*  t -@P2!7c !* !7 @nА !4.!7`  .!409>40G>40 @  \M  @>4?{g"@ * X2 *` X2 *` X2 *` X =*`  X *` !3  .!30>40P>4  @  \  @>4 @ {,"㿘!4 @ X B B  aƐ ?  B   `  ? @ ? ``?  @ 2!4- @!3 8!4" @T !4 !3 .`*  t* @`!2 "    "!2x x d x@l  x = @   *@ xР"@ `ې ` * | X*` X2 *` X2 *` X2 *` X*  X*   XD ? $ x X   x "& X x  @>4{" X *`  X  b@  ?  X  4 x>4zh" *`  x 㿘!2` >4"{’  X *`  X  b@ ` X ` ? t   t` 0  2m !3?.!3"Y!6&` x/   * 2 *  `@*  t  ; 0 "`0J "5!5F  "`4`0`0("`0`$`0* "`@`0`<`,@au`H t 0`0 `< `@ 0h" `0!2  .!2 * t" !2 2 \[!2 \W!5 .!5` ? @ &` ?  .!6!* !4 .!4   4@( `2 !4!2 "!4\4!2!4!3!2@!5@ @ ` >4# {  >4(>4>4#8{ >4{#`㿘`"!4!J@ @lԐ !4.!6.!4 P ">4y}#p !4  X "!6㿘 X ` @ `  @>4cz˔ ? >4#z>4yQ# `  *`     t  Ő @“-  x @ !3?.!3  2 "$  `$  @ "   "    @  N2M  H  $  (`"$ $ ($ <$ $,`$ $  @ ,@ @ @*  `@,@ &$ 4`  @e 4`   @e  @l1 `,`  ` a >"@,`  ( $`!6 ?  .!6!* !4`.!48 M   ` "9 ?`0`A 9 ?=   0`0 ($`4$`0 $* $`@$`@ ,`H@`(`< `< 0`@`0" gZ !2  .!2 * t" !2 [!2ё  @$ !5`[.!5  @$ !5 .!5 4 4`4 㿘     #>4yڐc 0  D>4 `#yВ`a@  @  @  2>5>5  ` >4` #` y@zyc"  @r >5y  >5 2>5>5 y 0>5y P㿘` ``?` ?`@&`!5 .!5`?&`!5?.!5? X` V `$ + ` `("  @ &`$&` &`(``   @dא @dҐ@k@ @k<@c?- ` &`  .2 *  `@.2  .6`  ܐ ?6 `` `" @d. `@k `. !6 0?. `  `` = `&`@2( ` 4$  &` .2 *  `@.2  .&`!6 ?  .!6!* !4`.!4  0  H /d * % !4!!3!2 !5ؐ   H 0 W #\>5 x X@iN >5x `$ >5? >5x   , >5x $>5 >5x  *@ @jy ? >5x P    2  x,  @@ @2 t>5    #\03 #`xy  `40 >4#8xm H /d * %    t `  @" ?` ?"`  t  " ?4` >5 xE  ? v H 0>c#l*!8^@ 㿈  ` {'>K!P*`      Q Ѱ  ͑* R  ư     ` 6?`!?>K ȓ*`  ` @l `倢   * @ %6   @l| `倢 2   0 ~ @lm `倢 x  2r   @\ ``  p @\0X `БH /d * %  #``ؐ~#\`,`0 *  t* @ `. t . !5? `,!5Xz!5 !2  ,!2 * t"  !2 2Xk!2   %H 0 @\ >Kx* >5!>5!(>5!@>5!`>5!x>5!>5!>5!>5!>5!>5">5">5"0>5|"H>5y"`>5v">5s">5p">5m">5j#>5g#(>5d#8>5a#X>5^#p>5[#>5X#>5U#>5R#>5O#>5L#>6I >6F >6C (>6@ 8>6= H>6: `>67 x>64 >61 >6. >6+ >6( >6% >6"! >6!P>6!>6!>6!>6">6"(>6 "8>6 "X>6"h>6">6"㿘\ `& & 0& & & & & $& (& & & & ,  $ 0 < H T ` l x 㿘 <""> v>6t "!"˧ H 0"& 0 0 ?& 0㿘`> v"!""`(`?*   *  `>\`̒a@\ >6"uL`+ `6"@`4`>6u<"`>6`F#`6 *2u14``Ȱ  64` F4` 3,` / ,`4`"$ (㿘` @f/ 2 2    ? А@kb@ @  p  0@0 & &`X> "x*` &`d>6#0t&`h&` *`\" ܔ  H@Z" #?ܒ H @  'ؒܔ  @Z H H@Z6ؐ H  @>6#8tĒ`0@eR H&`t&`p  2>  &`l>6sG#`@eB    *`" `p`l "@ `p 4 @  *@ `p @  *@ `p @  *@ `p@ ` *``p@ ` @*``p@ `  *`ٓ*`l&``p`h 0&`x&`| 0 #\#`   @ `| ``2  `x " U|`x` >6@ >6t[#p>6tX#x0l>6tT#` ">6>6tM#>6tJ#Ȁ` `@ ɐ>6#t@0T`X   >a>6`t6#>7t3 >7t0 @0D#\&`0&`4`0 L >7`@_`h" @Y] 8''쀦'?2 '`@2' @ ' ]/   '@Yd" @ `>fbdZm>c#l*Zl@ `    㿐`0@dl > !4`&`&`X  a&a6`6`&`&a,&a*` *   l* @&` \&` * $ 2"`ؑH /d * %  p`֒  S B`ր >7`>7 s``آ 6`#\#`   @   x " T x  >7s} ?6`">7@>7; sp 6`6`6`6`.`.` <#+ an2 al  }2 &`ܐ &``܀  `#` #\ @Ě  2` x " T\ x 2`܀ " `ܐ@`>7 s86`>7s3!`0.`_Ɛ  `>7`s"!``*`Ԓё4  &"#\>7!0: 4 s  +  " `܀@2 ` 逢@ >7`䀢@>7` 耢@ >7!h r>7q|!  $ܑ+ ``˗?`?ˑˏ`ئ#\#`  @B  x " S x "`@C>7-! ```l hd`ؘ#\#`  @   x"` xS` " @>7!rP6`֘   ?#@`2 `  "  `@  `2  `逢  ~  }` ~>7!rcH 00)adȍ"  @9  >6"@c` ` @"$ @Y6`  SN`֑H 0? 0  > 2 * " ` `` ( ("` ( ("`` `"`㿘?2  > a   6  a . @ >7"`qa 㿘? 2 >    @2    * @  e`f@"N  m@"We e@3 0  h@3 0  n@"`g@O 00 e@u 0}| H /d4 * % !dޔ"H 0e  ȒҔ!_  Ȓ `& ȓ*`` &!  @Y M ր I G4 E  "  Ԑ 4 ?# @4 Ԁ2 3  @Y , ր  ` 4 ֒@?`4# @ `*  *  >a ȒaL @Y$   @ $ 9 @8㿀 ?>   6 2  M  * @Gր  آ'  @V[" ?'Д7@Vx"ր  )  `6! . @  "   *@$ *@$  $㿘>a>!L!ؚ 2T㿘>a>!L!ؚ 2H 㿘?2 >     2  60? * @    *@2  Ȑ r " ?,` ?( S2` 2  c ?㿀 D? @2 > `@! 2` ! *@   T &   (@e% <  K& 4ր  آ'  @U" ?'Дz@U"ր  "  < D  " < %& 4 %Ȗ @X̀ $ 7@  N ` *  Ȯ"@>7"H$ ok . \   $ $ $ $ $$ ($ $ ,$ $ $ $ X$ 0@G 㿘`쀦>7mؐ"`D `T`ȓ*`   H @Tj< 2<>7 o,"x! &:   $ $ $$ $ $ $ ($ $ $ $ $ ,$ 00@   \<`0 㿘 X  0P l "@0O>70!>70  N` @  >7T` А Eb@ 2>7>7mq""nْ mj"ؐ@A 2  X#P"7 >7m\"*` X2 *` X2 *` X2 *@ X *` "@0>70P>7   N @  >7 `@cm*#㿘 @_  ` l`x 0 ` p 3 "`h`"  & @ ` *`<@ @`O &   , *` l*     p*`   $@  *"  ` *`2`  `   @`  ? Ӡ` @㿘@  4  XBa     ? @ '   ?  @ 2@ @@  2@@@  " X`@ 㿀 |*  |  *  2`  * @  `*` ߐ * | ` *` | `  *` |`  `  * | X *` X2 *` X2 *` X2 *@ X*   X ? $ | X    |  " X |  @+>7m@ X b@ 2 |>7l,#X *` |Ȕ 㿘` >7#hm  X b@  ?      l` 0  2M4"H4&` p@ ` *` ` `2  *`` 0 0 "`004"*`,4 "`4`0`0("`0`$`0* "`@`0`<`,@SM`H`0 $`"! l 0`0 `< `@ 0Zx" ľ`0&`N:` ? @&`4`? 4@ 㿘` ,  \ `" a"  `  2   ,  P㿘 X `  >7l#x ? Y >7#l>7kr# ` @ @*` `  *`  @    @"  ` "  `  `2 "$  `$  @ "   "    @  B2A  <  $  (`"$ $ ($ 0$ $,`$ $  ` ,` ` ` *  `@,` &$ 4`   @W 4`  @W  @^P `,` ` a >"@,` (@2` 4` 4`<   ` ". ?`0`0 + ?,   0`0 ($`4$`0 $* $`@$`@ ,`H@RS`< `$"a `< 0`@`0" Y $ ǐ   @$ MA  @$   - @ 2U  㿘     #>7lc 0  D>7 `#l `a`  `  `  2>7>7##`>7`#`k@qkcЀ"  @i >8k  >6 2>6>8 kؐ >6kՐ#ȁ㿘`@``` ?`@&`` ?4&` R` P  `$ + ` `("  @ &`$&` &`(`` !d @W @W@]} @]y@U?' ` &`  . 2`  . .6 `   ?6`` `" @V.`@]M `.0'`  ``` G ``&``@ `   &` .2`  . .&`㿘 H /d * %    l `  @" ` ?"`  l  " 4  >8 k @ ?  H 0>c#l* Q@ 㿈  ' 6  0z&  u q m i "0c a  ]*  Y 2S   @P  `   @P&0= БH /d * %  #`#\ 2 x  `. x . x" K x  gH 0@O [>[* >8U X>8R p>8O >8L >8I >8F >8C >8@ >8=!>8:! >87!8>84!P>81!x>8.!>8+!>8(!>8%!>8"!>8">8" >8"8>8"H>8"X>8"h>8 "x>8 ">8">8">8"Ё "F   "A   "< 4: @ 4 5   &/ . ", 04* " 0%"$ @ ! " `    " ` %   "  @ $   @ 0 㿘\ `& & 0& & & & & $& (& & & & ,㿘` @Z 2E >c"$ 2@  ?2 &   24 >8@Zb 2- > 2 & >8@Zb耢 2 > 2   p ?2` >8 @Zb 2    `(?  㿘`     2> > !D!@&e   (@$ ,> > >I>I>i>j>ja`!L8㤘#,`T  6`6&`L&`D6`:&`\&``&`d&`h&`l&`p&`t&`x&`|&`&`&`&`P&`X``'>8>j>j>je!b&`&`&`&`>j>j!ta&`&`>k>k>l>k>k "bܔ&`&`&`&`&`&`g"e &` &`e  ` &` &`&et!@&e &z  &e>8g#  e" &et>i!&e&ex&e|  "  >8 ex@y  >8ex   !@&e>8 hŐ#8e>8>8#HXh`> !8 >8#ph> !>`>@ @i6`> ?!4 @Y  ?  `@ @{ > 0 Q  @r 㿘 !8 >8#hz& <+㿘% %t  `` ">8 hb# >8@ h[#` #  & ! #   >8hG#؁㿘> !8 %t>8h<#%``2" t 4 p 4 l 4 4 4 4 4 %4 4  t $ ^$ $  $ X  $  t 㿘 ` @>9f % =  >9g 801 >9 Xf  % ``>9f} p $  & & & `/@   $   @M   &  >9 gΐ $$` 㿘 ` 2 >9fU ">9fO " $`   @M $$ $` 㿘  '%t#0#Pߐ d%  > `>9!g  $> !8 >9!0g㿘@%t  4 %t? 0%t?c0c0 0 000 0 00 0㿘 `  @%t>9!Pe )> !8  &%>9!pg> ? 4   4      4   4 4 ?#ߒ @4 44 4 <`4 4 4 4  >9 !g   d* t  \* ` @ *@ l d *@ t  \* ` @ *@ t*  4   !8 & >9f!ȁ㿘   %t>9fא!0 ?& `?# @4``@" `>9fƐ" "`, `{&  p`` %& %'> "8 >9"0f4  >9"Xf  O& $ >9e("p"@8& & >9"f :` 5>9 f|"` `'?`  @0`?c 2 ,?`,?` 2 ,?`?c 2 ,?`,?`?# @2`,?4`4` 4` 4`4` 4` ` `* \*㿘@ %t  $ %t %t   㿘 `  @%t>9!Pd +> a8 &%>9!pf      ?%   a8  >9"e <$ % $%  ` d* ݗ >9"eݒ  t   \* ` @ *@ l d *@` Ւ >9#e  t  \* ` @ *@ t* >  %   a8 & >9!e 㿘   ` %t>9e!0 ?&   ?$   "  >9e#8@ "`, `?&  W> !8  $@>9"et4  >9en#X  C& $ >9c"p"& &  5 `   "> )a&>  ?2 * c2 * > 2 *Ȑ " > 2 * 2 *a̐  "a > 2 *aА "aaԐ "a$ $  `> @ *@ \*8 >9"e㿘>  2 # ? 2> >9c# P P 24 4  `*` * " > b* @㿐>  !>  P 0$ P Ё  6 а 6  * * > " b* `@㿘> !؀  >     >  >  * * " b* `@  㿘> !؀ >  "l  > l 2  3  * * > " b* ` @  㿘  b@1> !؀   ,  2*&!' > !؀ >  "l  > l 2  0 * * > " b* `@@㿘> !ؒ  >  " >    > >  >   e 㿘> !؀ >  " l  > l   2 * * > " b*  $ @@ (  € 㿘>  ` ``@㿘!>     €   € 㿘>   !> > aܐ?"a!܀  € !ܐ $!܁㿘>       ( <  , X  < `!0: ``> >n!*` >9cQ#:`2> >9aސ#"? >  ' 2(`` % >9aː#>9aȐ#! 4>: `a 4>: b' ? 2eN&`>: @c >:a P B', `@2` >:2` ??̀ >:a `'@1 " `  !>:0>:0> ?> b *  @ '2* `'  2! `am p` Ñ, &`㿈@>:2 a ` 2 J28    <` &   `4& >n!,` , , @, *@,%  %  @@ΐ @ ,@ @ ,@ 0`& 0@c @ٔ ,@Ԕ@V @̔ ,@ǔ@mI @ ,@@   @ ,@@     p.8"P% L  @@ ,@   ` @} `@f  >   > !J p.@  %  *% , %*   %* %* % 㿘  ,@,``2   @@Z ` 2    z&   v&  r "L   L$`$` 6  $`  @" $`  $`  2    $`   $`   $`  B@#@$`@i ` 9$`?  @  @  @  b@#   `?$`$@  @>:` "$`>:_ b #$`$`$`$`@   , ,` " : 2"5 `2, ) &`` ` `     `    ( " 㿘  `,, `,@80`2 `@@n   `,  " 2` " "!``   ` @`  ` " `!`  ?" ` @ @@`&4  @4   ` ! @ @@`&4  @4   ` ! @ @@`&4  @4   ` ! @ @@`&4  @4     ` ` 㿘`   &  & & & @x&  㿘?.@6`2 `*  ?  & & & & @a&  `2  2&  & & &  ?& & & & &  㿘?.@*26`6.g<  & & & & @0&  g 2&  & & &  ?|& & & & &  㿘?#@#@66/ *6`..7  @ ?#  & & & & & @ @ ?2&  & & &  ? @ & & & & &  㿘.2`&`&` >:0 >:0=Ks  ^ 2 &@` 2&@ &` & ?&@㿘/ /` (`67`7 @20`0+#" "    &  &2&  @@@&&&& &&&&  0    `?㿘@ ` "`` 4` r"@@ؐ "`` $``  2 0`1 ? #$`㿘@`* @ [N E2`M`4 Y Z"@@Z  `@2 9   @& `,@`@2>:]. 8 @`@"` ` & u "11 #`,`1?*@㿘@`* @X >M'@2`&J  ="@@C  `@2 @ 5&  @& ! @( <ܒ `@"' ` &  ?1@&1 & 4@`, &`1?@*@㿘@`* @ Q#@2`&<#@  "@@ @`@2 %@   @& $ } `@" # ` &  1@&& &?1 &4@& &`?&`, &`& `@  @㿘 >:>:& &&x&\ 㿘   ,@ ,@   2@` $` 2``        `) , ,0`1 4  @ 4@D``  `) , ,0`1 4  @ 4@D``  `) , ,0`1 4  @ 4@D`` `) , ,0`1 4  @ 4@D. ``c  `) , ,0`1 4 @   4`      㿘 ` ` `@Q`` ``` B : 1" `! B  +`"   B 3`` `   b`    B @ b`+` @  B 3``@ `   b`  ` B  b`+`   B 3`` `   b B `&    b`+`   B 3``    ` ` 㿘`  &>:Z `r   >:Z # ####1 `_      `?    `$`   ` "(+@+(03@3  @ 0##### 㿘` ?    ?`8#  ?@ 7`  6  .//@67@/` . ` 670@./(@!#####?   LL     8888㿘>c"$  >:`@Lf  `?[K `>:`[F!    9F (fɀ  ( 4("@`%>c$ *>!> ϐ \@K!> " \(> v$ H,"c$ L$ T\$ `$ X$ $ P`$ d$ l$! $ $ t >А#"@>@K!x!> $ HN  \ d@$ `$ z >:@!  @,>:@a0 >:Ym!@>:a0@D 2>:Yc!x  >:Y]!$?>:YX! , ,  0Ԃ`  ", >:"YG?P@@O ?, ,  0Ԃ`  >:Y1"`@;?pA ?p`>:"@@" 2 >:@>:@Bb 2>:>:Y"@b 2>:Y"> ΐ?* > " "$  > !=@?P` ?P*㿘%> ϐd@J!'> v` d` @@   }L -y ML`1L L` @ / 2*@*@L @? `L , : `L : > Ϡ L?$` $`> bp`  "bp dL /̠ d@,@  ` 2L -  L c"> ~ d a"> ~4> ~  L s> ~ b "bb "bb$"b>:YԐ# ۠ b "b㿀!>c"$ 2N`>:YÐ#80' (''y`J@ ,"$`qJ@ ,"$`i"$ N@ x>@N` d2>:>:cHcP@O > p?& & & `"p N`>:X Y@O #> ?bp& & &  $bpN`>:N@ ` Y @Obp&  & (&  i l'*`N` e#*`>: @Ouch!> "p?& & &  $"pN`>:N@ ` Yw@O` "p& &  & $"p:  sN` d t r> ">:  >E & @>>:cP@O8 !> "p?& & &   $"p>:#cp>:ch@O' !> "p?& & &   $"p>:cx>:ch@O !> "p?& & &   $"p>:c@O "p&  & & $"p  >:Wt#> " LJ 1 :  : N`>:N@` X @N> p&  & & "p f@N` d*`>:c @Nΐ> p & & & i"p*`:  l!*`N` e*`>:c@N !> "p?& & &   $"p>:c@N "p&  & & E$"p:  sAN` d t r9>:c@N #> bp?& & &   $bp>:c@N bp&  & & $bpN` r  >:ȐX  >:N@`X{ @Nc bp&  & & $bp㿘>:X:#N >:>: #X0  #X* `>:#X#`a N 2 >;X > v  ሁ㿘>c"$ ,> v#  '>  X@ ">;@M~  >; W `"?@` &` &@L *?Ѐ &@ $L 0` &@㿘!> "  > v>;> v 8a $"> v!.  㿘!> "  > v>;> v Ha $"> v!.  @ > L""l> ~"$#>ceb$ W >dch 8 > #@,  &> <@ <@ *`: * @ch *` > !̀@"  2$R  $ 2 2 >;U X' > bp ''> ΀ "a>;U xb$ b$@>;@Ӓ`>;@HY` b$>; Uђ > v@> v#`x>z#>;"`''@o 2b$>;U b$ b$  H o@@s@>c""ءH/ />c"@G(8@4H 0㿘>;U!㿘@B^#@B[#1> v'>;  W!А@H#耢 "!Ф#@L\!Р!Т@ "@ W .,@!Ё㿘`>; Vɐ!( 4  0 ">;>;!H!P>; 4V!8 㿘1> v" 2 &"@^ 2&">;U>!X㿘 " >;ap@+@G @G >; 㾘!@G>;a@!?#>;@`  `@>;@Ga " @K'  >;>;!xVg   >;>;!ȔxV[ & &@Jn &  ,>;a @ ? &   >;>;"xV< <  & (>;b0@ @?" 3 %>;@8 *   %8@w4   >c"$ > "> "h*` # "  , Ē    >;>;"HxU <  &!0>c"$ 2? @ "@ ?  ,  >;"pUٔ 㿘`@F `?P'>c$ 2 > >;> ϐ"xU  >;>;@Fap> ϐ"x@K  >;> ϐ#Ubx$ 5 @F:!D>; '5>{8 >ʒ@F.!D> >:!dch'''8> 2>;>;T#" "''8>  2'0>;>;#"$ &@ 5> v>;`@>;`@Fx @E!D>{'8'''>} @ >;> v > v@E֒!D>; >{''8''>c > v#` `LJ ">;> ""hc@ > "bh@Ȑ>;yc> π "`X>;S#> ϐ!d'k >< U S'r  >{8>% 2SL S$ >;>; @  @l>;@E` ;>;ap@b @E 2 )4 "><`0@EԐ><@EВ`8 > > b "b> "  >{H 0+>{8'=̖ @N $`!>c"$ 2'? "<  "<@ ><"8>< ''' @S> "p ' 'ڐ耢 ""$:? 3><@"$`">:ch ><R `@`x@? >;a@ ( ><@><`8 ><  R͒8>c"$ ><0 > "$ > "$ $ T t > v#  " & 4%>< !`0$" >< R `N Q><` $`$ @` A >< S`><!S Ȳ ,@>;7c ><Rk! ><0><!H>;!R^  @!)`@Gے     @  $$    ><R@!X><S!x㿘>c"$ ><!S > v#` €>< 0!ȒS 㿘> v#`€㿘!> v!˖ ?" !.㿈  㿘> v#``@㿘> v#`@@㿘 >;`͐>;@DS!  ސ >;><Qǐ!!p@DB %>; @= >;@D3a  ><@D+b ǒ 2 >; 㿘!> v#` ><R" `@ #`@ 㿘> v#`€8@ 㿘> v#  8 |@HS |€0@0> v#` `  @ ><><@ dR &@x dR&@&Ґ  @  㿘>c"$? > v# x"> v# t㿘>c"$? > v# x"> v#`d@><Q"ȝ㿘> v# l㿘> "Ԁ%" > *" c$* `@`@?" >  `@$> $ > "x : * $  ?2 @ 㿘  > ",`@G@H ``> ? > *```>  㿘@! ><R#3><> bLRc > !耦 >; 2 c R   2>;Q 㿘`> @@? , : .@> bL@B > > "8!耦 "%.@ 2 @B  2   ><Pa#0*?c *   *` & 2.@㿘  :  2><PC#@@B> $ $ > blbl $" $ "bl> "p?`'p> ϓ*`!D@ -> > ̀#"8? 2  2 `xP 4 ><`Q  ><P#h 'pK>   > ~"> ~b "b> ~" "><QV# ><`#  a QH %><QEx@   @GT@F ?L@ * x ,@ t tx   t ><  G><0 p ><@ ;?9'pQ# ><`#  bPPx@̒ ޒܐ`>v!*` ?'pt? @2  `@?`v# @* ` * 'pp> t> %"b9"Ѐ 2,y ? ,  ` **` ? 2`   2 ` *`@*@ > %̒?> ""'pp>  ""Ԁ \> ><#aPU>  ><P#0`@0]> ")?> cd> 2  ">< 3 a#Pu> "Ԣ `4 ?%"ԑ2 @2  2`  2 2 2 @2? 2`  2 2"#""? > bЀ@> > ""b> "l  2> b̓2` `  @ 㿘 9 ",>; @ ">;  % !>;  #    >;O ,@ >= ?O0ѐ  O0>= >=>=O 0Ð O,@`x> !>;  P@EQ@EN >=N]  @Eޔ @E @@͒ 2㿐l㿘>c"$<x> ""@>   @ > π "" Т@ * Њ@@ Ъ@@> >="O @㿘> > > "t"* > "" Ԃ Ң  Ң Ң> >=" @O`"㿘!> @: Ģ @: ܔ*> "t*@> "b> "" Ԃ  Ң Ң  Ң Ң Ң>T "`"  pК@ `к@>a  "`"a>=O @㿘>   @> "t> ϐ?* > > """☀!"D @   ТA0ТAЂA  @ @ @W :>! !$ >` "`>=Mz P  >=N @㿘!> @:G Ģ @:C ܔ*> "t*@> "b> "" ԂԢ> Ā  ̒ @ 6  ܐ ТA@ @  > ܀  @ 6> ТA0ТAЂA 2 @ @ & > >="`N @㿘> >> "t"?* > "" ҂ z a ଔ 6a Т0ТЂ 2  & a { Ң> >="Nm @㿘#>``@9Ӑ`@9`*> "t*@> "b> "" ւ`̀  @  > ТA@ @ > ܀  @ 6 ТA0ТAЂA  @ @  ֢&Ђ >>=N$ > >="`N @> τ >`  > ˄"p`8 "p Ģ0 ``8 ` Ģ> ϒb`>c$"`* * :`>8  Ģ@@> ϔ>c$"* *`* *`:>`> ˄"p`8 "p Ģ0 ``8 ` Ģ> >`  Ģ0 > p8  Ģ 㿘%> =)> ˦"p> Ϣ@`4 "@8"p  .? $ Ц"p?0" ,?  Ц? 0#@4  6 6 | `?09>> ଐ"  ࠄ8 "  Ģ` > ϒb`>c$"`* * :`>8  ĢB@@> ϔ>c$"* *`* *`: >8  Ģ  >> ˔> pb:? "b Ģ? 㿘㿘> ːbp>   %> bp@ @8G"4.$,? " ТB?@ 0#@4  ?6 6  `?0#@4  v6 0_  Ơ  ƠƠ㿘O>>8? ? > v2>̄3  o ??  Ģ> ȅ2   ? 0 (  > Ȓ2`  ? @0 ` `?> ˑ*  㿘@2  ?6` " ` @7&&` <* & 2  㿀`   2` 2`>  ?aȐ  @  2  ' 4`H*   '* ?@ Δ  2` *`: '2`  ` '쀢 4`H*   '* ?@    4쀤`  '>!>=JV W`"!42 !4 *`='`* 8"2   ' 4`H*   '* ?@j   2    $  4`H*   $ * ?@ M  n Eb6  X T @?77& G`􀤠2 !4 | "2   * !4"@!4012   * *  " `H    2    * *   " `H    㿈֔  2 2  2z 2   ' 4`H*   '* ?@  `^ 2` *`: '2` `  '쀢 4`H*   '* ?@    `5 2  `? ; `*> H€& # V쒒  2   * *  " `H  a `      @   ?"@ ? 2    * `,+?%     $ (, 04 8<  @?܀             ? 2 2 * ` `2i `? 2 * ?2   8"  㿘 >= >=  IŚa > > v( "  > vb   "b>=HJ!0( > v" "㿘>  'J > ϓHo o> """H 0 * > > ϒ"J` 0*` 㿐!>!8''€ 2  H>= >= L!HxIl3  H  ?p>=>=!Ib>=G"㿈">="G*>="@G &`H/` /> v":  >="hGΒ  >c>c"$ 6> >c"P>c. b$!`>"!\>"!" ?.)  :  @? (R@"> ?).   (R#\#`#d >=" G. "@@  2 "&` H 0 x>c"P6` . !@cH/` /%> v:  >=> ".  >="G[>c"$ 2>">"!\!" #)  :  @? (R@"?).   (R#\#`#d >=# G+  q8  '''  N@@'```   *@ $H 0㿘H /:`@ G#H 0.  㿘!2   > v>=F#H * > w`+ " & & " "@㿘!> v2 8 2 >=FҐ#X> w "` +`"&   * ( 55555445555555455555554㿈 ?H@ 5>c$ ?H?L :>c"> >C"b$G!> ˤ"p> "1>t>=* G#@͐ @ *@ !  >=Fz#@")> >=Fq#"D * * #`! +> w#\a ?? "a>=F\#3> '"DbH@3/@@ :@  p&bH"D bH@3@9/a/> ˑ,p@  T "D #\    u 2> >>F ! `4p@"D*a!  H'#\ 1 > $"b<#> π??$b!> ?0 $"> Ԑ! > `""@>>E @ "bɒ" b@">>Eސ `>> #\  66 > π "b>>EА !> ˒"p`>>` G3*@ "pbH!> >>"DG*㿘%> H  > "L> @2 d$H1> "D  H &"D &"D"D  &"D"D ̓*`#3@("D$3&"D"D> bp* @2fH@@2`$H"D> x* &. . "b㿘!, !0" !,`@; " ?   ? !8   $`!8 ?&!8!4  #>a($a *&!4@7J P$a$= #$H$$$$,&㿘`%  >c   -0 -03> bPbP bP  ( 0"$> !> v#$0! ! ``H`@'@@ !*@ `!!#!  @@'X'\'`'H'L`'d` 'h@*@ 'l`?P'p`0't!  ? 0'L'DxD-?@' H  ?@   (`$`H$`$`$`x @'  @ "+ !0$ <* @  ## # # # 0# H؀  $a  a ?"a ?" @&!?㿘>c"؀ ") (>mK> ~ ""> X > vc쀢 >  "cH"X(>>ZE!H/` /!>m@i>m"@s ` ">>>>E!(a>>Đ!H>>E!X>>E!x>>E!  > v s*b  @> v" d*  -> v*""* > v*"> v"㿘> "Ѐ"2 > * $"@*` `@ @#> bx> b *@  * $ $> > "bd"`> v  㿘>c" 1> @"Ѐ?> "` %> d "? 2 2 >> ` E+!"> 2  c$*"@ `*` @>>E!Ȁ?">>E!0`2` `*`" * d>>E !@#B@#%> bx>>* D>  > >  > "p= >>D! :."@ @8> "p?- >>"Dؓ5 !> v" @ " "П@" > Ԑ!@U@ 2 4`  צ  " >"Г,  >>D"0>>D"0>>D"00 >>D"@0 >>D"P0>>"`D㿈>>D"p>>D"`%>  0>> <"  $ ( ,#\ 4#` 8#d 8Du#h 8 p 4@4 " 0㿘> v #> ?x"bp 8 `>>B" @ ? ">>B#bp  >c"$@ @ *@ . > !` bp& 㿈> v#쀢`">>>>`4D$##> D #(#> ˠbp >> #8#\   D >>D#x >> , #Dbp *@>> 0>> <#  $ ( ,#\ 4#` 8#d 8C#h 8 2bp>>C#㿘N@  t>?0``>?0>>Bj#>?CҐ 0 Cϐ 0 0Cɐ 0㿘>c"$ >?C H H/` /> v#쀢`2a,>c"` $` H p@` * ( 22#  *@ `  `" *`0*@2@  `*@㿘!0 P 㿘!4> " ! ;<=P>>>>>>>>=l=? 0        㿘?  2 @ϰ #> vb( "(>? $"("(! " "( >?!> "̐ `$b(>t> ! bp$""̀ 2`>?A  ` ?``?&@ &`>?A 2 @` >"0*` ` @( #> ˤbp> ϔ,`!> π   b'> "̐@ ` bp `" @ 8 "̐ "̰bp@L@ b`` ?G#@> "p?H @ >  X@ >  p@ : @` 2 @"@ @ 8  @@ 8 `@?  H *` A &`> >c"$ $ q ` %> Ѐ  > !> "p  "p@2$> `"p@ 8 " `  "Y@? 2  @ !> v"( "(#^ $"(? ->c$   㿘> v#  "  @ " @  㿘#   &, ?㿐#@2>  X &`%> v,@>  X@> vH/` /4H p@  $,> v#0  c'@'  #@Pc@ 0c@c@p 0؀` Ho o €H 0 @` &   'Ho o  H 0Wp`r]  V |Ho o  H 0 @2b aC`E0 2VHo o €H 0@6 @ $&  4"> Ho o €H 0> v`& " Ho o €H 0> v"",& "   FFF|F\FFhFpFP㿘> !\@㿘!> >t> !  `H"p"p >! @"pސ"p` @2 㿘>t> ! p㿘 `#Ђ   ? . $$Ң``  ? 1?`  ?1?** `  >??.   ?  2`( $(2`  ?(:`  㿘> Ԓ!0 Ҧ`z> Ԓ4`  >*             ""@ "@"㿘 @   @$@ :`$@ * `$ $@> > ""@㿘> %> "   ̐#> В$`ϐ  >?>!`> π", `@> ˔p @2@ ` "#> ` > Ԑ ,     @  > "x 2@2O ` > ԁ>  > > >txd82`  2`@8@( (> ̄,    "# 2`@8`2`?d (> ̆ #,( *` (8 #㿘/>c$  >?>!0> %?> +?"`X" p2 @> %?> +?"`X" p@H4*` > * $`⌀`@Д`> b @&> \#a? > v> #@2 4  , @ 2`>  ` * Ԡ? Є Ф> "p? 4&@&㿘 !Ђ* >`<  `T   Т@Ђ ```>?0 >?0> p>?"@=|!`>?=y!@>=s!`< `T  㿘?. #+ `$چ ` ( , (>? (@ ?( @ ( `  `  (@ +  z@???$ ` @  ` =/"` ?˰ 㿘?.  @, @؆  " " >? ?(   `   @(@ +` z@??  @   <"0  ?԰ 㿘?.  ؆  ">?  >?`* @.`@  z@<ܐ"`<ڐ"? 㿐> # ,#` "`" "@$ $  "& $ ` $ `"&`> Д ,> Ԓ x",0 "04 "4.`$> # #>?<" `2> >?<"!@2>?<#` "`" "@$ $  "> Ԑ x & > А  4 0`" 0" 4 * @`$*` `2 >??<_#P1 @@ (`>>c"$ 2``"Ң>Ю@>!P € >c"$   + * # + * ; >c>c"$   "Ң>cЮ@>c"$   Ҫ`  Ҳ` > "ƃ# B>t!8?(  2: @*`" * > ̐#,     &  `2: 2?? * > ̒"@,*`*  * @`88 @" ($> "p@  >c"$` >  >  * *`:  Ԫ`> π`#  *`*   *`* :`@Բ@`> #5  ` "` $`  "@ @$ ` $ `"&``$.* @.  2 $ 4 4 㿐> ԑ.``l"* @ *  $* `>c"$  ** @** ;`@>c"$   Ҫ`  Ҳ` > "ރ@#  B> >t!8?+  2: *`" * > ̐#,    `  @  `2: 2?? * > ̒"@,*`*  * @`8; @" > "p`@ ` "` &   "@2> >?:#x #*`> Ԓ !2``"  "`> " | "@> В``0?"`0`"  "`> "# "@> В``4?"`4# #> ϐ# #  "@" > В``, "`,㿘 0 6`*  $* @6`` ?*@@= >  #@ `5 І@ "0?0.?@H /f * ' > ϒ# >c"$ Ү@`> Ҷ@`> "Ц@> "p@`H 0 㿘>cb$   0 4H /f>* '>x   t # "x+<`|@\@"|??""|`> ""|> | t,` "@!  b$@    `0&`44>c"$#& G&  @>!X $    ?>c"$  `> ``#Ъ` > ``#в` ? 2*>c"$ - - : %*` *  аH 00 !>!` ,,` p: @  z@">!X "Ң`H 0㿘#>c>?9#b$ &"#>a` "aX"aX "Ң`Ң/>% @>!    >b$ ">@>!X  Ҫ@>>b$   "Ң>Ь@>`x$"`x㿘H /f4 * '    H 00 @  `2>?97#4 *` `$* @4  ?>?9*#ȕ*   > #  2>c>?9#"$ 2< <  | *i$@ % > ˒#`x `| X2 `?#?#(M` Ҫ@>!L@`  Ъ@@>c$ + 2  Ъ@`$2  в@`$> ˀ`"x<  < ?,`6@ <` @& @,@ >c"$ 2< <  | "@    $ " ?$ 2g @H 0㿘H /f4 * '    H 0_  @ P4`*` $* @4`` ?>@8j * @ > #"6  Ъ@@@@>!L@ Ъ@@>cb$  Ԫ`b$Բ`b$> ˀ`"x<`  `<` `?,@@ 6 <  , @2%  @H 0㿘  >@8 (, +> В `  "`> & #(&     & &   1& *  "& ` "` &  ?A& > В``  "` >@7ߐ 8 2  2 > "#(1   !   > b   2 > В``"`  & T㿘 ` ` > В`` "` & & E& B& > В ` "` 2%! " " ! #  `& ! > > b  >  "!> ϐ#(/ 2>@7_ H""" " " &㿘H /f4 * '    H 00^" S"``>@7/ h# $ > ˒#`x ``|*5@`" ?#(?#((@"Ң>!L@ 0Ң`  :>@ 6 @& *}``  $` "@` ?$` @`2`"H 0㿘4H /f4`* '`   H 0C "` `4 2 >@ 8"" Ң pҢ`  2 `<    @>!L@ p Т@` ?|2%` "H 0㿘  >@6x (, +> В `  "`> & #(&     & &   0"& *  "& ` "` &  ?A& > В``  "` >@6? 8 2  2 > "#(/   !   > b   2 > В``"`  &  㿘 ` ` > В`` "` & & C& @& > ϐ#(. > >@5  `"  ` 2" `  " `&   > b " 2 $$ $  $ $ &㿘 8H /f * '  `+%>c$  "@@@@ $ `"Ң> Ҫ@>!L@  2 >c"$  "0@H 0㿘>c"H!> $"p1"p>c"$ : > π"b@@㿘>c"$'D'H`'L` L>  "#> > ϐ "cL> "b>3> &`L>;> ϔ4'b>> Ԕ a%>> " '>> "t)>#D> "+>`> " ->> "P/>LT> "ذ?> ">>>>!>#>> > "a$#aL#a@5> 7> 9> > > > В?&d& '"!"  "` 'L " "`+> > ѐ!"`$  T> > ԓ, `L@ !"  ?> ϒ`, * `L 2 ?H̒LL> Ԣbx*" > ԑ* "`l@&Ɛ!>D$ t%a*`@7> ϐ" &> ϒ#"#"`5> Ԑx" &x3> ːbp @,@bp> "@ @"@> "?> "a$ \   $ x$ \&$#> vc@>?"?"| >c$`4<`  <` ? a> "Ԑa $#>+   `?D4`D   6 %D &%x`% `""`% > Ԓb ` % `""`> Д 0 "0% 5 5 ``? ?%@5 * @2`> "Ԁ``? ?%@* @*`   - `@bp > bԑ*  @bp Ф@ @ L>5 %`% `""` ,L ",  > \ ,  @  > # <`   ?#8  ?>c$ > #Ь@`#д@`@  > > \   Ҫ@>c"P>Ȓ!4+@  #Є@ Ф@> "p@@ 㿘>b3> &`d>> Ԓa`7> &ܔ!>>"b1> ;> & L'a+>`> >"c !/>9> '"\> )>"bب X> " > >>!>#>%>'>->"a!, > > > > > Ԡ!bt > 5> &  b!! #`t" P > і" "$", `@%]"(> А L@%Y  T3> В`L> ԑ*  " "@  ?* * `L"@?#>> Ԥbx`\$`t1> ԑ* &!$@%57> ˨p $`\,> Ϧ! "$ , @(I$`p !> ϐ$#$@% 9> ϐ'"$@%  5> Ԑ& @%$ > Ԥ,#"T $(: $,``pz( $`+"!-``$`(-`@ 2  cz@%  2  >@4G!8-` `L $ -` - @*`  ,2 @ , z@?$@ ``̬ !p> "bb"`ΐ> "> ?"!%> \   # x% \&%>?!>"`<"`|4 *`! $* @4  !@  *> !2`  > c$ > `T >c>c"P >Ȑ!4 >c>c"$ <  |< @z@p ɓ4 #>a  !> #$#$> ԒT ڔ"@\㿘 "Ң!,   $Ң` p2  ?!Т@ $Ң`㿘>c"$   > " +> $+ݐ 2   #  !Ԑ 2   @ !ː 2  ,"@  & & p㿐> >@#(aP#\   ( >c"$ !> "h> v>@"HaX$$  (#\> v>@#\#ah!! (ǘ 㿘>c"$ > #$ ҂`>!  ` >  T> "x"@ 2@ @ 㿘> ˀ@ "p> !@@ 㿘  " @@# @@㿘 " ++/& >c"$ & & $`&  & !& > v )"HG& (& ,  (*  z$ ( > *  c#z> & 4㿘   ? & @ "㿘H /f#>c* '#>cb$    ">@1@!x    >@17!H 0 "b$Z "b$   > v  >@1!j> v (*ܐ"H& ,& (  " 㿘 V> Ԑ!>  PW> ")>c"$  "0@H /f@* '@' "$6` ?`6` * ** :`* @ **  $* @ ` @ "$H 0>c"$  "0@㿐. $* @@ / @ `  Ҫ@> "x&2  >!P €t@!  n@ @ h> 2a  2>t>!L@>t!8?,  2: *`" * > ̐#, @   @#@   `2: 2?? * > ̒"@,*`*  * @`8<  @" H /f * '   H 0 Ц@> "p@@ `',>c$ ../ / >`@> \  Ҫ@$ > #Ю@`#ж@` w ?, 㿐. $* @@ / @ `  "Ң> "x&2  >a q aP€l@>!  e@  ?@* @ [> <2M?>!L@>t!86􀢠  2: *`" * > ̐#, @   @#@   `2: 2?? * > ̒"@,*`*  * @`8 > @"  ? pҢ`@ ?*   z> "p@@ >` ,`㿐. $*  x / >@/M! l ;> >@/A!c@2~>c"$ 2>` >`  | @a@ X> 2R>t!8?,  2: *`" * > ̐#, @   @#@   `2: 2?? * > ̒"@,*`*  * @`8 "H  *  H 0$@> "p@@ `- "% ? ,  "$   Ҫ@> "x&2  >!P €!  @   Ъ@@>cb$  `b$`b$> ˀ`"x>`  `>` `?,@z @ s> 2a 2>t>!L@>t!8?,  2: *`" * > ̐#, @   @#@   `2: 2?? * > ̒"@,*`*  * @`8<  @" H /f * '  H 0 Ф@>c"$ 2<` <`  | "> "p@@@ 5->cb$ ./ ./ >`@  b$ cЮ@`ж@`) "%v ? ,  "$>c"$   0@"& 0 4"& 4㿐.$*  `  / >@-ʐ!  2>@-!؀ "Т@> > "x&2  P€k@h f ?*   ]> <2M` >!L@>t!84 􀢠  2: *`" * > ̐#, @   @#@   `2: 2?? * > ̒"@,*`*  * @`8 <  @"  є  pҢ` ?*  z> "p@@ >` /- >c"$  / . ! Ң``/   z!> v&#% ` ? ,`  " Ң`(.@z@@B "`#&$@㿐` 8`` 0H /f4'* ''    H 0 0Ҋ@' ں ?  4- $* @ 4` ?>@,А!@* @  2?>@,Ɛ"-  7> ϸ  2 >c"$ @<  |< "@ܒ "$@ ? - @Ӓ "%@    Ҫ@>!L@0  Ъ@@>c$ *2  Ъ@`$2  в@`$> ˀ`"x< `< `?.@ֆ@:>@ "0,q  @ Ц@`W>c"$ 2>` >`  | @L"> Ԑ!2> \,  Ҫ@>c"$ > #Ь`#д`   ?+-  >c"$ Ю@`ж@`^ " % ? - R "%>c"$   0@"$ 0 4"$ 4> ϐ#(%Ӓ 2+ & && Ҫ@H 0 㿘 0F @H /f * ' @6`*  $* >c$@6` ? ** :`* @>@+"h8 ` + @@ ` 2`ز> # 2$ @ >`  |>` @Ɣ@*@"> "p@@@ #  Ҫ@@@@> Ж $   "$(>aL "(@,Ц@> "p@@瀦@0  Ъ@@$ *2  Ъ@`> ˑ2  в@`> $p` >`  >` ?@y*p҂*@Т@ @ o@H 0 @㿘> ːbp > Ԑ!.@  !!`  @6`6` ?H / * ' *`  $*  2  >@,|"H 00 > >@,o"H 00x`+  "`  > #  >c"$  >`  |>` @@ @Q*@F&@@@   Ъ@@@ @= 2+>!L@%Ъ@@>c$ *2  Ъ@`bp2  в@`bp$` >` `>` `?.@@ @.@ @H 00  `" H 0㿐` 8` ' 0H /f4 * ' `  H 00"҂'􀥠w   4 -`$*  4 ` ?>@*K",@ ` 2?>@*A",`@  "`Ң>!L@ 0Ң`< @   ":>@*(# @  z@ `2> Ԑ!@-@ -, ! Ң`, z!> v##ђ %@ ? , @ "`( "Ң``(-@z@% "&##> ϐ#(# 2   ?% %%"ҢH 0㿘> ԐȔ0!> Ԓb4` `@"H /f * ' @a>c6`b$+   $* 6`@ ?+ + :`* @>@)"h8 ` *@  2ز " Ң)> ː"p '> Д$&: @@"$>` ?* @ @  (`" (  < >!L@ pҢ` ?*  z"p@@ޥ>` @H 0"㿘.> "t> Ԓa> Ԗ"4 .@  '> В` "`H /f * '   " Ң<  2p>!L@p Ң`"  ?` "`|H 0㿐> # >`  l  (:> >t"xa86  2: *`" * > ̐#, @   @#@   `2: 2??* > ̒"@,*`*  * @`8 > "x?6*   @> Ԑ!  @@і  >@(#8@㿐6`, $* @@6` `?6,`@ H /f * ' 5> @"d@ 6`#@   H 00O >t!8?,  2: *`" * > ̐#, @   @#@   `2: 2?? * > ̒"@,*`*  * @`8    Ҫ@>!L@  . @ N@ )> Ԓ x >6  - `\? Ҫ@>c"$ Ю@`ж@` > "?@ Т> "p`@H 0 㿐~66`*  $* 6`@ ?H /f+>c* '+>cb$   0 4# 2  :  & & 4   & 0 2" "{  "%-  ?> #4, @@> "Ԓ "* `   $@ ,  - > #  b$ 2>` >`  | &    Ҫ@@>!  @   Ъ@@b$  Ԫ`b$Բ`b$> ˀ`"x>`  >` ?* 6h #@  H 0ٖ < ?& <S >t!8?,  2: *`" * > ̐#, @   @#@   `2: 2?? * > ̒"@,*`*  * @`8 ` >!L@  , < & < @  @> #">c   Ҫ@0  Ъ@@>cb$  Ԫ`b$Բ`b$> ˀ`"x>` `>` `?.@@>c"$ 2>` >`  | $H 0 㿐`+`(@@@:> >t"xa86@  2: *`" * > ̐#,      `2: 2??* > ̒"@,*`*  * @`8 > "x?6@* @ ! @> Ԑ! @㿘> Ԑ!@㿐@?x*  `@`<@:> >t"xa86  2: *`" * > ̐#,      `2: 2??* > ̒"@,*`*  * @`8 > "x> Ԗ!> ԓ6 *`"4@ . "@@  @#@   >@%#`    $ "  $ "㿐=6#@ >@#%6`*`  $* @6` !@H /f * ' >` ?* @ 2[ @ <H 00eL >t!82`􀢠  2: *`" * > ̐#, @   @#@   `2: 2?? * > ̒"@,*`*  * @`8   "Ң>!L@  ,   7` /@p Т@` ?*  zH 0 㿐{U6`,  $6* 6`@ ?H /f4* '  " "Д  .|s"$, $ 2> v#  $ ? z@`凐  (2 , @  z@- @`!@> v ϐ# 2$@  ,   ,  ? zd 2 - @  z@s >` @  2d  ?@<H 09 < ?q& <Q >t!82`􀢠  2: *`" * > ̐#, @   @#@   `2: 2?? * > ̒"@,*`*  * @`8   >!L@  , < & <  7` /@ " Ң pҢ`>`   zH 0 㿐`x* `  ``> "x6@>t!8+ @  2: *`" * > ̐#,    #   `2: 2?? * > ̒"@,*`*  * @`8"> Ԑ! "㿘> Ԑ!@> І  㿘 r6`* @ $*` 6`i ?* > #   D# @@  y>c"$ 2  "Ң0Ь@@ֆ@) >cy>c"$   "Ң>cЬ@@>c$   Ҫ`$ Ҳ`$> ˀ`"x>`  >` ?* ւ @ `>c"$ 2>` >`  | @ > ː"p ? * *@  &     $ 3 ((  3  ;  >  x>c$2*@?+ /@" 㿘 8h & `㿘 8  Z  㿘 8P & `㿘 8  B  㿘 8 & `㿘 8    㿘 8ܐ & `㿘 8  ΐ  㿘 4> "x?4, <> Ϡb@> "pz) Ф@㿘)>!  4 `4ϐ+> ˢbp`4 #! (``> ϑ4 < Ф@bpy>!L@ ФФ@㿘#> vb4   4> "> v> "0G!$b4!>! > 씐> ːp 4!*  > v"0 0Ң`b4z!> vpy"0"0 0Ң`b4 z@㿘'> v8 4 `4!> "> v""@#> Ԓ "a $8> v""D a> v"b<#>a +> U+> ˰bp 4a ,   J 5a*  > v"@ 0Ң`8z> v"D 0Ң`> v" v"D!> v"@yqbp>!L@"@"@ 0Ң`8 z@> v"D 0Ң`> v"< z@㿐>c"$ 2r" Ң i"> Ԑ!⮒@  ">t>@!#!84 􀢠  2: *`" * > ̐#, @   @#@   `2: 2?? * > ̒"@,*`*  * @`8`      " ?  0Ң`|@<2> >!L@> "p"0f e &>t>@!I#!8?,  2: *`" * > ̐#, @   @#@   `2: 2?? * > ̒"@,*`*  * @`8`   稔 ,2> >!L@> "p> Ԕ􀢀2$$  ` *` (`"8> @:88> " "@㿘>c"$  >Ồ 0 >Ң㿘 H /f4> v* '> v#쀦 v >,0!`>c"$  "Ң0 Ҫ@H 0㿘>  >c"$*`  @> #> bz * > ː"p  >㽀7>c$   "Ң"  Ҫ@"#ʤ 'Ѭ9> ˒"p`)> $*  ?$'`# # > #   * @# #  > Т L!@#  `> "Вƀ" `? 4@  #   > "Вƀ" `4  ?2'  +$> Ԑ ,      ?? #   > "Вƀ" X`4 > $ A/>  @0>c$  `> `> "Ѕ' #   > "Вƀ" '`4"p`@$>c"$ > # Ҫ`# Ҳ`耣 > "Вƀ"㿘H /f * ' > "t>aH.€ '>c$  "$@$  "Ң$ Ҫ@$ $> Ԑ!@   H 00/ 0Ң`{. 0Ң`{$ 8>ք H 00Ф.֤>!H €$  "0@H 0 㿐> ˒bp`  @("`  y 2 >c"؀ "`&&>A>A#c Q > #.  >@#> v#쀤 2 >   $!0 *!,  "_' L 0, \  0& #> ʀ ဦ $䀦 0 >B " ဦ 0 뀦 퀦 0 >B ? ?n > "8 >A>A#cȔ'  3  4>A!#ܒ 2'`&&     !4  > Β * N!> bu!$!4> ! 2 '  ɖ  R #>a w!4w5$a &@   ` >B` >B! H` t\ @  ` "$`>B tj@ݐ  H` tE @ ْ `X``t< @ В ` ?>B (a$`!8 / "v' ] a>Bې 8v!4$a!4' M >BӐ X'  E ' ?  `'&&6 tF>B xA  `'&& " !8 0$!8  `'&&  D  쀢`  ,(!@ 0 >  !,!<    ,@ "<*@ $ ,`А" > w! " ,    쀢`  ,(!@   ,  >  c@wj""x !> *a@>!*@&㿘!,` ` 2 x  xsh @ 2??  @$` 㿘sp!," 㿐'> ˔p> v#` ">   д> # >  m @ @   @1. 2!,H/` />B>B J>Bܐ! ">c >'#P@J>c"؀ 2G!,=#@ >t! f 8!,$!0  @   &( @O @e  Ԁ@   p>@" ȗ2 8&  "   @֔ + @ !,   ``H/` />B>B! >Br!'`o'`@'     @b  쀢`  ,(!@  >  !,!<    ,@ "<*@ $ ,`А!p > w! " ,ِ   쀢`  ,(!@ ϐ  ,  >  c@v8"!F !> *a@@>!*@'@㿐)> ː"p > v` " >   Ѐ + `` `>!t@`  `@  ` `  x@ "p> b@n"b@$Ђ`  h@#Ђ@ `@.  @` @2Z!,@3` 2!,H/` />B>B!@h>B! ">c >'#P@8>c"؀ 25!,=#@ >t! dΔ &!,$!0  d– Ԁ@   "p>@" ȗ2 8&  "  (@@"'!,   ``H/` />B>B!!h>B>!&k&  􀌠@b  쀢`  ,(!@ ΐ >  !,!<    ,@ "<*@ $ ,`А @ > w! " ,  b 쀢`  ,(!@ 쟐  ,  >  c@u"  !> *a@>!*@&p> ˒bp` "`> v#@ @">c>A! " !,@">B!Ȑ#@@" >B!$!0,``0 Ц 3`  0`0`4  >j!Ȁ@  `8  . `* @@T`2$">B!`Hؓ,  \p* 22 *q`4''`И? ?0 2 Ѐ &`0 &`4$  `     @*@`&@&`&`  `+ @`@@&`0&@&`&` 쀢`  ,(!@ ِ >  !,!<    ,@ "<*@ $ ,`АK > w! " ,  m 쀢`  ,(!@ 몐  ,  >  c@t"! !> *a@@>!*@&@㿘!0 8 쀢`  ,(!@ u > !.!<    ,@ "<*@ & ,`А > w! " ,P    쀢`  ,(!@ F  ,  > #@s Ԕ!> *!ā㿐> "> Ԑ! 2> >Br"( !> "p€> ! "p@㿘>t! @F 㿘> ˢ"p` .= >  2&@`6 z &@>t!  @% b  㿘> ˢ"p`@.@@>  `6@ S G 㿀> "D > "p#"D> ˒bp`  8 `> H/` / "D> ϐ?bȚ@"D#\ #`#`@0#d?"D> bȐ?bȚ@"D#\ #`#`#d@  |H 0`; -> " 7> >B"8p >c* $ 'A  p> "ܔ> ! @ p@  '>a 2aH€㿘> "t>c.b$`.10> Ԑ!iH/` /> "Ȓ S >BȐ"XH 0>a aH€㿐 0@2 ,>BD")>  "p H>t& L`8 $@ @  lߖ@`#& H> " 2>>B "! >  '> "ܒ> ! @ "p@@㿘 0@2> >B""t>t H8 " @ ! kĔ  L>& H& L   @ <H"@ 㿘> v#!,a,n8H $`>  >BҐ"op" !4`>!2 *p  * ֱ!&a4!4o]!%&a4% @ &a0oO P& H $  & & 4& 0P$  " >'"Ԓ $ $ $$ 㿘!4  #>a2p^$a׸ *m"!G 8 !\&66&(!0o P!,!4 `'>!2!4p9 !4o!@ Z!"(H ''   '#\#`#d#h#l  !\ #\ #`#d#l#h   &㿘  =`>B"В@`   >B"ؒ@Y  .>cb$`$ ``N` s b$ 4 b$  2 4N` s24 4*@, @  "$`㿘(!"&(<  #&< 6 *" " * #" @&& W&m(' D' T' @( ' 0' <@o 2 HnP" ' 0k >1>B7"!L@2  ", 6"@2@@В! !W@@ 1>B"n!  @o"1>B# 㿘`8 "; `( !25 @, !W@2- ` 2) ܐ "  `* @ .* @   @2  @   o ?mΔ! 㿘@ l( Hm"$ D$ T$ @($ <$ 0@nk\㿘`D`< *  @`8 ):` `(p6 `T 2 `0@22 $$`46 pp`T  $`@ ,  $`4$`<`( o2` `T`8@ L$`@`0?($`0㿘"  @`@ *  1>B# !W&`&@`mG "&`(! &`,! &`0!&`4!o!&`8o!&`<!6`B!!&`D!`6`H!6`6`J&`&`o$` $@,` > "H  ,` (  $`,` 4``a " "*   gG#ꀢ@216`  Ȁ@  @`@  2#6`  a?on$  $, > "H  , (  $ , 4   6`6` 㿘 ("2  , "  0 r  l H 6a F 6 6a B6a J6a 66a F6a 26a .*`*2 2`o%6aa  @  M@ x$$@` 6"6a       `  "4(&`gG#&`!  @  ,`@ C$`" ``Ȁ@  @`@ &`  ,`"@`"@&`b @ 6a@`@ 6a 㿘 @- @"+ =?  @28?@x &  66  F6  26  .6   J6   B6  H6  F 6 6@[   8` .  @ t " 8 "@ ϐ&& **`@ @  }*  (@ 6?㿘>B@#H 2 Ȟ@ P>BcX>B~`>Bcp>B@c 0>Bq#0   &`P<   &`TH   &`XT   &`\`   &``l   &`dx   &`h  ۖ &`l  Ֆ &`p  ϖ &`t  ɖ &`x  Ö &`|  н &`a4 " '>B@2cH 2'8 '>B?c@`P* `&`<&`@ "`<@`P`8*  "n> d@`0ђ>B#k&!D8 `'` ''> 㿘 @#>B^c ^  & L>B# Д01 @& H @c L" H $ `< 6 H  L`8 @2     " `8 L  @"`` H㿘`>B #؁ @@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   &    "  #+ 0 `**   "+ 2# +  @(*`  *02 @"@ @b 㿐  `   ` @;`>c Ԅ b    ?2    *2@ 2  &  4 @    㿘  `   `  @  ` " @ ` ?  2  H;j&. cv" "" " " " 㿘 . 2  ?&   &  6 @"@   &  i"@6  ?@2 @ ? @   &i@㿐 @4``2  ?7 x 8" > b  @ @H XP    @'@!'5ک/@ @  x@@@ 0`(` @/@:1@ #V@@@ 7`/`    ۺ@)@@ @ 7 /  Ĕ(@0os@ "@ 1 )  /@ @ =_#@ @@ 0`(` @̔/@@ "*@@@ 7`/`  @Д)@* @ "@ 7 /  Ԕ(@?Q@ !@ 1 )  ؔ/@ `&@  ؂@@@ 0`(` @ܔ/@"=@ #@@@ 7`/`  @)@?֒@ #@ 7 /  (@"W5@ #@ 1 )  /@ @ !"@@@ 0`(` @/@?f@ !@@@ 7`/`  @8 @)P@ #@  7 /  8 m@  !@ 1 )    =!b@ @@@ 0`(` @ @0,@ #@@@@ 7`/`  @(@@ @ "Q@ 7 /  /@:m@ #@ 1 )  / 5Ē@  ]@@@ 0`(` @)@@  S@@@ 7`/`  @(@@6(y@ "@ 7 /  9#ȸȔ/@@ @ 1 )  / xs@ !@@@ 0`(` @)@0@ #ֺ@@ @ 7`/`  @(@@=5C@ !@ 7 /  /@V@  @ 1 )  / *x@ !@@@ 0`(` @)@@ ?;#@ @@ 7`/`  @(@@@ "ٸ@ 7 /  /@#J@  @ 1 )  ?@!B@@@ 0`(` @@!}@"@@@ 7`/`  @@gX@!"@ 7 /  ?yN@ @  1 )  )/@"D@@@ 0`(` #@@Ȓ@@@@ 7`/`  @@=Ғ@#`@ 7 /  /@ p@ 1 )   &ߒ@"Ƃ@@@ 0`(` @@:I@#@@@ 7`/`  @@5;̒@ @ 7 /  "@!@ 1 )  6u4@ 9@@@ 0`(` @@9@!@@@ 7`/`  @@蟒@ @ 7 /  1+@"e@  1 )  1= HbD@ @0`(` @0@ʿc@ @7`/`  @7@*@c  7 /  7?$@`9 1 )  1V֐aÐ@ @0`(` @0@#3`@ @7`/`  @7@?@`} 7 /  7!a@aѐ 1 )  1bO@ @0`(` @0@?9b@ @7`/`  @7@(P@c 7 /  7@a 1 )  Ȑ1=ߐb @ @0`(` @0@/Nb5@ @7`/`  @7@ b@  7 /  :ᴐ7c@ 1 )    @ & & && @1 @  `*@ 0* @*  @* `      +` *   (*   @ `  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2* 8㿘 G ">B   (`("`  ` `>B#.%`>B #?آ>B#?0Π >B >C>B#0Ð . J@   J@J`  ?*  8 B  ?*@    2@* *@ 㿘  `  `  @/# @*   & &@&&`gBg>`"   ` 㿘?#@6 6`g  ` : & $ @$@&@ g g2   *  , " 4  "@ ,  4 `@ -` 5``@`  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  'D'H'L'P'T'X2J  J@ `2J 㿐@"  ` ?2  㿘@  H'T> "@M T ?+T2 7耦(7耢 2:  4`444`4`4`ؑ46'ē4`666A `29`@`@`*  @@`*  @@`*  @T @T :-`2 -,`- 2` ˰ "ĺ` `"`` ?8   đ. ?2@ Đ"* c'Ā@  .`@    @@ 7'7*6`+@, @@7*`e42 .2, @ ( 6`? #   .. e$$6`@?6"@ #? @ "6` 5  *. ?  @26`5Į5 'T  .  "@* : 2?. 4@*  *`@T:@̑*  ΰГ*`@     :( 2? + @( 3@@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  ?* 㿘 `"@ J@ "@ 2N@@  @ *@`N &*@ J "  * 4 ?: :  *2@ :    4  * *  @    2J@ "J`  2J@   88 @@ @   `@ @ "`"  ?*@    2@* *@    (+  2 2 " 2+J " ?* @ @ ` ``z @Z( 2 "" 2 @  &vm_map_lock_read: intrsafe mapdrivevectmuxconsoleoffsetslotluntargetphychannelleveladdrbpfilterlooprdespFAS366/HMEAM53C974FAS216FAS408ESP406NCR53C96NCR53C94ESP200ESP100AESP100out of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d %s: unknown revision code, assuming ESP100 %s: resetting SCSI bus [NCR_INIT(%d) %d] ncr53c9x_ecbregs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] SELATNS [ncr53c9x_scsi_cmd] [0x%x, %d]->%d [ncr53c9x_poll] [ncr53c9x_poll: rescheduling] [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)ncr53c9x_sched: tag alloc failure%d:%d busy requesting sense [ncr53c9x_done(error:%x)] %s: QFULL -- throttling to %d commands resid=%lu sense=0x%02x error=%d ncr53c9x_dequeue: lun %qx for ecb %p does not existncr53c9x_dequeue: slot %d for lun %qx has %p instead of ecb %p[flushfifo] ncr53c9x_rdfifo: bad flag [rdfifo %s (%d):startcont %02x] [wrfifo(%d):%s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT ncr53c9x_sched_msgout %x %d [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d gotmsg(%x) state %dcmdcomplete got %ld extra bytes msg reject (msgout=%x) %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d noop TAG %x:%xdisconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d async mode max sync rate %d.%02dMB/s %s: wide mode %d unrecognized MESSAGE EXTENDED; sending REJECT ident unrecognized MESSAGE; sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET [ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus [ncr53c9x_intr: state %d] %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! %s: unexpected disconnect; resetting sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>%s: target didn't send tag: %d bytes in fifo [%d] backoff selector %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] selid=%2x %s: identify failed, state %d, intr %02x ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: STATUS_PHASE: msg %d %s: invalid state: %dncr53c9x no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE %s: unexpected bus phase; resetting DMA active%s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled leam7990_config: weird memory size %d: address %s %s: %d receive buffers, %d transmit buffers am7990_config: can't establish shutdownhook%s: controller failed to initialize %s: overflow %s: receive buffer error %s: dropping chained buffer %s: transmit buffer error %s: underflow %s: excessive collisions, tdr %d %s: memory error %s: receiver disabled %s: transmitter disabled %s: device timeout missing buffer, no_td = %d, last_td = %d rdramdisk: multiple attach calls? rd%drdattach: device name too long RAM diskfictitiousrd_idleMSG_INMSG_OUTUNSPEC2UNSPEC1STATUSCOMMANDDATA_INDATA_OUTncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d ncr5380: scsi data uio requested%s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finishncr5380_done: state=idlencr5380_done: current=0ncr5380_done: dma free did notncr5380_done: sense asked for sense %s: target %d, bad status=%d ncr5380_done: bad statencr5380_sched: not idlencr5380_sched: current set%s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: ptr but no data in/out flags? ncr5380_reselect: current set%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT %s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding ncr5380_status: none? ncr5380_machine: state=idlencr5380_machine: no current cmdncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... vm_map_lock_read: intrsafe maparc4maybeinit: premature;n vAMaX ֣d° xrndrdvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapcd9660_inactive: pushing activecd9660_reclaim: pushing activevm_map_lock_read: intrsafe mapRRIP without PX field? ..RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_1282IEEE_P1282RRIP_1991ASPvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe map,px`0gTcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] vm_map_lock_read: intrsafe map..cd9660_strategy: spectag VT_ISOFS, isofs vnode vm_map_lock_read: intrsafe mapexec: a VTEXT vnode has writecount != 0vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapexec: a VTEXT vnode has writecount != 0OpenBSDvm_map_lock_read: intrsafe map#!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%dvm_map_lock_read: intrsafe mapvmcmdset_extend: not necessarydiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../kern/exec_subr.cocnt > 0exec_process_vmcmds: RELATIVE no basevm_map_lock_read: intrsafe mapCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2004 OpenBSD. All rights reserved. http://www.OpenBSD.org %s swappercannot mount rootcannot find root vnodefork initpagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init.bak/sbin/oinit/sbin/init/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d init: couldn't allocate argument spaceexec %s: error %d init: not found no initvm_map_lock_read: intrsafe mapacctAccounting resumed Accounting suspended vm_map_lock_read: intrsafe mapfileplfdescplfd_unused: fd_lastfile inconsistentdup2: fdallocfileclosef: count < 0closefclosef: count: %d/%dkqeueplknoteplkqreaddiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../kern/kern_event.c(kn->kn_status & KN_QUEUED) == 0kn->kn_status & KN_QUEUEDvm_map_lock_read: intrsafe mapexecve: argp == NULLexecve: no vmcmdssys_execve: falloc indx != ikernel mapping failed %d user mapping failed vm_map_lock_read: intrsafe mapinit died (signal %d, exit %d)reaperwaitvm_map_lock_read: intrsafe mapprocppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: using decommissioned locklockmgr: non-release on draining lock: %dlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: upgrade exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: pid %d, not %s %d unlockingexclusive lock holderlockmgr: LK_RELEASE of unlocked locklockmgr: draining against myselflockmgr: unknown locktype request %d lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d with %d pendingNTFS vrunNTFS decompNTFS resident data NTFS file attrNTFS hash tablesNTFS dirNTFS fnodeNTFS nodeNTFS mounttemprp_addrip6rrNDPip6_optionsemuldata1394data1394ctlpacket tagsIPsec credscrypto datamemdescUSB HCUSB deviceUSBUVM aobjUVM amapRAIDframe dataVM swapindirdepnewblkinodedeppagedepxform_datatdbpfkey dataEXT2FS nodeadosfs bitmapadosfs anodeadosfs mountmiscfs mountexecttysMSDOSFS nodeMSDOSFS fatMSDOSFS mountISOFS nodeISOFS mountmrtether_multiin_multiip_moptionsNFS daemonNFS uidNFS srvsockExport HostMFS nodeVFS clustersubprocprocfile descfileVM pmapdirhashsemVM mapshmUFS mountUFS quotanamecachevnodesNFS nodeNFS mountNFS reqmountiovioctlopsnameisysctlsooptsifaddrfragtblroutetblpcbdebugdevbufmbuffree??malloc: allocation too largemalloc: out of space in kmem_map???%s %d of object %p size 0x%lx %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %d of object %p size 0x%lx %s %s (0x%x != 0x%x) free: non-malloced addr %p type %sfree: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated freekmeminit: minbucket too small/struct freelist too big%d,%s,rw_enter_wait: NULL procrw_enter: locking against myselfrwlockrw_exit_waiters: no waiterphysbuftodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy brokenputphysbuf: private buf B_WANTEDprocplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0chgproccnt: lost userenterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession and p != curprocRRRRQQdeadzombiestopsleeprunidle%dPROC (%s) pid=%d stat=%s flags=%b ADVLOCKCTTYINMEMNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCFSTRACESSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUED pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu plimitplvm_map_lock_read: intrsafe mapsigaplpausepsignal signal numberprocfs debuggingProcess (pid %d) got signal %d issignal postsigpostsig actionpid %d was killed: %s sorry, pid %d was killed: %s %s.coreuiomove: modeuiomove: procureadc: zero residureadc: non-positive iovcnthashinit: bad cnthook_disestablish: hook not establishedpowerhook_disestablish: hook not establishedvm_map_lock_read: intrsafe mapsysctlsysctl_disklocksysctl_kmemlock%s,diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../kern/kern_synch.cphztsleepsleep called with priority %d > PZERO, wchan: %p old sleepsleepwakeuppreempt: cpu_preempt not yet implementedmi_switchsetrunnablevm_map_lock_read: intrsafe mapdenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleeptimeout_add: not initializedtimeout_add: to_ticks < 0>>> probing for %s* %d mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe unsupported not configured root device %s not configured %s (root)%s at %sconfig_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longconfig_make_softc: %sing dev arrayexpandcreatconfig_make_softc: duplicate %sconfig_detach: bad device fstateconfig_detach: forced detach of %s failed (%d)config_detach: detached device has children%s detached config_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structureconfig_activate_children: shouldn't get hereevcnt_attach%s%d%c: %s %sing fsbn readwrit%d%d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs extent_register: already registeredextentplextent_create: name == NULLextent_create: extent `%s', start 0x%lx, end 0x%lx extent_create: end < startextent_create: fixed extent, bad storagesize 0x%lxextent_create: storage provided for non-fixedextent_destroy: NULL extentextent_alloc_region: NULL extentextent_alloc_region: extent `%s', size 0x%lx extent_alloc_region: bad sizeextent_alloc_region: extent `%s', start 0x%lx, size 0x%lx extent_alloc_region: overflowextent_alloc_region: extent `%s' (0x%lx - 0x%lx) extent_alloc_region: start 0x%lx, end 0x%lx extent_alloc_region: region lies outside extentextent_alloc_region: can't allocate region descriptor extntextent_alloc_subregion: NULL extentextent_alloc_subregion: NULL result pointerextent_alloc_subregion: extent `%s', ex_start 0x%lx, ex_end 0x%lx extent_alloc_subregion: substart 0x%lx, subend 0x%lx extent_alloc_subregion: bad subregionextent_alloc_subregion: extent `%s', size 0x%lx extent_alloc_subregion: bad sizeextent_alloc_subregion: bad alignmentextent_alloc_subregion: extent `%s', size 0x%lx, boundary 0x%lx extent_alloc_subregion: bad boundaryextent_alloc_subregion: can't allocate region descriptor extent_alloc_subregion: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx extent_alloc_subregion: overflow after alignmentextent_free: NULL extentextent_free: extent `%s', start 0x%lx, size 0x%lx extent_free: extent `%s', region not within extentextent_free: overflowextent_free: start 0x%lx, end 0x%lx extent_free: region not foundextent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx vm_map_lock_read: intrsafe mapklogvm_map_lock_read: intrsafe mappr_rmpage: nidle inconsistentpr_rmpage: nitems inconsistentpool_init: pool item size (%lu) too largepool_init: too much uptimediagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../kern/subr_pool.cpp->pr_itemsperpage != 0phpoolpcgpoolpool_destroy: pool busy: still out: %uLIST_EMPTY(&pp->pr_fullpages)LIST_EMPTY(&pp->pr_partpages)pool_set_drain_hook(%s): already setpool_getpool_get: %s:must have NOWAITpool_get: %s: crossed hard limit%s pool_get: %s: curpage NULL, nitems %u pool_get: nitems inconsistentpool_get: %s: page emptypool_get: %s: items on itemlist, nitems %u pool_get(%s): free list modified: magic=%x; page %p; item addr %ppool_get: nidle inconsistentpool_get: %s: nmissing inconsistentpool %s: putting with none out pool_putpool_put: %s: page header missingpool_prime_page: %s: unaligned page((((vaddr_t)pi) + ioff) & (align - 1)) == 0ph->ph_nmissing == 0pool %s is locked; try again later page %p, nmissing %d, time %lu,%lu item %p, magic 0x%x POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p no log cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%s): free list modified: magic=%x; page %p; item ordinal %d; addr %p (p %p) poolpool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pcg->pcg_avail <= PCG_NOBJECTSpcg->pcg_avail != 0pcg->pcg_objects[idx] != NULLpcg->pcg_avail < PCG_NOBJECTSpcg->pcg_objects[idx] == NULLpool_page_alloc_nointrpool_page_free_nointrvm_map_lock_read: intrsafe mapkernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %s%d%llo%lld%llx0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad base?vverbosettimezonesshowquitLlinesllisthhelpffindqexiteenableddisablecchangebbaseaadd--- more --- %d%d0%o0x%x%s*FOUND***UNKNOWN*%3d free slot (for add) %3d %s count %d (pseudo device) Unknown devno (max is %d) %3d at root%c disable ??? %s flags 0x%x %s [] ? Unknown argument change (y/n) ? out of memory. flags changed %3d can't change free slot count%3d %s changed Error unknown state already disabled %3d can't disable free slot %3d %s can't disable pseudo device enabled %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know%s Unknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d autoconf verbose %sabled endisUnknown command User Kernel Config UKC> Continuing... selectpollpipelkpiperdExpected pipe buffer wraparound disappearedExpected wraparound badPipe buffer overflowpipewrpipeclpipeplvm_map_lock_read: intrsafe map@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ /dev/consolettnreadttrstrtttypendttyunblockttckoutqttyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group empty foreground process group cmd: %s %d [%s] iowaitrunning%ld.%02ldu %ld.%02lds %d%% %ldk ttyfree: tty_count < 0putc: required clalloc b_to_q: required clalloc vm_map_lock_read: intrsafe mapWARNING: mclpool limit reached; increase NMBCLUSTERSmbplmclplm_copym0: off %d, len %dm_copym0: null mbufm_copym0: m == 0 and not COPYALLm_copym0 overrunm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_zero: M_READONLYm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufm == NULL in m_pulldown()unixsockplsofreesoclose: NOFDREFsoabortsoaccept: !NOFDREFreceive 1diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../kern/uipc_socket.cm == so->so_rcv.sb_mbreceive 1aso->so_rcv.sb_mb == mreceive 3netconnetclsnetionetlcksonewconnsoqinsquediagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../kern/uipc_socket2.csb->sb_mb == sb->sb_lastrecordsbappendaddrsbappendcontrolsemi-panic: sbcompress (sb->sb_flags & SB_LOCK) == 0sb->sb_cc == 0sb->sb_mb == NULLsb->sb_mbtail == NULLsb->sb_lastrecord == NULLsbdropsbcreatecontrol: message too large %d acceptvm_map_lock_read: intrsafe mapuipc 1uipc 2uipc 3uipc 4piusrrequnp_attachunp_connect2unp_disconnectvm_map_lock_read: intrsafe mapbremfree: lost tailbufplbuf_dirtybuf_undirtygetblkallocbuf: buffer larger than MAXBSIZE requestedallocbuf: negative bufsizegetnewbufDirty buffer on BQ_CLEANBQ_CLEAN has buffer with dependenciescleanerClean buffer on BQ_DIRTYbiowaitbiodonebiodone alreadyvm_map_lock_read: intrsafe mapcache_enter: name too longnchplvm_map_lock_read: intrsafe mapcluster_read: size = 0cluster_read: DONE bpcluster_rbuild: size %ld != filesize %ldcluster_rbuild: too much memorycluster_callbackcluster_callback: too little memorycluster_wbuild: size %ld != filesize %ldClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvop_generic_revokevop_generic_revokeallvm_map_lock_read: intrsafe mapoperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.vm_map_lock_read: intrsafe maplockfpllf_findoverlap: defaultvm_map_lock_read: intrsafe mapnamei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsleaf should be emptyrelookup: null namerelookup: lookup on dot-dotrelookup: symlink found.vm_map_lock_read: intrsafe mapvnodesvfslock%s_mountroot failed: %d vnodefree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O'sv_lockvgetvref used where vget requiredUse count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cntvput: bad writecountvput: v_writecount != 0vrele: null vpvrele: bad ref countvrele: ref cntvrele: bad writecountvrele: v_writecount != 0vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevmissing aliasvgonel: not cleanVBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: type %s, usecount %u, writecount %u, holdcount %u,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT| VBIOWAIT|VALIASED flags (%s) kinfo: vp changed unmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done softdep %d vwaitforiovwakeupvwakeup: neg numoutputvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvflushbuf: not dirtyvflushbufvflushbuf: dirtybgetvpbgetvp: not freebrelvpbrelvp: NULLbrelvp: holdcntbuf_replacevnodereassignbufvfs_register called with vfc_refcount > 0 vm_map_lock_read: intrsafe mapsched_sync: fsync failedsyncersyncer vnode vm_map_lock_read: intrsafe mapvfslockmount: lost mountunmount: dangling vnodevm_map_lock_read: intrsafe mapvn_lockvm_map_lock_read: intrsafe mapdefaultvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_leasevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_whiteoutvop_getextattrvop_setextattrvop_strategyvop_bwritevm_map_lock_read: intrsafe mapdead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapspec_read modespec_read procspec_read typespec_write modespec_write procspec_write typespec_ioctlspec_fsync: not dirtyspec_fsyncspec_fsync: dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calledvm_map_lock_read: intrsafe mapbpf: ifpromisc failedbpf_detachd: descriptor not in listbpfbpf_mcopybpfattachtoo many interfacesif_attachhead: mallocif_attach: mallocif_downif_up%s: can't handle af%d d;n &0vAkkQMaXPq< D֣ad°Ԡ xlolo%dlooutput: no header mbuf%s: can't handle af%d ifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_setifmedia_match: multiple match for 0x%x/0x%x rn_addmask: mask impossibly already in treeMask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtfreertfree 2rtfree: %p not freed (neg refs) ifafreertredirectrtflushclone: called with a non-cloning routertflushclone: no rnh_walktreertrequest deletertinit: wrong ifa (%p) was (%p) /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../net/route.crt_init_done == 0rt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputrt_msg1routearp_rtrequest: bad gateway value arp_rtrequest: malloc failed arpresolve: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 arpintrarp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arptfreearplookup: unable to enter address for %s revarpin4_cksum: offset too shortin4_cksum: bad mbuf chaincksum4: out of data in_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplin_pcbnotifyin_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d in_pcblookup_listen: laddr=%08x lport=%d interneticmp_erroricmp lenicmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout %d.%d.%d.%dKgipqeplip_initaeshmac-sha1deflateipintr no HDRattempted source route from %s to %s save_rte: olen %d ip_srcroute: nhops %d mlen %d hops %x %x %x forward: src %x dst %x ttl %x redirect (%d) to %x ip_output no HDRmalformed IPv4 option passed to ip_optcopyrip_attachrip_detachrip_usrreqtcp_input: TCPS_LISTENtcp_pulloutofbandsynplsyn_cache_insert: bucketoverflow: impossiblesyn_cache_insert: cacheoverflow: impossibleinvalid sc_tp in syn_cache_cleanuptcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlentcp_output REXMTtcpcbpltcpqepl2578tcp_usrreqm_pulldown malfunctionIPv6 inpcb to udp_outputudp_usrreqipip_input: should never reach herevm_map_lock_read: intrsafe mapdev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialfile system full %s: write failed, file system is full dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimffs_reallocblks: unallocated block 1ffs_reallocblks: non-logical clusterffs_reallocblks: non-physical cluster %dffs_reallocblk: start == endffs_reallocblks: unallocated block 2ffs_reallocblks: alloc mismatchffs_reallocblks: unallocated block 3 %d,mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free pos = %d, i = %d, fs = %s ffs_alloccgblk: cyl groups corruptedffs_alloccgblk: can't find blk in cylffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost blockcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedfs = %s ffs_nodealloccg: block not in mapdev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ffs_freefile: freeing free inodebsize = %d, size = %ld, fs = %s ffs_checkblk: bad sizeffs_checkblk: bad block %dffs_checkblk: partially free fragmentstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in mapuid %u on %s: %s vm_map_lock_read: intrsafe mapffs_balloc: blk too bigffs_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %dvm_map_lock_read: intrsafe mapffs_update: bad link cntffs_truncate: partial truncate of symlinkffs_truncate: newspaceffs_truncate1ffs_truncate2ffs_indirtrunc: bad buffer sizevm_map_lock_read: intrsafe mapDisk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlapffs_isblockffs_clrblockffs_setblockffs_isfreeblockvm_map_lock_read: intrsafe mapsoftdep_flushfiles calledsoftdep_setup_inomapdep calledsoftdep_setup_blkmapdep calledsoftdep_setup_allocdirect calledsoftdep_setup_allocindir_page calledsoftdep_setup_allocindir_meta calledsoftdep_setup_freeblocks calledsoftdep_freefile calledsoftdep_setup_directory_add calledsoftdep_change_directoryentry_offset calledsoftdep_setup_remove calledsoftdep_setup_directory_change calledsoftdep_change_linkcnt calledsoftdep_load_inodeblock calledsoftdep_update_inodeblock calledsoftdep_slowdown called?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@vm_map_lock_read: intrsafe map@˔͠@Ф0ӈh ffs_mountroot: can't setup bdevvp'sffsroot_deviceWARNING: soft updates isn't compiled in WARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty2ffs_reload: dirty1no UFS2 support ffs_statfsfs = %s update: rofs modinodeffsinovm_map_lock_read: intrsafe map%s: modeffs_read%s: short symlink%s: type %dffs_write%s: nonsync dir write%s: typeffs_fsync: not dirtyffs_fsyncffs_fsync: dirtyvm_map_lock_read: intrsafe mapufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cacheufs_getlbns: Invalid indirect block %d specifiedufs_getlbns: indirect block %d not foundvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapffs_inactive: pushing activeufs_reclaim: pushing activevm_map_lock_read: intrsafe mapmangled entryi_ffs_size too small%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_makedirentry: missing nameufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapchown: lost quotaufs_link: no nameufs_whiteout: missing nameufs_whiteout: old format filesystemufs_whiteout: unknown opufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_mkdir: no nameufs_readdir: lost in spaceufs_strategy: spectag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lld ufs_makeinode: no namevm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_amap_i.h(( offset) & (PAGE_SIZE - 1)) == 0amap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing therevm_map_lock_read: intrsafe mapamappl/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_amap.c(( sz) & (PAGE_SIZE - 1)) == 0(( padsz) & (PAGE_SIZE - 1)) == 0amap->am_ref == 0 && amap->am_nused == 0(( entry->end - entry->start) & (PAGE_SIZE - 1)) == 0(( addsize) & (PAGE_SIZE - 1)) == 0amap->am_maxslot < slotneed(( (entry->end - entry->start)) & (PAGE_SIZE - 1)) == 0amap_wipeout: corrupt amapamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countvm_map_lock_read: intrsafe mapuvm_anon_add: can not allocate %d anons uvm_anon_adddiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_anon.cpg->loan_count > 0anon_pagein: uvmfault_anonget -> %dvm_map_lock_read: intrsafe mapuao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_aobj.cslot == 0uao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getpageuao_getpg->flags & PG_RELEASEDaobj->u_obj.uo_refs == 0TAILQ_EMPTY(&aobj->u_obj.memq)(pg->flags & PG_RELEASED) == 0vm_map_lock_read: intrsafe mapudv_attachdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_device.cuobj->uo_npages == 0 && TAILQ_EMPTY(&uobj->memq)udv_detachudv_faultvm_map_lock_read: intrsafe mapfltamapcopyanonget1anonget2flt_noram1diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_fault.cresult != VM_PAGER_PENDuvmadvice[ufi.entry->advice].advice == ufi.entry->advice(pages[lcv]->flags & PG_RELEASED) == 0uvm_fault: uvmfault_anonget -> %dflt_noram2uvmexp.swpgonly <= uvmexp.swpagesflt_noram3flt_pmfail1uobjpage != PGO_DONTCAREfltagain2uobj->pgops->pgo_releasepg != NULLflt_noram4uvm_fault: want to promote data, but no anonflt_noram5flt_pmfail2(map->flags & VM_MAP_INTRSAFE) == 0start >= vm_map_min(map) && end <= vm_map_max(map)uvm_fault_unwire_locked: address not in mapuvm_fault_unwire_locked: unwiring non-wired memoryva >= entry->startentry->next != &map->header && entry->next->start <= entry->endvm_map_lock_read: intrsafe mapuvm_fork: uvm_fault_wire failed: %duvm_swapin: uvm_fault_wire failed: %dschedulerschedpwaitvm_map_lock_read: intrsafe mapuvm_init: page size not setvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileddiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_km.cuobj->pgops == &aobj_pagerUVM_OBJ_IS_INTRSAFE_OBJECT(uobj)(pp->flags & PG_BUSY) == 0(pp->pqflags & PQ_ACTIVE) == 0(pp->pqflags & PQ_INACTIVE) == 0vm_map_pmap(map) == pmap_kernel()km_getwait2uvm_km_alloc1: non-released pagekm_allockm_alloc1wvallocwaitvm_map_lock_read: intrsafe mapvmmaplkvmmapbsydiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.cnextuvm_rb_insert: duplicate entry?%s: %d/%d ownspace %x != %x %s (last)%s: space %d != %d %s: corrupt: 0x%lx >= 0x%lx %s: nentries: %d vs %d %s: lookup: %d: %p - %p: %p uvm_mapent_alloc: out of static map entries, check MAX_KMAPENT (currently %d)uvm_mapent_allocuvm_mapent_free# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekplUVM_OBJ_IS_KERN_OBJECT(uobj)(align & (align - 1)) == 0(flags & UVM_FLAG_FIXED) == 0 || align == 0tmp && tmp->space >= lengthvm_map_pmap(map) == pmap_kernel()!VM_MAPENT_ISWIRED(first_entry)uvm_map_replace1tmpent->start=0x%lx, tmpent->end=0x%lx, end=0x%lx uvm_map_replace2uvm_map_replace3uvm_map_replace4uvm_map_replace5(start & PAGE_MASK) == 0 && (len & PAGE_MASK) == 0(flags & UVM_EXTRACT_REMOVE) == 0 || (flags & (UVM_EXTRACT_CONTIG|UVM_EXTRACT_QREF)) == 0map->flags & VM_MAP_PAGEABLEvm_map_upgrade: failed to upgrade lockuvm_map_pageable: stale mapuvm_map_pageable_all: stale map(flags & (PGO_FREE|PGO_DEACTIVATE)) != (PGO_FREE|PGO_DEACTIVATE)start >= current->startpg->uobject == NULLpg->uanon == anonuvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)vm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_mmap.c!UVM_ET_ISSUBMAP(entry)start >= entry->start!UVM_OBJ_IS_KERN_OBJECT(entry->object.uvm_obj)vm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_page_i.hpg->wire_count == 0lcv != -1/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_page.c(pg->flags & PG_TABLED) == 0pg->flags & PG_TABLEDuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: bad free list %duvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM BSEARCH BIGFIRST <>!!!! number of buckets = %d obj == NULL || anon == NULLoff == trunc_page(off)free_list >= 0 && free_list < VM_NFREELISTuvm_pagealloc_strat: bad strat %dsaved_loan_count == 0vm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_pager_i.hrvpg != NULLemergva/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_pager.cnpages <= MAXBSIZE >> PAGE_SHIFTpager_mappppp->flags & PG_BUSY!uobj || obj_is_aliveuvm_aio_biodoneuvm_aio_aiodoneswap || pg->uobject == uobj!write || (pgs[i]->flags & PG_FAKE) == 0vm_map_lock_read: intrsafe mappagedaemon: deadlock detected! pgdaemonaiodoneddiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_pdaemon.canon != NULLp->loan_count > 0uobj != NULLanon->an_swslot != 0uvmexp.swpgonly <= uvmexp.swpagesuvmexp.swpginuse <= uvmexp.swpagespagedaemon: pageout returned invalid 'unlock' codep->uanon != NULLvm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_pglist.c(alignment & (alignment - 1)) == 0(boundary & (boundary - 1)) == 0(m->pqflags & (PQ_ACTIVE|PQ_INACTIVE)) == 0vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapswapsysuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswapdrum_addminirootswapctl: miniroot copy failedswapctl: copystrswap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_swap.csdp->swd_npginuse == sdp->swd_npgbadswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filesw_reg_iodonevnx->vx_pending == 0uvmexp.nswapdev >= 1sdp != NULLsdp->swd_npginuse >= nslotswarning: resource shortage: %d pages of swap lost flags & PGO_SYNCIOswapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrvm_map_lock_read: intrsafe mapsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?vm_map_lock_read: intrsafe mapuvm_deallocate with null mapvm_map_lock_read: intrsafe mapuvnsyncuvn_attach: blocked at 0x%p flags 0x%x uvn_attachuvn_deref: vnode VM object still has pages afer syncio/free flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: page not released!uvn_releasepg: kill flag set on referenced object!uvn_releasepg: pages in object with npages == 0uvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getpageuvn_getuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressvm_map_lock_read: intrsafe mapiommu%s at %s unsupported cache-coherence?page-sizeiommu_attach: can't allocate memory for pagetablesbad iommu range: %d: version 0x%x/0x%x, page-size %d, range %dMB nameobiovmelvmesvme%s at %s addr %p vec 0x%xܠܘܐ܀interruptcountereeprom unsupported rangesobio: PROM ranges too large: %dcould not find %s amongst obio devices namezsvmesattach: can't allocate intrhandvmelattach: can't allocate intrhandvme: PROM ranges too large: %d: version 0x%x vmebus: no rangesvme: spurious interruptvme: spurious interrupt vmeintr_establish: interrupt vector not allocatedvmeintr_establish: uninitialized vecvme_addirqauxregauxiliary-ioauxioauxregmatch no aux registeroclockeepromclocktimer delay constant %d%s [TOO SMALL?] oclock: calibration failing; clamped at %d mk48t02modelno prop: %s (eeprom) mk48t08counter-timercounterdelay calibration delay constant %d oclock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz statclock; using 100 Hz oldclk statintr;Zx0NWARNING: preposterous time in file system WARNING: bad date in battery clockWARNING: clock %s %d dayslostgained -- CHECK AND RESET THE DATE! power sun4cpumidsun4csun4mno%s @ %s MHz, %s FPU: %s%s, %s; %s %s: %sphysical %s%dK instruction (%d b/l), %s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)%dK byte write-%s, %d bytes/line, %cw flushthroughback%s%dK external (%d b/l) Unknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %dmmu-npmgmmu-nctxclock-frequencyvac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-typecache chip bug - trap page uncachedcache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache [viking: PCR_TC is off][viking: turn on PCR_TC]UnknownTI_4_4TI_4_3TI_MS2TMS390S10TMS390Z50 v1TMS390Z50 v0 or TMS390Z55RT620/625CY7C611CY7C601/605 (v.f)CY7C601/605 (v.c)CY7C601/605 (v.b)CY7C601/604MB86907MB86904W8601/8701 or MB86903CY7C601L64811MB86900/1A or L64801psr-implementationpsr-versionimplementationversionOut of CPUsB5010 or B5110/20 or B5210RT602 or WTL3171TMS390C602AL64814L64812 or ACT8847L64804on-chipWTL3170/2L64802 or ACT8847MB86911 or WTL1164/5MB86910 or WTL1164/5version 0x%xmemregmemory-errormemregattach %ssync mem err: ser=%b sva=0x%x aWRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGaer=%b ava=0x%x WBINVALTIMEOUTDVMAERRparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3memory errormemory error:sfsr=%b sfva=0x%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWafsr=%b afva=0x%xSYSERR UNCORR TIMEOUT BUSERRAFOhard memory errorHyperSPARC async cache memory failure at phys 0x%x%x store buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. zsslavezsattach: expected 1 interrupt, got %d pri %d, softpri %d serialkeyboardmousebroken zs interrupt schemeintr%s: channel %dzs_set_speedstopping on keyboard abort ttydttycttybttyakeyboard/displaystdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. device_typestdout-pathconsinit: bogus stdout path %s. displaycninit: mismatched PROM output selector cninit: invalid inSource=%d console is %s cninit: zs not mapped. fdc360KB/x720KB/x720KB360KB/PC360KB/AT1.2MB1.44MBfdSUNW,fdtwo drive %d[version cmd] CFGLOCK: unexpected responseintr pri %d, softpri %d: chip 8207%c fdprobe: %d stati: %x : %s %d cyl, %d head, %d sec : density unknown fdstrategy: b_blkno %d b_bcount %ld blkno %d cylin %ld fdstrategy: controller inactive fdc reset fdcresult: overrun fdcresult: timeout fdcstart: not idle %s: %s: state %d (st0 %b cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam fdcstatus: weird size: %d timeoutfdc: spurious interrupt: state %d, istate=%d fdcintr: spurious interrupt can't be clearedfdcintr: block %d != blkno %d fdcintr: %s drive %d track %d head %d sec %d nblks %d readwriteseek failedread failedwrite failedblkno %d nblks %d nstat %d tc %d fdc: %d -> threshold soft errorrecalibrate failedstray interruptfdcintr: impossiblehard errorfdioctl: impossiblefdformat: blkno %x count %ld fdformfloppy diskfictitious%s: %s Insert filesystem floppy and press return.sbusslave-only%s at %sdevice_type class %s %s slot %d offset 0x%x unsupported clock-frequency: clock = %s MHz burst-sizesrangessbus: PROM ranges too large: %dnamerelative sbus addressing not supportedsbus_establish: can't find sbus parent for %sreset %s:%s: dma card found in non-dma sbus slot %d: not supported  '&     1!2@ 3#!4$"5%#6^$7&%8*&9('0)(-_)=+*`~+,-=.//*12.345 6q7w8e9r:t;y<u=i>o?p@[{A]}BC D7E8F9G-HIJLM aNsOdPfQgRhSjTkUlV;:W'"X\|Y Z [4\5]6^0_`ab cdzexfcgvhbinjmk,m/?no p1q2r3vwxy z{}+ ]}&12 "3!'4"(5#6$7%!8&9\'0()~)-_#**|6a7z@A`$@M qVmMW%X[{dwj,?k;.l:/m=+w |<> &12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@()])=+}*6a7z@A$M qVmW%X*dwj,?k;.l:/m!|<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)|*'*`@AC LVWXk,;l.:m-_w|<>\ 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)|**`@AVWX\*`k,;l.:m-_|<>\ ]} 2" 3#6&$7/%8(`&9)''0=|(?\)*#^@;z@A+~LVWX[{dyjmMk,;l.:m-_w|<> 2" 3#6&$7/{%8([&9)]'0=}(?\)*^6qQ@;z@A+~VWX#'`dyjmMk,;l.:m-_|<>| ]}2" 3#6&$7/%8(&9)\'0=|('?`)^*@A+*~LV@W#X[{k,;l.:m-_w|<> 2" 3#6&$7/%8({&9)}'0=('?`)^*\|@[A+*]V@W#X~k,;l.:m-_|<> \|1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?) *<>@A*~NsSV+WX@dzZexXfcCjmMk,;l.:m-=w }][ 1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?\) *@@A*|~NsSV+WX<>^dzZexXfcCjmMk,;l.:m-=}][ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)\*'*`@ALVWX|k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)\*|@AVWX'*`k,;l.:m-_}<> ]}2"@ 3#!4$#6&$7/%8(&9)\'0=|('?`)*^@*+A~LVWX[{k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}('?`)*\|@+*AVWXk,;l.:m-_}<> ]}2"@ 3#"5%#6&$7/%8(&9)\'0=|('?`)*>oO@^A+*~LMaAVWX[{k,;l.:m-_w}<> 1!|2"@ 3#!4$^"5%~#6&$7/%8(&9)'0=('?`)*\@[A+*]VW{X}k,;l.:m-_}<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*'*`@AC LVWXk,;l.:m-_w|<>|)'`A^~ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*@AC LVWX'*`k,;l.:m-_w|<>| >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\ >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\1!|!3#(-_C 2" 3*`W'@X#~|\|2"#6&$7'%8(&9)'0(-=)^~*|@@`A[{V;+W:*X]}|\_  `TDO V`Mj LNPzbDb O    NL O\ZZC",fi| JKUUv O  <       zstty flags 0x%xinputoutput (console %s)i/okeyboardmouse: %s zs_shutdown: not enabled?%s: device enable failed %s: %d silo overflow%s, %d ibuf flood%s szskbdkeyboard, flags 0x%x%s: no keyboard keyboard-click?true: keyboard, type 5, layout 0x%x: keyboard, type %d, layout 0x%x : failed to set baudrate : failed to set modes : reset timeout %s: reset: invalid keyboard type %x %s: %d silo overflow%s, %d ibuf flood%s smii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %d!A  !@@@@mii_phy_setmediamiiautnsphy: %s, rev. %d DP83840 10/100 media interfaceqsphy: %s, rev. %d QS6612 10/100 media interfacescxsplgetxscannot allocate scsi xs scsi_free_xscould not get size scsi_donescsi_execute_xs: USER without NOSLEEPscsi_execute_xs: USER with POLLscsi_execute_xs: NOSLEEP and POLLscsi_scsi_cmdscsi_execute_xs: invalid return codescsi_execute_xs: impossiblescsi_scsi_cmd: buffer without nosleepscbusyunknown error category (0x%x) from scsi driver DEFERRED ERROR, key = 0x%x Sense Error Code %d at block no. %d (decimal) %s(%s:%d:%d): probeReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadySoft ErrorNo Additional SenselHl0lkkkkkpkPk jjjjjxjXj8jiiiiiipi@ihhhph@hgg gx g8 f fffHfeeeeeXe e d d d d d dx dp d@ d d c c c ch c8 c c b b b bx bH b a a a ap aH a(a````````H`____ _ _ _P _ ^^^^^h^H^]]]]]p]X]@]\\\\\P\0\[[[[X[8[ZZZZHZY YYYHY YXXXX`X@X(XWWWWWhWHW(WVV V Vx VP V( U U U U U` U8 U T!T!T!T"TP$T8$T $U$U$T$S$S$S%S&Sh&SP&S8&S&R&R&R&R&R`& R0& R& Q& Q& Q&Qh''QH'Q 'Q'P'P'P(Pp(PH)P)P)O)O)O)Ox)OX)O@*O(*O*N*N*N*N*N*NX+N ,N,M,M,M,Mp,MP,M0,M,L, L, L-Lx.LX/L00L0K0K0K0Kp0K@0K0J0J0 J0 J0Jh1JP1J82J2I3I4I5I5I5I`5I85I6H7H8H8H8Hx8HX9H8:H :G:G:G:G;G`;G0;G;F;F;F;F;Fp;FX; F@; F ; F; E; E;E;E;E`;EH;E(;E;D;D=D>Dp>DX>D@>D >C?C?C?C?Ch?CH?C(?C?B?B? B? B? Bx? B`? BH?B(?B?B?A@AAABAXCAHDA0EAF@G@G@G@G@hG@0G@G?H?I?J?K?hK?8K? K?K?K>K>L>N>P>hP>HP> Q>Q=R=S=S=S=pT=HU=0U=U SCSI%d %d/%s %s%sremovablefixed not configured vm_map_lock_read: intrsafe mapcd{{{{{{z{{NEC CD-ROM DRIVE:260 cdstart%s: not queuedATAPI CD-ROMSCSI CD-ROMfictitious < Xcd_scsibus_get_mode: Mode page %02x request bad size: %d bytes cd_scsibus_set_mode: Set mode request bad size: %d bytes ` 0 ch|(|(|(02009000SPECTRA %s: offline %s: %d slot%s, %d drive%s, %d picker%s, %d portal%s s%s: warning, READ ELEMENT STATUS avail != count %s: could not sense element address page %s: could not sense capabilities page vm_map_lock_read: intrsafe mapsd}}}}}}}}}}}}}}}}}} %s: %luMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lu sec totaldrive offlineunformatted mediasdattach: unknown result from get_parms%s: WARNING: unable to establish shutdown hook sdstart%s: not queued, error %d SCSI opticalSCSI disk%s %s%s: ..is spinning up...waiting %s: removable disk stopped - not restarting %s: respinning up disk %s: respin of disk failed - %d l%s: strange capacity descriptor byte5 0x%x ސ 4%s: mode sense (%d) returned nonsense%s: could not mode sense (4/5); using fictitious geometry %s: WARNING: cache synchronization failed x `xP8x(xxPx Px xxpx`Hx8 xEEEE????5150ES SCSI FA1501 AT4000s HP 263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21531VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 3800 TDC 3600 TANDBERG stxxx %s: %srogue, drive empty density code 0x%x, %d-bytevariable blocks, write-%s protectedenabled%s: already open %s: cannot set selected mode %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d ststart%s: not queued %s: block wrong size, %d blocks residual %s: %d-byte record too big %s: bad residual %d out of %d dmaledma[%s at %s] offset 0x%xespdmacable-selectiontpeauiburst-sizes: rev 0esc11+2unknown (0x%x) nameesp%s: line %d: CSR = 0x%lx /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../arch/sparc/dev/dma.cR_PEND%s: start %d@%p,%d dma_setup: dmasize = %d dma: cannot allocate DVMA address%s: intr: addr %p, csr %b INTERRDR1DR2IEN WRITEENCNTTCDMAON%s: error: csr=%b dmaintr: DMA wasn't activeDRAININGdmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: empty esp FIFO of %d dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d lebuffer[%s at %s] offset 0x%xburst-sizes: %dK memory nameqec%s at %s offset 0x%x#channels: no channels : invalid number of channels: %d burst-sizes: %dK memory %d channel%ss nameranges%s: PROM ranges too large: %d %s: reset failed. be: expected 1 interrupt, got %d board-versionchannel#burst-sizes pri %d: rev %x address %s %s: device timeout %s:%s qstat=%b unexpectedRXSRXPRXLRXSMALLRXDROPRXTXSTXPTXLTXDTX BE%s: resetting %s:%s stat=%b RXRCNTACNTCCNTLCNTRFIFOCVCNT TX TFIFO TMAXPKT NCNT ECNTLCCNTECNTDTIME%s: rev %d PAL not supported. %s: no internal or external transceiver found. %s: invalid tcvr type %s: invalid packet size %d; dropping %s: bmcr reset failed %s: bmcr unisolate failed qe: no interrupt found on parent mace-versionchannel# pri %d: rev %x address %s %s: device timeout %s: excessive tx defers. %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... %s: invalid packet size %d; dropping hmeSUNW,hmeSUNW,qfe: expected 1 interrupt, got %d : expected 5 registers, got %d hm-revburst-sizeslocal-mac-address pri %d: address %s rev %d qfe%s: stop failed %s: device timeout %s: burst size unknown %s: setting rxreg->cfg failed. %s: reset tx failed %s: reset rx failed %s: link status changed %s: stat=%b, resetting. RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVP%s: invalid packet size %d; dropping %s: mii_write failed %s: mii_read failed dma: expected 1 interrupt, got %d pri %dinitiator-idclock-frequency espattach: no dma foundintrespdepthwidthheightlinebytesfb_setsize: inappropriate bustypescreen-#rowsscreen-#columnsvm_map_lock_read: intrsafe mapwsdisplaydiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../dev/wscons/wsdisplay.cscrdata->nscreens > 0%s: screen %d-%d added (%s, %s emulation) wsdisplay_forceclose: bad screen%s: screen %d deleted wsdisplay at %sdmuxwsdisplay_common_attach: no memorywsdisplay_console_inittedwsdisplay_console_device == NULL: console (%s, %s emulation), using %s !wsdisplay_console_inittedtype->nrows > 0type->ncols > 0crow < type->nrowsccol < type->ncolswsdisplaytty() on ctl deviceWSSCREEN_HAS_EMULATOR(scr)sc != NULLwsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wswaitwsmoused_sleep   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000wscons: copybuffer memory malloc failed vt100 p Ƙ diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../dev/wscons/wsemul_vt100.cedp->console == 1wsemul_vt100_output_c0c1: ESC in kernel output ignored edp->tabs != 0wsemul_vt100_output: kernel output, not consolewsemul_vt100: invalid state %d[>24;20;0cdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../dev/wscons/wsemul_vt100_subr.cedp->tabs != 0P2$u%s%d/\P0!u%5\[?62;6c[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %d  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%%$ $ $ $ $ %%% %%<%%$%4%,%"d"e"`  "% "# #!%## # #  ""#*"d"`"e"+"4"""""<"C!!"a"""")"*"'"("!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../dev/wscons/wsemul_vt100_chars.cnrc < sizeof(nrctable) / sizeof(nrctable[0])[34~[33~[32~[31~[29~[28~[26~[25~[24~[23~[21~[20~[19~[18~[17~[15~[14~[13~[12~[11~OSOROQOPOyOxOwOvOuOtOsOrOqOpOIOMOjOkOlOmOnOo[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCvm_map_lock_read: intrsafe mapwsevent_readvm_map_lock_read: intrsafe mapwskbdwskbd at %s (mux %d ignored for console) mux %dcannot load keymapdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../dev/wscons/wskbd.cwskbd_console_inittedwskbd_console_device == NULL: console keyboard, using %s !wskbd_console_inittedwskbd_console_device == scwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s ABCDEFGHIJKLMNOPQRSTUVWXYZwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry%s%dwsmux_detach_sc: not allocated wsmux_detach_sc: not found %s: connecting to %s %s: disconnecting from %s sun !l ) + / /Pdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../dev/wscons/wsemul_sun.cedp->console == 1wsemul_sun_output_lowchars: ESC in kernel output ignored wsemul_sun_output: kernel output, not consolewsemul_sun: invalid state %d888rasops_init: font table is empty rasops_init: couldn't lock font rasops_init: fontwidth assumptions botched!rasops_mapchar: no font selected????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?wsfont_unlock: font not lockedbwtwobwtwo/p4model: %s, %d x %d cgtwocgtwoattach: impossible bustype: %s, %dx%d cgthreecgRDImodel: %s, %dx%d cgfour: cgfour/p4, %dx%d cgsixSUNW,cgsixcgsix/p4modelcgsix on mainbus? : %s, %dx%d, rev %d cgeight: cgeight/p4, %dx%dcgfourteen: model%s, %s: expected %x bytes of control registers, got %x %s: expected %d registers, got %d%dMB, %dx%d cgtwelve: %smodeldev_id (%s) %s: %dx%ducoderev, microcode rev. %spninekp9000: expected %d registers, got only %d : bt445 did not attach previously : rev %x, %dx%d btchambt445: id 0x%x, revision 0x%x pnozzp9100: expected %d registers, got only %d : unknown color depth code 0x%x, assuming 8 %s: rev %x, %dx%d, depth %d tcxSUNW,tcxmodel: %s %s: expected %d registers, got %d tcx-8-bit%s: %dx%d, id %d, rev %d, sense %d vigravs10vs11vs12model: %s %s: expected %d registers, got %dVIGRA,vs11, %dx%d agtenPFU,agamodel: model %si128_fb_physaddri128_fb_sizep9100_reg_physaddrffb_depthffb_widthffb_height, %dx%d, depth %d tvtwoPGI,tvtwo: %smodel, revision %s revision%s: old-style boards with %d registers are not supported freqcodehresvres%s: %dx%d zxSUNW,leomodel: %swidthheight, %d x %d %s: zx_cross_wait: timed out mgxSMSI,mgx: %smodel %s: expected %d registers, got %d fb_size %s: expected at least %d bytes of vram, but card only provides %d , %dx%d rfxRasterFLEXRasterFLEX-TV: %s %s: no SBus registers! configuration, unknown %d bytes conf. structure, revision %d, %dx%d %s: lost carrier on UTP port, switching to AUI port %s: lost carrier on AUI port, switching to UTP port sbuslebufferledma: expected 1 interrupt, got %d pri %dbusmaster-regvalif_le: Lance buffer crosses 16MB boundaryUnknown3e/vmeonboardmultibus/vmeieie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s %s: device timeout %s: parity error (ctrl 0x%x @ 0x%02x%04x) %s: receiver not ready ietint: command still busy! %s: send aborted %s: no carrier %s: lost CTS %s: DMA underrun %s: too many collisions %s: receive descriptors out of sync at %d %s: tbuf overflow %s: reset %s: abort commands timed out %s: disable commands timed out %s: TDR command failed %s: transceiver problem %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x ie: bogus buffer calc%s: multicast address setup command failed %s: configure command failed %s: individual address setup command failed xdcxdxddummystrat%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) pri %dxdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s intrxdattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! %s%c: crash dump not supported (yet) xdnfreexdsubwaitxdcmd nfreexdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space xdiorqxdc_submit_iorq addingxdc_submit_iorq wrap upxdc_submit_iorq%s: off-line: %s xdc_reset%s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE xdc_start%s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEAD%s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries] %s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: %d WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout Software fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatal VMEDMA errorVMEbus errorDrive faultedHeader error/cylinderHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test numberACFAIL assertedUnknown errorxycxyxydummystrat%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) pri %d%s: can't alloc IOPB mem in 64K xyc malloc: %s: : doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled] %s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver intrxyattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! %s%c: crash dump not supported (yet) xyc_cmd%s: stole control iopb xyc_startbuf null buf%s: warning: out of DVMA space xyiorqxyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed!xyc_submit_iorq wrap upxyc_submit_iorq%s: off-line: %s xyc_reset%s: soft reset %s: DOUBLE ERROR! %s: soft reset failed! xyc_remove_iorq: controller DEAD%s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries]%s: watchdog timeout Software fatal errorDOUBLE ERRORSuccessful completionInterrupt pendingBusy conflictOperation timeoutHeader not foundHard ECC errorIllegal cylinder addressIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulWrite-protect errorUnimplemented commandDrive not readySector count zeroDrive faultedIllegal sector sizeSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headDisk sequencer errorSeek errorUnknown errorsiswsi_attach: impossible bus type 0x%xsi: dma handle malloc failed pri %d %s: options=%b RESELECTDMA_INTRDMAsi: Set TheSoftC=%p TheRegs=%p si_minphys len = 0x%x. si_intr: DMA conflict si_intr: DMA bus error si_intr: spurious from SBC si_reset_adapter si_dma_alloc: already have DMA handlesi_dma_alloc: misaligned. si_dma_alloc: xlen=0x%xsi: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO si_dma_free: no DMA handlesi_dma_free: free while in progress%s: DMA timeout (while polling) si_dma_poll: done, csr=0x%x si_dma_start: bad pa=0x%lxsi_dma_start: dh=%p, pa=0x%lx, xlen=%d si_dma_start: Fifo_count=0x%x, xlen=0x%x si_dma_start: started, flags=0x%x si_dma_stop: dma not running si: DMA error, csr=0x%x, reset si_dma_stop: resid=0x%x ntrans=0x%x si: fifo count: 0x%x si_dma_stop: excess transfersi_dma_stop: ntrans=0x%x si: Got Left-over bytes! si_dma_start: adjusted up %d bytes %s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d sw: DMA error, csr=0x%x, reset sw: short transfer vm_map_lock_read: intrsafe mapcnopen: recursivefpu_cleanup 1 fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3fpu_addfpu_explodefpu_ftosfpu_implodefpu_rightshift 1fpu_rightshift 2WARNING: matchbyname not valid on sun4!%s /obio/interruptinterruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/countercounterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter propertieskernel has no debugger twas brillig.. vmelvmesx%cc%c%cobiosiswespbootpath_fake: unknown system type %dfdsbuslecdbootpath: /%s%x/%s@%x,%x:%c WARNING: %s map is bogus, using default sd-targetsst-targetscpu_configure: no memreg found!cpu_configure: ROM hasn't mapped memreg!device_typecpuPROM root device type = %s (need CPU)mainbusmainbus not configuredPROM sync command%d%s at %s %saddr 0x%xiono PROM root devicenameproperty lengthreghierarchical%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored address%s "address" %s = %d (need multiple of 4) intrinterrupts%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector HPledphXHP@( virtual-memorypackagesoptionsopenprommemoryinterrupt-enablealiasesauxiliary-iocounter-timereeprommemory-errorhP@ eccmemctlSUNW,sxSUN-4/%d series: %s obio missingfbno options in OPENPROMcould not find %s in OPENPROM audiozsfindzs: unknown zs device %dfindzs: no obio nodeslavefindzs: cannot find zs%dpre_panic: makememarrmakememarrmakememarr: hope version %d PROM is like version 2 makememarr: limited to %d makememarr: cannot find "memory" nodeavailablemakememarr: no memory foundmakememarr: WARNING: lost some memory WARNING: getprop not valid on sun4! %s node 0x%x property %s length %d > %d search_prom: null nodeiommuWARNING: opennode not valid on sun4! %s ' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !PROM exit failedPROM boot failedraidrdstxdsdxyuse one of: %s[a-p]parsediskno memory for mountroot_hook%s%dsetroot: device name too longroot device (default %s%c): swap device root on %s%c can't figure root, hope your kernel is right  %cconfig_attach: device name too longcache enabled cache_enable: can't handle 4M with hw-flush cacheDVMA coherent vm_map_lock_read: intrsafe mapfp align without being the FP owning processstray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%b EC EFSPSETcrazy interruptsAsync registers (mid %d): afsr=%b; afva=0x%x%x SYSERR UNCORR TIMEOUT BUSERRAFONMI: system interrupts: %b fVMEfSBUSbKbSbEbAbSCbTbVIbMIbFbVbMbIbMEbMAnmiintr_establish: level (%d) > block (%d)intr_establish: strange block level: %dintr_establish: level %d interrupt tied to fast vectorintr_establish(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xintr_fasttrap: already handling level %d interruptsintr_fasttrap(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xsetrunqueueremrunqueuevm_map_lock_read: intrsafe mapreal mem = %d startup: no room for tablesstartup: table size inconsistencycpu_startup: cannot allocate VM for bufferscpu_startup: not enough RAM for buffer cacheunable to create DVMA mapunable to allocate from DVMA mapdvmamapunable to allocate extent for dvmaavail mem = %ld using %d buffers containing %d bytes of memory WARNING: not updating battery clock attempting to power down... power-offWARNING: powerdown failed! halted rebooting dumping to dev(%d,%d), at offset %ld blocks dump area unavailable mmu memory @0x%x:%d device bad device not ready area improper i/o error succeeded error %d Frame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p mapdev: zero sizemapiodevcurproc = %p, pid %d no curproc uvm: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace g0 panicw: case 4 w: unknown case %ld w: arg not allowed warning: ldcontrolb called in sun4m vm_map_lock_read: intrsafe mapmmrwmmrw: out of space in kernel_mapvm_map_lock_read: intrsafe mapVA2PA: Asked to translate unmapped VA %ppmap_page_upload: no memory?mmu_reservemon4_4c called on Sun4M machinemmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry typemmu_setup4m_L1: unknown pagetable entry typemmu_setup4m_L2: unknown pagetable entry typemmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry typeme_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptesme_free: no segments in pmapctx_freepv_changepte: pm == NULLpv_changepte: no segmentspv_changepte: pte == NULLpv_syncflags: no segmentspv_unlink0pv_unlinkpv_link_4_4c: allocation failedpv_changepte4m: pmap == NULLpv_changepte: invalid PTE for 0x%lxpv_syncflags4m: no pte pmap: %p, va: 0x%x pv_link4m: allocation failedpmap_bootstrap: unsuitable number of segments (%d) rp->rg_segmap == NULL! pvplL1 pagetableL2/L3 pagetablepmap_release: segment list not emptypmap_release: releasing kernelpmap_rmu: no segmentspmap_rmu: no pagespmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V: ctx %d, va 0x%x, pte 0x%xpmap_protect: last segmentpmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! pmap_page_protect4m: empty vregpmap_page_protect4m: empty vsegpmap_page_protect4m: !TEPTEpmap_enter4_4c: can't fail, but didpmap_enter4m: can't fail, but didpmap_enk4m: can't enter va 0x%lx below KERNBASEkvm_uncache: table entry not ptekvm_uncache !pg_vtrapsvr4 gethrestimesvr4 gethrvtimesvr4 gethrtimesvr4 setpsrsvr4 getpsrsvr4 setccsvr4 getcckgdb exec4.4 syscallsvr4 syscallinteger overflowfix alignrange checkclean windowsflush windowszero dividebreakpointsyscallv8 insn access MMU missv8 data access MMU missv8 store errorv8 idiv by zerov8 data errorv8 cp exceptionv8 unimp flushv8 cp disabledv8 text errorv8 r-reg errorlevel 15 intlevel 14 intlevel 13 intlevel 12 intlevel 11 intlevel 10 intlevel 9 intlevel 8 intlevel 7 intlevel 6 intlevel 5 intlevel 4 intlevel 3 intlevel 2 intlevel 1 intwatchpointtag overflowdata faultfp exceptionalignment faultwindow underflowwindow overflowfp disabledprivileged instructionillegal instructiontext faultasttrap type 0x%x: pc=0x%x npc=0x%x psr=%b EC EFSPSET%s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_INTOF text fault: pc=0x%x ser=%b WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGkernel faultdata fault: pc=0x%x addr=0x%x ser=%b text fault: pc=0x%x sfsr=%b sfva=0x%x CSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWdata fault: pc=0x%x sfva=0x%x sfsr=%b syscall cpcb/ppcbsyscall trapframesyscall nargsvm_map_lock_read: intrsafe mappagemove 2dvma_mapin: null page framedvma_mapout: extent_free failed vmapbufvmapbuf: null page framevunmapbufcpu_fork: curprocsdcddisk label read errordisk label corruptedno disk labelSunOS disk label, bad checksumxboxSUNW,xboxmodel: model %schild-presentfalse: no devices write0-key ranges%s: PROM ranges too large: %d %s at %s  %c  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzOpenBSD3.5RAMDISK#42 @(#)OpenBSD 3.5 (RAMDISK) #42: Mon Mar 29 10:45:50 MST 2004 OpenBSD 3.5 (RAMDISK) #42: Mon Mar 29 10:45:50 MST 2004 deraadt@sparc.openbsd.org:/usr/src/sys/arch/sparc/compile/RAMDISK n sun4c compatible0 0 f8000000 15c6a0 map-pagesn spurlev1lev2lev3lev4lev5lev6lev7lev8lev9clocklev11lev12lev13profd'(4"D1vEHI@HuG-|5wF@ @  0 0   !!!!!!!!x!p!h!`!X   b@ABCDEFGHIJKLMNUOPQYVRTXWZ[9:;<=pqhijk#$%/01 !#$34/0mn*'8235r46463Ѵ3H3ш3ѠH33H3 3$H3Ҹ3H3Ҹ3D83T3lH3T3lD83T3lt833|83383Ӏ3ӘH3Ӏ3ӘD83Ӏ3Ә83(3@t83(3@833D83,3DH3۠3۸H3۠3۸D83۠3۸483۠3۸<833 H33 D833 L833 T833 H33 D833 \833 d833 l833H33D83\3t3ޠ3޸H3ޠ3޸X3ޠ3޸\333H3(3߈3ߠD3ߴ3D303H3x3D<33D<3 3$D<3L3dD<33833D 33D 33D 33D 33D 3 3$D 3L38T#3x3dT#33D 383D 3,#3D 3#343 $3h3TD@Z4+$4+<D 4+$4+<84+$4+<84+$4+<84+$4+<D 4+4+`]4,44,LD 4,4,84,4,84-l4-D 4-l4-84-l4-84-l4-D 4-4. 84-4. 84.|4.84.|4.84/4/D 4/4/D 4/4/D840@40XD 4040D 41P41hD 4141D 42`42xD 4243D 43p43D 4344D 44(XL`44(XP`44(XD 44(X844(X&`44(XD 44P44h844P44h844P44h`]44P44h`]44P44h`]44P44h`]4444da4444da4444da4444da4444e4444`]4444`]4545 2m45p45(`]454584VX4VpD !!!(0||!"H"@"8"(""""!!130 44444444x-Pa55YZLZhZPXpqTFuwPNwRRwCEx4STxNMsxtCLu0PLu0REu@RRwCEx4STxSLqRRwCEx4STxERxCEx4STx`l0\ 8ld$l@lP0`x|<ihj _HlDpp5x`j <ihj l5t@$ ,4Lnative-!@<+ddnative-! +ddCBBX!* p t 'ht&\X25X&$ 0=| ?P o X X[(4d\T\hX n jm b u t8; <4 (X[8XD\UpX xt\}PiiΈ~~ |O3 :d O&XXXXX+$XXX q  H 4XX \g[L] ڐXX4XXXX dlXHT k a  f` XjhXX. brbX XXX~(X X XX֠ss$X   A>PXdHcHXX2jqhLKHLDCdX׼ XXXXXX]@ X XXXXXXXXXXX*XXXŜXXXXXXXPRXXXXXXf\g<eXXXX89:x W pmMH X6FpGT  4D[`/XXXXXXXXXXXXXXXXXXXXXXXҐ\XXXXXHXXXXXXXXX +T \ @[ XXX #4!X"tP+T//QlR  wXXXXXXX ^ _L a` aX D    D   $ PMxMpMhM`MXMHM@M8M0M(M MMMLLLLLLLLLLLLxLpL`LXLPL@L0L LLKKKKKKKKKKpKhK`KPK@K0K KKJJJJJJJJJJJxJhJ`JXJHJ8J(J JJIIIIIIIIIIxIhIPI@I0 0 @8@HHdB@hXXXp8 ?T?|??  nnnnnxnpnhn`nXnPnHn@n8n0n(n nnnnmn@mmmmmmmn mm<d4dLL`Hh$httyclsttyopnttybgttyinttyoutʈD `lۘT000000 y,T(y(yx{4(I(KI(IJPJPpffs=hcd9660Tϰ0Tx2lockf@` 0(  l<h6UWX[\P]Y\ ( 8( HT X h x  0\   8d ( 8 H( XT h x  4`   <h(”8HXhDxlHp0\ 8d@l0`<hDpœ fi00i0\gi(i( i(8gdgHgpgli0i0i00i0`i0i0i(i(i0<hhdhHgiDi(pi(p6U<devopndeviodevwaitdevindevoutdeviocdevclskz0z\k w|zz z8mdpstu,@luzzz0z`zzzzz<phw4HvyDyXpyp6UŘ L20123456789abcdef^^T0#$%&'()*+;,-.;/;0;1B@C= D$E= F$cdeB@LK@B@ Ȥ \xpȤ,2pFMPQlFT,Ӱ-D?9!2`+DƬȔt(ȔpP}UhȔ\8tȔ6@XAƬȔƐDt dX$, }E#(D<8Q @X,,048˴˸˼2(@AAA==(A* d%(i @@@@@@@@@H 7*X7*Lͬͨ@$PdhX$PPPPtm0|xx0\ 8pd<-@lT0` @"#$<h%\%H%'H%D)p*œgp7+pj(\ 8'd(lT<h%\%'H%7+ϸ ... ....T..T/.T/DOpOPSW[]]^^\ФX s v v y 5H x",  ھە (@han   @@haB,C( @@&&/mnthMPZ`Zd@@<@`dT (@haB   @@haB,C( @@=@@<@`dT U@ham@@6x0 (0pLl ~@A @haB@ham:i@ham:i0vA@haC@haH*Q@haH*Q)7ۜ@haC+@haE/q@ham:i8@HPX`hp 3@haG% @haG)'@haG)'*81@haG,@haG3B@haH+ C,@haG6=@haHĴ@haH1 lnd@haH@haHp@haHpx8@ham2b@ham6=@ham6=7 Foyj'!^F+I]Uk ɮn4-/ymڊ2 |Ⱦ(%׮{Iz#09`0nw,wݙVQU-:bm)Fd5c39S,V(Z8eh$B7{KP]pJ%i XW m.V97!iGKO@@nye-ˈM?K{}6;4<>?5 .A .. ftpgzipgunzipgzcat sedgrepegrepfgrepless`morep export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs # emacs-style command line editing rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/sh MODE=upgrade . install.sub resp= while [ -z "$resp" ]; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} if [ ! -b /dev/$resp ]; then echo "Sorry, ${resp} is not a block device." resp= fi done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV > /dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(< /tmp/myname) ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat << __EOT The fstab is configured as follows: $(< /tmp/fstab) For the ${MODE}, filesystems in the fstab will be automatically mounted if the 'noauto' option is absent, and /sbin/mount_ is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs for _dir in /mnt/usr/include /mnt/usr/libdata/perl5/site_perl/*-openbsd; do [[ -d $_dir ]] || continue ( cd $_dir if [[ -d ssl && -L openssl ]]; then rm openssl mv ssl openssl ln -s openssl ssl fi ) done install_sets finish_up  . ..@ bin@ dev etc mntmnt23sbin3 tmpA usrAvarinstbin.profileXupgradeinstall install.sub  install.md#!/bin/sh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while : ; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done < /tmp/fstab.$DISK fi : $(( _i += 1 )) done < /tmp/disklabel.$DISK if [[ $DISK == $ROOTDISK ]]; then if [[ -n $(grep "^$ROOTDEV /$" $FILESYSTEMS) ]]; then echo "The root filesystem will be mounted on $ROOTDEV." else echo "ERROR: Unable to mount the root filesystem on $ROOTDEV." DISK= fi if [[ -n $(grep "^$SWAPDEV" $SWAPLIST) ]]; then echo "$SWAPDEV will be used for swap space." grep -v "^$SWAPDEV" $SWAPLIST > $SWAPLIST.tmp mv $SWAPLIST.tmp $SWAPLIST else echo "ERROR: Unable to use $SWAPDEV for swap space." DISK= fi [[ -n $DISK ]] || echo "You must reconfigure $ROOTDISK." fi [[ ${#_partitions[*]} -gt 0 && -n $DISK ]] || continue _i=0 while : ; do _pp=${_partitions[$_i]} _ps=$(( ${_psizes[$_i]} / 2 )) _mp=${_mount_points[$_i]} ask "Mount point for ${_pp} (size=${_ps}k)? (or 'none' or 'done')" "$_mp" case $resp in "") ;; none) _mp= ;; done) break ;; /*) set -- $(grep " $resp\$" $FILESYSTEMS) _pp=$1 if [[ -z $_pp ]]; then _j=0 for _pp in ${_partitions[*]} ""; do if [[ $_i -ne $_j ]]; then [[ $resp == ${_mount_points[$_j]} ]] && break fi : $(( _j += 1 )) done fi if [[ -n $_pp ]]; then echo "Invalid response: $_pp is already being mounted at $resp." continue fi _mp=$resp ;; *) echo "Invalid response: mount point must be an absolute path!" continue ;; esac _mount_points[$_i]=$_mp : $(( _i += 1)) [ $_i -ge ${#_partitions[*]} ] && _i=0 done _i=0 for _pp in ${_partitions[*]}; do _mp=${_mount_points[$_i]} [ "$_mp" ] && echo "$_pp $_mp" >>$FILESYSTEMS : $(( _i += 1 )) done done cat << __EOT You have configured the following partitions and mount points: $(<$FILESYSTEMS) The next step creates a filesystem on each partition, ERASING existing data. __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "ok, try again later..." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do newfs -q /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >> /tmp/fstab while read _dev; do echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done < $SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp ( cd /tmp; rm -f host* my* resolv.* dhclient.* ) cat > /tmp/hosts << __EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= resp= while [[ -z $resp ]]; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" if [ "$_password" != "$resp" ]; then echo "Passwords do not match, try again." resp= fi done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done < /etc/fstab questions echo -n "Saving configuration files..." ( cd /var/db [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) ( cd /tmp hostname > myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done < hosts > hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host*; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2> /dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up MDTERM=sun MDDISKDEVS='/^sd[0-9] /s/ .*//p;/^x[dy][0-9] /s/ .*//p' ARCH=sparc md_set_term() { } md_installboot() { local _rawdev=/dev/r${1}c _prefix if [ -e /mnt/usr/mdec/boot ]; then _prefix=/mnt/usr/mdec elif [ -e /usr/mdec/boot ]; then _prefix=/usr/mdec else echo No boot block prototypes found, you must run installboot manually. return fi echo Installing boot block... cp ${_prefix}/boot /mnt/boot sync; sync; sync installboot -v /mnt/boot ${_prefix}/bootxx ${_rawdev} } md_checkfordisklabel() { local rval=0 disklabel $1 >/dev/null 2>/tmp/checkfordisklabel if grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 fi >/dev/null 2>&1 rm -f /tmp/checkfordisklabel return $rval } md_prep_disklabel() { local _disk=$1 md_checkfordisklabel $_disk case $? in 2) echo "WARNING: Label on disk $_disk is corrupted. You will be repairing it.\n" ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { } ELF`44 (@@@"@"@3355xfxfxؐvؐvؐ 444OpenBSD㿠@ @D* @ +#@㿘 "#8@ s`'"#Ȑ @, / &@ & J `@  *"J` Ȑc@&*#8@W@j*`:` J " 㿘 ? `     , `2 ?, ??@@??㿘 |`  |  㿘 sc̀  "c@K ,㿘 scЀ  "cЁ㿘@ J 2@@6@@G /  @ s#`"@ 2     `H`@0"@㿘 ?@?`Ŕ㿘 `h`@0" scԤ c)+@P@  O4@0Ғ @@0͒``@ @0Œ @ 㿘@㿈 "a"`!"  # $`%C+)57/-B3@t $@-* @ = 2,`#@-!  L ``@-  ' @-.蔒 #@-   "`@-  €$  $`@"@ $` @@o @```@,ِ "``@,ѐ b C#4D"!"@! D "C#4$%b `@, "` !`@, C"x%b ! a` 2 `@,  #@"]?  2` $ 8`  #@"K?`   `$  a @,r?㿘@@㿘@"a"㿘@z"b㿘@s "b?"b㿘@h t"c㿘!`@\"a 㿘!`@M"a 㿘@:㿘@:ȁ㿈 ,'D)%!B'#1D@"'8  @,%" @, `"`b@+ ` `"&"$D ߐD㿘@/@㿐@9 ?2 b@ 2J c@+͐ `k`m`b". `w . . .  'J`x 4``*2 @y@^ "`c @+  c@+ 㿐 @c0     b@ 2K c@+m  k m b .J w(J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& 2 @! 'J`x 4!`#`*2  @# @@ސ "`c @+  c@+ 㿘"$ a  "@    *a``$   $ @   $`$` 㿘 ?`$)!  !     !!" "  !@Tߒ"@ !!?"`"`%!! "@ "( '`@8"$    +@ `  0 +@`    !`*`!` " "`?"` $   @Th" *!` " "` %` !  !`? "`  !` ? %"`!`` ` $` $`@ ` `!! @ " 㿘!` %!(!` "@ "@T/ b$ `` `   ! "@T" " "㿘"$+a  ??  @? ?,@ a@ <a!   @?*" ?   " " " @Sܔ@$$ $*@` $@|  @ " % a   a@S"@ a  $ 㿘a  +  @ #(a% @ *a @ "a@ "@   `@S``@$`$` `"* "㿘@Hb<@S HbX@S G@Ge#b? 3 t@Ac??&c@@ 㿘!   !@$  $ @$ޔ $  aH@_ @ t#`  `aP@) !  ! $ $ %)a' "& @$! $ !"& @$! $ `$ a`  `@ aH@a! @2a @Ȑ? $a@  $a! "@*"@@  $a "@@ $aa@ aa`$"`$ ` " @  $@!@!  !   @     @#Ĕ !"@S`!,b !`$ @ 8+ *  R + ( @ 9` !x`$ @ 8+ *  R + ( @ %` !``  R@* `` !x``  R@* `` $H@8  @&Z` h aH@b <     a@%     @G ?    L`  & 㿘 )a!"(/1""(` ! -` @Q` @Q`  @  h$ 6. ᠀$2  !H@ !H@)@         @GJ @ @᠀``$` "(@  $`%"(   $ "(@  $ %"( $  $  $ ` %`᠀` `@_&`$`@@ `"`` %``@=F``  @€$`x㿘b C"x@C#4@D= "܀@! !!`!@  " @QD !@Q? !`"`! `@ 㿘! !``!-/+   A# !`  2 `` "@!!` "$` @&a@ ( @&  L` aH@# (  > B; Ť@2   # !  " &   #   !@P"@ !  & ! !X'@7? XbHbH" 'X\"@ '\Вb@ ?XX"\?00"D?00B F?0 ?0 ` d#\@,8< @I'8$@` Ā` "H"P0 @, d,@I%%@ "(  ( "H"P X@,g d,@I%%@\@##\(`@qb BXp d0 ¡,@,G;`@I%%@@  @F"㿘! \ L$ L㿘V@n 㿘a 2   @`    @E ?CAb@/  9 +-ᨔ@   "  &!D?D?  tc ?"c@%̐ !d @%b b@ ᨁ㿐!      @     @E3 ?vt b@Ր   $  '7a@#  c b@Đ    X $ Ta a@  4A6  b@   7 'a@"? b@  D 4a, $ (aa @    b@  D 4a $ a0  D4a $a㿘@5'x'x'x'x'x'x'x'x'x'x'x'x'x'x'x'x'x'x'x'p'x'x'x'x'x'x'x'x'x'x'x'x'x'x'x'x'x'x'@'x'H'x'x'P'x'x'x'x'X ! ''|-I+ )|'5 7 0*  @€    a"@O @A@??X* & @ @2`@M@ |` @ ? '' '| ''|'0@ah   L`-`8@$ ``@ɐ @ 㿘 `x@'"@ސ 㿘@Đ  @ 1' n L  o  @ T = 2*`"@r 2   @2    &*@&`@$J  @ఠ 2L@_㿘@)*+,+,+,+,+,+,+,+,+,+,+,+,+,+,+,+,+,+,+,+,+,+,+,**+,**+,*+,+,+,+,+,+0/J#!%9-;+ u) '*7 $%* @€ $b\$"T $d $"T$b\ '"X %` 'bha8 `@# @!@J@؀?Ӑ? !Xd*@` & bh @Ra@3@8  2@a0@  !@Y@M@ `R' @@H  @i@ @@`=`< @ @2 @@@@ 2-`%a@F@ !"X  @@@h`@T D 2 aa@@D` @@Đ``@  @`  @F 4?a` $ bh @0@@ 㿐@7  @6  @ u ` T@! 㿘 u!8  bP`?  #@3    2bP@ 㿘 N  na@"  N  o "bP ""P % u  @ ɒ , ` @Α*  $8 @ $@ , `$@  @  , 2*@, $@㿘"X` u!8` "`` @7q ., ' D"X @"!x "``@B! T@Ea!!㿐@Ҕ?!@Ɣ0!@’㿘 :  @   ; @>`    ; @;`㿐  @!"\   " ҒG   @ @p@   @h@p- ` @ @\@  @T@p` @ @H@E  @@@p !В@J 'B' D ? !@/ bd )  "' B'􀢠B   B"  ?!@@""@ T㿐"\`"(@E'"0X@"T` "h$'@D'@a"xX@ϔ"d`"@ǐ"@Đ"` !x"T`"$"ئ"@D"X@`n T ` ``" 2'@  ?'#H ‰ F?@D`# ` @6 `@d@` ` `@Z@o` ` @6 `@N@K #\`@F@o #\`  @  @9@6` #` @1@n`#`#l#d#h@6a!a㿘@ @0!`?@@  @  ? 㿘 @@D@Ғ  L`  @f "cP@$   㿘 s# c`@#"@ 㿘! "p D?"p%\F!T@"&;? 4& 0& (&  8@nx  ̘ d & < (#  ; @<  @& d$"@& @nc ,?& Ȑ&& &$ #T@Jl Z@Jh ZDc@Ԕ  㿘+ $bp{$ O?bp 8;#S@2H? L (&B? $*& 4 * &@ (   $@4 ?@`@n$&  & "@ &bp& & &&$ #T@J Z@J ZDc@z  㿘@===<===============================<==<=<========<==<===@=h=t㻀 !''  ;% + u59)7S 8NN* <@€ 'G  C"bxa@l =3J@ 40,@[ ,"bX a@^ @0@F   '"t@:!8  !8@@(@?? aX * &@ `   0bX08䀠 .`? @ e  @ _!8  @ Y@ @I   @H @    @$  " @ @3  aP@   @ D "@!@, bX "@@@G! 0a`@ @ 6@Ԑ '@ap@ @@  @ T @a@ @  a@А  D& `&@@& ) T@m  @S @a@y  @ "  @!8   @@ " @a@b      2`@@E "@@Z 2`@  @l@&&@Z !b@ "(@Ô耢 耢 @Q ?  `L b0@R @@m㿐  @P '%@Aq@'`?@ H  2@㿘 ub\  b\@"   J@ " @y  @ !H'@F&  !`  O !8 @@Obh@  `50 .@>0*(@@H bp@Ґ @ Z @  "t`"b@}Җ  @k!  a@ 'DD <@)&D* &   x* &*& 'D@}"D  6 !.  @}"D . @}"@b@`p @s`  u0.@"@P` H#%# ;@$И@#>&@z`L`b@{`@ 2@  L`"@n@e @&@$@@+ @@^#*  `:  a0" ` @}͐ # @q "t`H@?X "p@9 @  a @<ɐ#(` !'  T #0@} D>bt *    u#HcP8@|  u"\` D#3"\ `-+)@`  2 HcP#X@| ,@`  뀌@`t#P#X@#x #`@|t   4'̒@ꌐ#@|/b@ !#P#X ""##@|#H  @- #P#X@|#H #P#X ##@|r#H  "t#P#X@|b#H  " #P#X@|Q#H  @" #P#X@|A#H  t#P#X#H@|1t 2 @t#P#X #@|t 2 $@t#P#X $#@|t 2 (@t#P#X (#@{t 2 , t#P#X ,#@{֔t 2 0 t#P#X 0#@{t 2 4 t#P#X 4#@{t 2 8 T#P#X 8#@{D`(@ @Ĥ#P#X@}!x 0@@{u%`H@a 5t  ! l 2 p t#P#X l P p`@{P ht  t#P#X p@{<쀤`@( t  ! l 2 p t#P#X l P p`@{ ht  t" x#P#X p@{ x " x#P#X#H@z x " x#P#X#H@z x " x#P#X#H@zД x " x#P#X#H@z x m#P#X#H@z^`@ 8! l  #P#X#H@z l " l#P#X#H@z l 1#P#X#H@zr"@^`؀ t !!@zb   #P#X#H@zQ "@zH @9!㿐@.  @6  @   @ T `@! 㿘 u"X  bp`?  #@ؔ    2bp@ 㿘 N  na@  N  o "bp ""p % u  @n , ` @s*  $X @ $@ , `$@  @W , 2*@, $@㿘 L@ @<ʐ@<ǐ @J  @ @e0@@c㿐'@! 1  -, , & @ =   , *& , & & @."H 2J&@㿘 a(`ᐘ!a@|"@d 㿘 @Kb  @a 2( @ "" @:   @4a耢 2 `@- 2 @i!  "(@b  㿘@  @ 1' n L  o  @ = 2*`"@ 2   @2    &*@&bX@  @P 2L@㿘@㿘@a  㿘@W_ta a a a a a a a a a a a a a a a a a a a a a ]a a a a a a a a ]a _a a a `L\$\\\[\\\\\\\\\\\\\\\[P[[\[\[[\\\\\\\\[\4[\\\[\㻈 a" 'D'H'@1 ?D`4@@/"Ȱ 2"@'"! $!"$!@H! $! @: @;h# v!@ '3% )^+ -hJ / D  'J /D@HfD`+`V!T*` € v ! "!@֔  "aJ !c@ GDc @  v >"` v :"` 7! v4" La"0,acH @  v("  v $"a! !@  v"!J`!cx@ Dc@  v "` v "`@%Db@JH??XD" 'DH*` 'HLa` c@c @A(#x #x @A" #x@A   @A @Tb@5h0@WD  aH 'D'H#" a?* : `&V *` €@@  @H @@ ! `# v ` !@c@2@  @`  !@~`!`|#@  @ @ l ` !@k`8@ @  `  !@_`P!`|#@ b @ @ @ @  v 쀢``  !@E`pd#(@ I @@@ %@ t@ @ @ @ [@-@ F @͐ D??O'D3_H$@'H@!X @ `$D??'D8@ @ # @ D??'D# v3_H$@'H@!4  ` @ɐ@ `D??'D@ @ 5@C  v 쀢`@  @6Y  㿘! s# #`@b#`@b#a@b#aX@b#b@a@ 㿘@`iL -e`@ *   &@@9@   @\  $L  `< -1*:  f"  s b0!  L@!@9i@` $ @0 * *@`  2 -   - L  "$- $  @$: ?&gkkkkjkkkkkkkkkkkkkkkkkkkkkkkkkkkkekf$fg<kkgkkkhkkkhiHkjkkijXihv|vdvlv<v|v<vlv<vv<v\v<vdv<vt  !g^ag^bh @''''''"P'''@$@&F#    v''@b v v"!"a  "c$$@z?* : `9aX#*` €@8@^bX R @  v `"_@y_@ @8@?b` 3 @ǐ "@   "bh@v@$@8g@b  @  `  _ "b@T}`@ W@w@8D@b  @ @ @   v 쀢`" v@  v["! @8)@ޒb  !#%')+-/13`㈞㠠#Ȣc@ h`Ȱ a #\#`#d;h;p;x;;"b# @c@ @7@墒a(  @<@7ݐ@咒a0  O  "@Ғa8"a@@˔@7 aH@7aP@m 2a f @7@`aX T ! v  "@a`$  ax@" `$ @7@Aa 5 @  @7}@2a & @@7n@#a  ! v 쀢  "@ba$  a@[" `$  "a@Qz!@ @3Ր"㻐 !`' 4` v!`H+) '% s# Mb aȠ"@(@4a$@eba` a ` aH@9@7 bb~J  2 *`J@ " "*`@}b'`4J@ 2%@$h@nbJ@ 2%%Mb /b @ $@@`@ @\Ӗ` 6*`! `4b("@–???" 2"@b8`"@bH `"@b``"@bx`` '@'```$" `*@ ``'``@`['@ @3"㿘NN "  " N C @ "?.@! %#*`:  \ ' N  "@]# "" .@ ` N*:  N`@`2.@N  *:"@<b?N   2ʑ*`.@㿘#@bȀ  !"@ה  2Nb؀ /2"ВbȐ@9@4@L`/ . L /   /`/ L /`/L  .?N /".L :# LL / 2 $  N . $?@"@$ 2Lb@{  2L?@` (?N / "@ؐL ˠ 㻀 ! '@ .  v`쀢    !2`J `:   v`    @  2 @@5z @5wW"  @Q@.@5k'7- @ H 2`@ .`@*  @\b @  2@#c @M(@$ #757/    a2J :@ `) 2- " @Ȁ @ -  # 0@$0  @@<` `@  `@ A` ^@cP@ `@{V @|`"  -  @ ?: @ܒcP@ ! @1_#X㿘@&@ `&J   v ? 2 ^8*J   v`" 6 !2`J `:   ^@ ݐ "    * . ` `Y h*` € "ch@   @  =  # %@ @  / . 㿈.`* @' '' @*T &L  'L  ' *2 2 v   '@r  ' Q@r " @@q  ' .`"@^* @ v*`@  ' @ @ `@ 4  `L ?"`` * $@-   4  @ -L ?`&`@  * $ @   4 - @cP T   %`?`$``@ * $@?2`&耤{ 㿘% v# v! ` `쀢 !2J :@ ` @]   1&" ".   @0q 0 㿘@  v 쀢`  v !2`J `:   v `  ?@   6` 㿘 @`㿘 v J! i `L#`"#@  @# 2$`L@X6 HXX㿘 ! v 2K @ :  v `!   ! `@!!`@( a  ! v`2'K@ @ :@ `` v 쀢`@ !`(@Δ:  v vJ!`i v v `- v `@ d@_@@ r " @ G@z  @ b@   4  @/ H㿘 a v 6`J `@ : @   J ? `2@  㿘# v`  !@b`P@ &  %- `  !@U`p' %  `,? 2 J@ :  J@ : "@@ f 2  @9@ /` a,2J :@ `&+ v) '#`쀢 " L @ !@L  @ސ@ 8  @@  c$ $c  `@ 㿘 a2 J : @ .  @  @ 2 @   `@2`     v@@   쀢` @ ^ !@`@ ?   L2    L    ^#,  € v` 4̀ @[@ @@ J@` v` 4`@  4 2L@ @@ ֒ v` 4  @ "`@N 0@ ` v` 4`@@E !|a !@@ X@@` v` 4`@@# !Za 4 v` |4@|C`@a(0nL ` ' v#L @aH@@ 2L@@T2@@' vؒ$ "ؔ@ 4`:@:@ !`ؔ@0* v 쀢`& @& !ap@  "a@0@ "a@0@ !@.㿘!#a@ ,#b@ b@ b@ b @ `㿘 v ` !@]b0 !  5+ @ * L` &?a2J :@ `` #' v% T  2 쀢 @Ր@1bP@@U  2T  #؀`*` "#` +) v' %L  2 T  @bp 쀢 @@P@͐@'  2L ` `2`㿘 v ` !@b)ؤ   "  @w$@@@ 2 #؀  #@wb 㿘 vJ!`R  v `3 v !@b0 ` !@b! v! @@"  a @ba  ; 975@@  !)' %@P #@"@" @~  @4 `@ @  #8@mb@!a @- 2 @X  2 @p  @!  ?4 @@   4 a  @,@a  @ 㿘 v ` !@0c  !* @ W @@@  a@@@@j+ v  @ 9, @@  @|) @ a !@ @a @@a @"@@1/ -@ @r @r @ΐ  @F4  @ @@@ @U @U@ - a 4 @F<㻐 ! '@g! v )  " !@c " @/@ 42  !@~c! 3a@= )  &!  @ @$L` @@Q   @@I   ?4   2 ! a @*ϐ#ȁ㿘 v ` !@5c ! @ @ `% L  ?`4  ?4 T  @Ȓ  2 @ 㿘@K    "@`  @ǐ2  2  2L  0@L   @`H㾈 v  `' !@ ֒`   va a$ @r! vJa r  R `Ȕ$@:a@vaa*@!?  `@ ú  "c?@$ v`@h  35 w!$@:!L`r `R `Ȕ$@!@@!!*@!? `@ À   "c?@# wa@4    / % ///7'/-37 x#/9)e's 8 $ . <  c@c@a &c@/X @@y  @ϐ!h  @ @ ܐ#@@c " $ ! @)!㿘 !`<@ @ @   @   㻈 !'@ ƀ iᜐƀ  b$@d8$!#@ @#  a@   @# "a@   a@   @# "a@ @# %- +, @$ b@ $0  $@#@G@gc@c  @) "(㻈 !'$@픒O'쀢 /  % 'J / @ "  8@ "J@  @(Ր"@㿘@ސ   @ @,3@c "   @ 0 㾈 v  a ' q! @@q *b!@_!+ ) 75/-a0 P@ !4`"   a0 ",  , ,   c$ "  @4  v   ? @:) v`  !@ ϒX   !@ ƒp   ?    !@  b@ !@ @ @@a0! @(."㿘 ! x ! ? @d6 % x#   $"@  Ða0#2 @I$$!!a0@ @(~ ! $!$ 㿘 x! ! # x`! a!0#$" 3 @* @h#"c$a㿘 @1!`&@ .` @n@+J ` `6`.`㿘@@@ | "b@ 9|  ;   @'P c&  @kڔ$& 㿘# v% ) -+'  2  @kǔ$  $ `쀢 )@ 4   @` $   $"  @ `쀢 @ c0 $  `2  @8 2 ! `쀢 " cX@ ڐ 㿘@  @j   v@!  0 㿘@!4@i㿘  @&Ԗ   "@ @㿘@ ?" @'$ "" @! p v ` !@ c vJ! r R ! w  !! wa!@ &$L! # !@# #@οb0`c@U 2 @W#! `@ `""@ \c0K ?4 9@ТM! i x``-  ` @ ?%4`Ѐ `@ `@Ґ 8@А@C0@jƐ@Cq@d` 4`  $@\v € @@ X@㻐 !'@  x@&@>! 6`@ B !# #@Vw@` `2# a79+ v/ -5d$@j?2 a @a @  2|@l?2 | a@ (@ `ۀd@ ,@ * a @&9!0㿘@B   p @0  !@3!@!##@c_* %&#@cX* $& `& `'`'@gM#'`#`@gG'`t''`d@7`p'' @- $㿘!#@c.#*  "    2  㿘@  wJa #a@f  vJa #a@f 㿘  !  #@bc*  "    2  㿘  ! *!@#@bېc* &` v&` "쀢 ` ` !`2` @!` `2`㿘  ! *!@#@bc* ``2` ` "` "` `2`!@e㻐 ! ' "3 N / @  *@ N` / @ **@@ " *@ " @n 2  "  N    2N  @%"㿘@m /  , / ,  N  "@㿘İ# <@ (  / `&@%Q ?.  @ `"0@ݒ㿘 xa(  "a(&& & & & & & &  &  @. $ 2@"H.   /`ې  "p@@Ȑ&@(. &  0)@m*@ @'&. &  & $  2& @"&  & $ `  @}"㿘V  b@N  2   b@t  c@m  '# x c @`   `0`   $  c8@D@6@oa(& $a(㿘 2 cH@1 " @&  & $ @l / @P@-&@'j. @ @@   ?6 㿘 `2 "`` `2` "``@ c`㿘 @ߐ#@':Ē ?#   " @ ? @ʐ# @L㿘@'Đ ?c &" H v `  !@c v!`c@ 2  @##@  a ?  4 -  $   @   aa E  <$@ $` $` $`  $` $` $` $` $@$`   `  $`  ?`` $`  "  $`  "  $` " $`  $ @b  2a  !#,@ 2 ''  @F # ! ' '!'a '!''Ȓ ' @- `@@S  @ @ v ` !@P`P  a@d͒ "c@, Ā "c@ ܐ p    2 @s 6 @  @ Œ@ߒx  @  @  @, 2@  @f ؐ@f  6  v@! !(@  vJ!`R`r% ! 耢 "!h!paP@s  v     +!("! "a@@@ m!xܑ*"@  Ą "! ""cܞ  㐕( `*` * @" #㐖`$/* @*` @ " "+  * @"`*` * @"`*` * @" `*` * @" $*ԠԄԸԄPp֐4D㿘 ! v` "@G  @C  !`# $a@ɒ : ! x$!@@’ :.!@@   '@+ a@ !'!@ $a%!@!@" $a"@  xa4 "a4 @>$㿘# xaD "!! @@. $ b @ $aD8 v`  !@bH x!@`  @ t  x"a0# x x!4` x"!0 @  x"a0a0  vbp@  @"a  !a4`  " v 䀢`2 @ @! a4 x v `?8`$ #` 8@ 耢 bx@,  "@ba49 7 /% x) v- +; 3s1s*5  v  `:"k:"l"` #  ! 9 7 /% x) v- +; 3s1s5 R!ސ"  "` v`  vJ!`t@  &'! @g~ b@ #$$,?@($,, " b@Ő  b@ @  쀢   !@"c@ #8@ cX@ ` *  `% !@ cx `@*2` %`@ #` "a,a `0,` @ \ "c@|  `@*e2` %`@ #` \,` &@`0 a4  @ *@㷀 !'D'  x" "a< xa4  D @ Z# v! `0 9 v' xa4  v@ J R r J!(`  D''耤j! 35 ;`  #\`  H`p@7 /'1  @{`@䛔$ 7 -/1  )'`-@@  @d@䄔$  `@Y "! O !@N@ !$@䋐!` ! ` @' @ű @5a `!  *@"@u! aH@!"a`@" a@"@ y"' @Q$  ` @ @" ?L@ ",@a@̐ O@  @ $ x!@` @ j  x@   x"a0a0a@Ԕ "'! @'!  !`"@(  v 쀢`  !@c "@a'! !  "a  !@ ! ! @ @O! b@"@G"b(@'!   * @! v#  쀢 " x!8 l!@yb8 9# h 5耢ll x ,"!8@p? a&J ! x!8a " ? "" "b`@F? # @K?aJ ` ! ' @ А"" % x # h   @,? @{a@a<  $< @   @"㿘 x!<` ! !J `  !"@^ْb !a<c!$! " * " $a< @i 㿐 v!# v!  x!4` xc@] !@7`'@ + 0  xa0 @ɒa @}#@㿘 @e! cP @  a` @U`#pa@c`!Lc8 ! bc"bc8@b"c@b㿈 a  - "a  ' @_K#' #'@_E '< @ { d(@"v v40@ @$ @"? t0 @ @  c@E"0 v ` !c@:0 v ` vo "  #@ƒ0 ` !`@  pr!s#*`@$  쀢  v ` !` @ @  @d1  v ` !`P@ v!`Ua ,`(2 @] 6 k pp @9t@al@:@tW v ` !`@ v!`*,2 @  6 C p @9t@aD@9@L/ v ` !`@ v!`@9 0&&@͔!! $   p@]=t, @2` @ ڒrrc\@*#@ @Zޒ0 @|]@ 㿘 !@ !  㿘 s  *(@?c  !?a'a`,'' 'D'H` `   !?c!' 2 @Ȑ  :"l@@  xa<   x@    x< "< !  6z! #??#नccc`cM %c*` `'@ x!, : @1c $ ?*   D€ '0  c $ *   ?*  D€ 'c ŀd $ H€<'`ࠠ  !  L " @  !  c! @! ??#`! u v 쀢`  !` !@za? $   *` ?@ #D€ @/! x"!< !@ @!H㿘 v!``@b?  !`!aP@{ 㿘`>`  @[ ?   !`!a@z 㿘`d "` !a@   @ܕ$㿘 !a@ 㿘! @  @$ 㿘@"`"`㿘 `    + &`  !+/ x - x`  "?$ %  * @ `@|  x`0@@_t4  @4   v 쀢` !@b% 4  4#  * 4 $@`Ǥ#  v ` !b8@ #: % [! b`@{" J ```""@ibx v"@cb v"@\b v"@Ub v `2 @"؀ @2  * `@$ڔ@`@p 2  xa0<   @S ? 8 `? b@y (  v ` !@c4   va %  @"a 0# * @``@$ `&`$@ x8 `""8㿘 !ਐ "$ x!@"`!@*`   xa0!@^* cH@y  vcX @P$ : $!`"  !@c㿘 x!0  x!@`@L@ 㻐 v   `', :"l@@f 2 ! !0   v ` !@c $!0@Ɛ F !0`E#@ A (w $@$!: :&& & & &  & & & 6 6 "& & D> (H& HL& 8& 0& @P & T@?!"k@2e @ "l^ &  (B?  !#  <  !    @Y# $  " (  > (`*`l" €  & *  :> (#x   "a4&  @  a4  v $ && &  v 쀢`" @   @\ (㿘   x !4` X `! `0@"#|`h@"a@"c xo"!H!Hc %'C!?`,) l"*` €! `@"! `@"! aH`@"! aH`@y"! `@r" `?  a @c""@_a    "  2   @6   J 2 `@ &J  $$ $$aH㻐 a  #'"  *` "`"`' x :"l@L $L%  $L{ L @L?`>*`l" €  %  L@ "   &L@! x $!LR !L @!L! "  "  !!"`!8%!!P %!@q!h !@l! " L "@’aa$L @G!ȁ㿘 !0!`  ?@  R@} ?@R!ހ@   a a "@aذ 㿘 'H'L'P'T'X"@UH   * *    *  * * *  㿘 7 h"` s 9%` 0!*`  "` w l`0 `0* ?В  "  " Đ`" @    ΐ 㿘'D"DD㿘@ߕ /  L@*`: /2`,@N 2   ͐@y  4 ,@`L@  @㻐#  a` 'bH@  6 $@ @@&. z@,a @]"h㿘  '#%  2  2 bx@d b@Y$㿘 v!` v@  v"@v0  ` !b@㿘N  b@4% v!` v@ !   v `@6 "@vc0  ` !b@h㿘N  b@   c@ ` 6  v!`  v@3  v"@v30  ` !c0@8㿘N  c@@ې ` 6  v!`  v@V  v"@v 0  ` !cX@㿘 v!`% v@Tu 6 v#h v!` v@W   v#@uْ #@  `## !cЖ@И 㿘 v!` v8@V  v@u    ` !` @ 㿘N  `8@S ` @6  v!`  v@  v P@u0  ` !`p@㿘 ! C  !J` !` !  㿘 , " ?J` "?` ? 㿘! `@N"`@G" `@?"  "  `@4b  "  `@)b  "  `@b " N a@bN  2!0!8a @b a@@b@@!X㿘!  ah@$,   ap@f$  a@^$  a@V$  a@N$  a@F$  @a@>$`㿘C     ?!2`J `:  "a@㿘 ")% !ؔ@@`? "`@ @  "@#   ` " `    a? "@ǐ  y nΒ!ؐ y`?㿘 'H'L'P'T'X"@)H v` !耢  ! @8@0 㿘@< @! $ @[y$ yc@ @   86 㿘b@@ 㿐 x!T`! x"`@Βbh %!Tbp@ @1@m $!Xb@ !X@@ 2 b@sƐ ` @n @  ,@N 2 @Ր $!T " @^! $ @ 5 a<* ''('! x<'$ `?c@  `?c@v $'`  @n `!\  @h 㿘N # *`: bl @ `  2  _ - @s   N  㾐# a'!И@ x "aP@a @"؁㿘! x!P "@ْb$!Pp !' @"@Œ   " L?@# `@W& 4@ @@` @#p% ' @@ !  @Z@ @Z<@# @#p# a' @@ `@Za @m#(㿘 `@Z 㿘@k#@# a'8 P@l@E#@a @D#H㿘 x!P` cX@/#P   ad@`,`7 !d㾐 !'  ?`!@4#h@ a @ #p㿘@t @Y@lF @p !'@I OЀ E F AА@?$#@ĐO F"`L x"!P?@<@J@ "*@#  @Ѱa @#㿐 ` @VҒ O O㿘`* :`` ,, ` #u, qא 㿘@㿘@@㿀'|`'  @ 2a @ 2] `&` 2 N!@q@NN u2 Nb@ܔ "  N <2  b@܉  `( 4*@  @< `" @q@#J`"8@q@ `(* N ^N `(`? `-   * `(*  &`  㿘 bh@ b@ 㿘 " @RG ` `%   @ @R:  2 @ @"@R,㿐'H@ٷ : 'HȐ H+ 'H/-@٩ = 2,@,@`@CtN@ c c@ 2N@s&  i2 N@c@ 2N@f& i2N@c@ې 2 N@c@CKU& $ l2 N@c @ʐ 2N@H& o2 N@c(@۽ 2N@;&  oc0@۰  c@C *& ( `  ' N@J@2  @ۗ 2  ? @C  , 2 H5H  H@w@ N@ i㿘@k@㿈@L@ -2&` &`` x}b"' @, 2 # 2  ` #@p@  "  & &` @py@ @ 㿘   D@u 㿘  " $@0 " `  & & & & $㿘@  & 6 F $  ߆C w   " * +* -* 0" $"    " * +* -㿘   D@7 㿐    ``'@   '``@  & 㿘 @n @ &  @$**@"" "$@$   """$ "     " "  " 㿘 @5 @v & 㿘  @0 @>  ?` # & & 㿘@  & 6 D   $g`  ˒  " " " " $" 㿘 F 8@Pf D㿘@B @P] @㿐 `'@z `H@o4 㿘@m`n `X@o' 㿘@``o `h@o 㿘`x `x @ 2    ` *@&`   &` U&`  2"䀢`" @ 2    `*@&`  &` ;&` 2!`! @ 2    `$*@&`$  &` !&`$ 2"`" @ɐ 2    `*@&`  &` &` 2  !'' "" "@O#@O#@O# @O##@O@u@s  @O @O`@@O} 0" @Ov H @ P! 4  X `@@  4  ` `@@$ 4  h `@@  4  p `@@  4  x `@@  4  `@~@  @t@  4  `@i@ @ 4  `@^@  4  `@S@"  . install.md set_term() { [[ -n $TERM ]] && return ask "Terminal type?" ${MDTERM:-vt220} TERM=$resp export TERM md_set_term } welcome() { local _q cat << __EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD in a simple and rational way. At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C and then RETURN, but quitting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat << __EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat << __EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat << __EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat << __EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat << __EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it..." } get_dkdevs() { bsort `sed -ne "${MDDISKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}" /var/run/dmesg.boot` } get_cddevs() { bsort `sed -ne "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}" /var/run/dmesg.boot` } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while : ; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while : ; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _devs=$3 _defdev=$4 _err=$5 set -- $_devs if [[ $# -lt 1 ]]; then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_defdev:=$1} _devs="$*" while : ; do ask "Available ${_name}s are: ${_devs}.\nWhich one ${_query}? (or 'done')" "$_defdev" [[ $resp == done ]] && break if isin "$resp" $_devs; then makedev $resp && break else echo "'$resp' is not a valid choice." fi done } isin() { local _a=$1 _b shift for _b; do [ "$_a" = "$_b" ] && return 0 done return 1 } addel() { local _a=$1 _b _seen=false shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [ "$_a" != "$_b" ] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file > /tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >> /tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" << __EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 _node=/dev/r${1}c if isin $_dev $IFDEVS || [[ -c $_node ]] ; then return 0 fi if [[ ! -r /dev/MAKEDEV ]] ; then echo "No /dev/MAKEDEV. Can't create device nodes for ${_dev}." return 1 fi (cd /dev; sh MAKEDEV $_dev) [[ -c $_node ]] || return 1 DEVSMADE=`addel $_dev $DEVSMADE` } addhostent() { sed "/ $2\$/d" /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2" >> /tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action while : ; do _action= cat << __EOT The following sets are available. Enter a filename, 'all' to select all the sets, or 'done'. You may de-select a set by prepending a '-' to its name. __EOT _next= for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "\nFile name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_all_interfaces() { local _IFDEVS=$IFDEVS _ifs while : ; do _IFDEVS=`rmel "$_ifs" $_IFDEVS` ask_which "interface" "do you wish to initialize" "$_IFDEVS" "" \ "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp configure_ifs $_ifs || _ifs= done } inet_info() { ifconfig $1 inet | sed -n ' 1s/.* /etc/dhclient.conf if [[ -n $_hostname ]]; then echo "send host-name \"$_hostname\";" >> /etc/dhclient.conf echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >> /etc/dhclient.conf << __EOT request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT cat >> /etc/resolv.conf.tail << __EOT lookup file bind __EOT dhclient $_ifs set -- $(inet_info $_ifs) if [[ $1 == UP && $2 == "0.0.0.0" ]]; then ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 fi mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 } configure_ifs() { local _ifs=$1 _addr _mask _name _prompt _media _config set -- $(inet_info $_ifs) [[ $1 == UP ]] && ifconfig $_ifs delete down [[ -n $2 && $2 != "0.0.0.0" ]] && { _addr=$2; _mask=$3; } ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat << __EOT The default media for $_ifs is $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the default media?" case $resp in y) cat << __EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media down || return 1 ;; n) _media= ;; esac fi _prompt="IP address for ${_ifs}?" [[ -x /sbin/dhclient ]] && _prompt="$_prompt (or 'dhcp')" ask_until "$_prompt" "$_addr" case $resp in dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not supported - no /sbin/dhclient found." return 1 fi dhcp_request $_ifs "$_name" || dhcp_request $_ifs || return 1 _config="dhcp NONE NONE" _addr=127.0.0.1 ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" _mask=$resp ifconfig $_ifs inet $_addr netmask $_mask $_media up || return 1 _config="inet $_addr $_mask" ;; esac echo "$_config NONE $_media" > /tmp/hostname.$_ifs addhostent $_addr $_name return 0 } isalphanumeric() { local _n=$1 while [[ ${#_n} -ne 0 ]]; do case $_n in [A-Za-z0-9]*) ;; *) return 1;; esac _n=${_n#?} done return 0 } enable_network() { local _netfile for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done DIDNET=y ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} if ! isalphanumeric "$if"; then continue fi ifconfig $if > /dev/null 2>&1 if [ $? -ne 0 ]; then continue fi while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|""|"rtsol") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= ifconfig $if $name $mask $bcaddr $ext1 $ext2 down cmd="dhclient $if" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) continue ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $(< /mnt/etc/mygate) fi route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat << __EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd donetconfig ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" "${_get_server_list:-yes}" _get_server_list=$resp if [[ $_get_server_list == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while : ; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp _passwd=root@`hostname` if [[ $_ftp_server_login != anonymous ]]; then resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _mp=$1 _dir=$2 while : ; do ask_until "Pathname to the sets? (or 'done')" "$_dir" case $resp in done) return ;; *) [[ -d $_mp/$resp ]] && { _dir=$_mp/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." ;; esac done install_files "file://$_dir" "`ls -l $_dir`" } install_cdrom() { local _drive _part _fstype _directory _n ask_which "CD-ROM" "contains the ${MODE} media" "$CDDEVS" [[ $resp == done ]] && return _drive=$resp _n=0 until disklabel $_drive >/tmp/label.$_drive 2>&1; do if egrep -q '(Input/output error)|(sector size 0)' /tmp/label.$_drive; then _n=$(( $_n + 1 )) if [ _n -le 5 ]; then echo "I/O error accessing $_drive; retrying" sleep 10 else echo "Cannot access $_drive." return fi else break fi done echo if grep -q '^ *c: .*ISO9660' /tmp/label.$_drive; then _fstype=cd9660 _part=c else resp= while [ -z "$resp" ] ; do ask "CD-ROM partition to mount? (normally 'c')" c case $resp in [a-p]) _part=$resp ;; *) echo "Invalid response: $resp" resp= ;; esac done cat << __EOT Two CD-ROM filesystem types are currently supported by this program: cd9660 ISO-9660 ffs Berkeley Fast Filesystem __EOT resp= while [ -z "$resp" ] ; do ask "Which filesystem type?" cd9660 case $resp in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: '$resp'" resp= ;; esac done fi rm -f /tmp/label.$_drive if ! mount -t ${_fstype} -o ro /dev/${_drive}${_part} /mnt2 ; then echo "Cannot mount CD-ROM drive." return fi install_mounted_fs /mnt2 "$SETDIR" umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { local _drive _def_partition _partition_range _partition local _fstype _fsopts ask_which "disk" "contains the ${MODE} sets" "$DKDEVS" [[ $resp == done ]] && return 1 _drive=$resp cat << __EOT The following partitions have been found on $_drive: __EOT disklabel $_drive 2>/dev/null | grep '^ .:' echo _likely_partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/swap/s/.*//' -e '/unused/s/.*//' \ -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _def_partition=`echo $_likely_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then _def_partition=`echo $_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then echo "There are no usable partitions on that disk" return 1 fi fi resp= while [ -z "$resp" ]; do ask "Partition?" "$_def_partition" case $resp in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp= ;; esac done cat << __EOT The following filesystem types are supported: default (deduced from the disklabel) ffs $MDFSTYPE __EOT resp= while [ -z "$resp" ]; do ask "Which filesystem type?" default case $resp in default) ;; ffs) _fstype="-t ffs" _fsopts=async ;; $MDFSTYPE) _fstype="-t $resp" _fsopts=$MDFSOPTS ;; *) echo "Invalid response: $resp" resp= ;; esac done if ! mount $_fstype -o ro,$_fsopts /dev/${_drive}${_partition} /mnt2; then echo "Cannot mount disk." return 1 fi return 0 } install_disk() { if mount_a_disk; then install_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 fi } install_nfs() { if [ ! -f /sbin/mount_nfs ]; then echo "/sbin/mount_nfs not found. Cannot mount NFS filesystems." return fi donetconfig ask_until "Server IP address or hostname?" "$_nfs_server_ip" _nfs_server_ip=$resp ask_until "Filesystem on server to mount?" "$_nfs_server_path" _nfs_server_path=$resp _nfs_tcp= ask_yn "Use TCP transport? (only works with capable NFS server)" [[ $resp == y ]] && _nfs_tcp=-T if ! mount_nfs $_nfs_tcp -o ro ${_nfs_server_ip}:${_nfs_server_path} /mnt2 ; then echo "Cannot mount NFS server." return fi install_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd cat << __EOT The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __EOT ask_until "Name of tape device?" "${TAPE##*/}" TAPE=/dev/${resp##*/} if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." return fi export TAPE echo -n "Rewinding ${TAPE} (mt rewind)..." if ! mt rewind ; then echo "FAILED." return fi echo "done." resp= while [ -z "$resp" ]; do ask "File number?" case $resp in [1-9]*) _nskip=$(( $resp - 1 )) ;; *) echo "Invalid file number ${resp}." resp= ;; esac done if [ $_nskip -ne 0 ]; then echo -n "Skipping to source file (mt fsf ${_nskip})..." if ! mt fsf $_nskip ; then echo "FAILED. Could not skip $_nskip files." return fi echo "done." fi cat << __EOT There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __EOT resp= while [ -z "$resp" ]; do ask "Which way is it?" 1 case $resp in 1) _xcmd="tar zxvphf -" ;; 2) _xcmd="tar xvphf -" ;; *) echo "Invalid response: $resp." resp= ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while : ; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" if [[ $resp == ? ]]; then ls -F $_zonepath else _zonepath=$_zonepath/$resp fi done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _insane if [[ ! -s /mnt/bsd ]]; then _insane=y DEFAULTSETS=$(addel bsd $DEFAULTSETS) cat << __EOT +*** 'bsd' must be (re)installed: no kernel found. __EOT fi if [[ ! -d /mnt/sbin || ! -d /mnt/dev ]]; then _insane=y DEFAULTSETS=$(addel base${VERSION}.tgz $DEFAULTSETS) cat << __EOT +*** 'base${VERSION}.tgz' must be (re)installed: /sbin or /dev is missing. __EOT fi if [[ ! -s /mnt/etc/rc ]]; then _insane=y DEFAULTSETS=$(addel etc${VERSION}.tgz $DEFAULTSETS) cat << __EOT +*** 'etc${VERSION}.tgz' must be (re)installed: /etc/rc is missing. __EOT fi [[ -n $_insane ]] && return 1 return 0 } install_sets() { cat << __EOT You will now specify the location and names of the ${MODE} sets you want to load. You will be able to repeat this step until all of your sets have been successfully loaded. If you are not sure what sets to ${MODE}, refer to the installation notes for details on the contents of each. __EOT while : ; do cat << __EOT Sets can be located on a (m)ounted filesystem; a (c)drom, (d)isk or (t)ape device; or a (f)tp, (n)fs or (h)ttp server. __EOT ask "Where are the ${MODE} sets? (or 'done')" case $resp in done) sane_install && return ;; c*|C*) install_cdrom ;; d*|D*) install_disk ;; f*|F*) install_url ftp ;; h*|H*) install_url http ;; m*|M*) install_mounted_fs /mnt ;; n*|N*) install_nfs ;; t*|T*) install_tape ;; *) ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done < /tmp/fstab > /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat << __EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the ${MODE}. __EOT exit fi done < /etc/fstab } check_fs() { local _dev _mp _fstype _rest _fail echo "Checking non-root filesystems..." while read _dev _mp _fstype _rest; do [ "$_dev" != /dev/"$ROOTDEV" ] || continue [ -f "/sbin/fsck_$_fstype" ] || continue _rest=${_dev#/dev/} makedev ${_rest%[a-p]} || continue echo -n "fsck -p ${_dev}..." if ! fsck -fp ${_dev} > /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done < /etc/fstab echo "...done." [ "$_fail" ] && exit } get_fqdn() { local _dn _dn=$(hostname) _dn=${_dn#$(hostname -s)} _dn=${_dn#.} echo "${_dn:=my.domain}" } donetconfig() { local _dn _ns _dr [[ -n $DIDNET ]] && return DIDNET=y configure_all_interfaces if [ -f /tmp/resolv.conf.shadow ]; then mv /tmp/resolv.conf.shadow /tmp/resolv.conf _ns=$(sed -ne '/^nameserver /s///p' /tmp/resolv.conf) _dn=$(sed -n \ -e '/^domain[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '/^search[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '${g;p;}' /tmp/resolv.conf) fi ask "DNS domain name? (e.g. 'bar.com')" "${_dn:=$(get_fqdn)}" hostname "$(hostname -s).$resp" ask "DNS nameserver? (IP address or 'none')" "${_ns:=none}" if [[ $resp != none ]]; then echo "lookup file bind" > /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >> /tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi _dr=$(route -n show | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while : ; do ask_until "Default route? (IP address, 'dhcp' or 'none')" "$_dr" case $resp in none|dhcp) break ;; esac route delete default > /dev/null 2>&1 route -n add -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -host default $_dr >/dev/null 2>&1 done edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { ask_yn "Do you wish sshd(8) to be started by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ > /mnt/etc/rc.conf.local fi [[ -n $MDXAPERTURE ]] || return ask_yn "Do you expect to run the X Window System?" yes if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf > /tmp/sysctl.conf fi } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /var/run/dmesg.boot DKDEVS=`get_dkdevs` CDDEVS=`get_cddevs` IFDEVS=`get_ifdevs` DEVSMADE= THESETS="bsd bsd.rd $MDSETS" DEFAULTSETS="bsd" for _set in base etc misc comp man game xbase xshare xfont xserv site ; do [[ $MODE == upgrade && $_set == etc ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done if [ -z "$EDITOR" ] ; then EDITOR=ed [ -x /usr/bin/vi ] && EDITOR=vi export EDITOR fi [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat << __EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b 8@HPX`hpx(08@HPX`hpx8@HPX`hpx(08@HPX`hpx8@HPX`hpx(08@HPX`hpx4  `@H@  ȓ4 @>@4  В `@2@4   ؒ `@&@4  `@@4  `@@( 4  `@@4 @"! `@@@!  4 ! `@@! 4 ! `@ݐ@ @ 4 !( `@Ґ@  4 !0 `@ǐ@4 !8 `@@" 4 !@ `@@$ 4 !H `@@( 4 !P `@@4  4 !X `@@ !h @@  4 !p `@x@  4 !x `@m@  4 ! `@b@ "  4 ! `@W@ @F! ! @I@  4 ! `@>@  4 ! `@3@ @ 4 ! `@(@  4 ! `@@  4 ! `@@  4 !Ȓ `@@ "  4 !В `@@ @!؀(2 #4 ! `@@ #!""  4 #4 @ِ!4 @Ր! 4 @А!4 @ː"4 " `@Ő@4 " `@@4  4 " `@@4  " `@@$ 4 "( `@@4 @"0 `@@4 "@ `@}@" @j"H ` %` @@ dP@ې@c` @ 2`@O D@K   `2 "`bh d,`` " ` @%@`  @^@ 2 ` @Lݐ @Lِ` @ ؀!@Lΐ"h"h@L˒  @ l"p㿘!L" @L H$"L""㿘!L"  L"@L"x$"@"@`H @L""@L $"@L""@$"㿘 ?  1L"@F &"L1 " " M." -*  ^* ? *4* ^*@**"@ ! 'H'"T '% 'H@nĐ?2 e"  f a X+ gX% ! !@猒  '!b@k   X@H*` @(QbXH*`@- XH* @ 'H b@믐 `@' b@j `h@ `@j"` `H H` HHH''@ OH +S =H 7H 1HJ@? bl   `  H@:@@q@'Hb@k  Hl`'@j"@/H 'H   @B c@j]    `g@蕔 @ju#  @ #0 㿘 s# c8@r"@wZ 㿘@28+)L'L%L!L#5 /L97 -* b@€  %"$  $  $( $"0@@mw`??X,"0* @ &"4Ԁ "  . " `. @@`@- @v @(@@v?@Q ` @i <  "@@@  @@  `@@@v0L"0 a 'L@P U L"$`L<  L@i (H "(`o XՔ!€ L<  L@ # @@$$L" ` L@J5 L  L`2 L",€  @iP a a @  H㿘 s# `P@J"@v2 㿘@O(T@l|h$x$%x'''','''%'&㿀''/;# y)V+V! %^/V7-^'U5p9U 8k* c@€al  @  $al_'al  @  V$alal  @ w  'K$al x G% x`| C%`|al  @ d :$alal  @ [ 1$al!.' *$t &%tal  @ G $al!@J !J `" @ 7!  / %ܐ $@ )@kՔ?? aXal*@`&  $al   x`|  쀢al "V@ alV @` "^  `@ɞ 6al^ b@h ?`h*` € @ @p @u @' @ @` ^@u @ m' @ @M t@t   !@ 0 * a:@@ O'? V@ V"@Ԑ`@̒" `b@g @ 3V- , `m@ה %b@g ?  @ r  ``@"V"@"@!@ a V @'@t㿘@>ِ bؔ@( @!&&& `&$@Nϔ 㿐U"ؠ ` @g"!V @g#0 @g#h@g#  !W&&6@ s^`o6^`   e`f@g  U  L  h#U"܀`   aD + 3` @;   aD + 3` @ ;  #@H 2H'  @H 6  ' `m@' 6@Ő"@NG  @ƺ 0% !' `m@   @ƪ" ^ `2  e`g@   @ 0 㿘  L   0 0@f 80@f 0 @f 0@fݐ!0@f"㿘^ `sU"܀`  * 2`   :  @@ !H @G  @  V `@KIc V^ b@fW ` !W`  U@ *  bU@f!U]"`"؀ ! !W !2  2   !x@ ^*  8!x (@fc"2 V x` `s@K Va@f V |`U"e`r@9 a@e "e`e@-  b@e !@f1& 㿘`( 2 @"&`&`( @!@ !Ԁ@ J b@拐 *J㿘N``"HbP @`N` bP @`"X@,`8  y `* b@Ґ`(b@͐`(@Ȓb`,@Òb`0@龒b`4b@鹐`8b@鴐`<b@鯐`Hb@駐b`Jb@靐b`Lb@铐b`Nb@鉐b`Pc@b`Tc@u `\`',(@i,` L  y )@975/-+@ 7@PH= @#0@J`8@E ` a *@@9@ ` @3H `  2` ` ,`@3< X@#`@c``@ ¢` @@w` x*`P`K  p. `@ / : ` !x*`@ R`* :    d* €' B`('`B  D' B'`BD' B`8'`B  ' B'`{' B`($?@G' B  ' B??M$' B`(?@F' B  ' B??'' B`(?@Fƒ' B  ' B??@F' 6B   /  #\cha@  0?: #l #\#`#d#hcx@a    y`* @c@0 c@    @2s c "  @2h  c@ȐcД@ .lc@縐h `8`"d  @F3c@窐 @Av`8  ?`&  @& * *@ْ0?`&  @&  * &@Ȓ `8  @F??c@z `8@AD  ?`&  @ * ** &@ ?`&  @ ) )* &@ ?`&  * &@ 㿐^ `@:` * y ` `@/`(@)``8@# `H @``X@`X```@`X `p@ `X `x@ ?`&  * & @8`(@``,@``0@``8@``4@ݒ``<@ؒ``H@Ӓa`J@Βa `L@ɒa8`N@ĒaH`Pa`@濐`Ta@源a@涐`\`    ,``"`&  4 `', @曐 $, `@撒aВ "(#`a" #\@恚` @ . >t``@@Ӑ ! y'@!P?@hb0 ?@ː"@bBP~ @p @ِ@C u  b8@?bH@;@Ȑ-/+VQ) !@ ǐ@ @ ג@"!` @ݧ@B  @x! `` ? "`@_ `  "` ? !``? $`@K`  $`` 2` n N@  P@Œ 2X@aǒ@BP  @Y 0㿀`8@'' H'@f'  P@% y@P  @m/ @a `K xP@H' @   @   @  ! #@ @8 & L @gm@* @aq @m+ '@m&@h,  ` `:`@  @   @   @  䀠 `?㿘@m`L  㿘1@> L   , @VL   㻈 !'&`  &``@ɣ ,Ő "@ɏ :  @a*`,`@ސ 2 !`@  y! y ``<@@ "`@ t``@*@@V ' Ȕ@`l6``@˨ :'쀤3L /-)'#x@˔  '@ˋ!  '@˂  'a@``L .&`Xa0@j  $L  `\@,`$ 9 `L `a@@2쀢 ? !P@` 6`6`"ap@2  `ax@) `@G a@ @ '쀊a"&`(!@`O˪`a@ @  '!@`<`&`,a@ @  '!@`'`&`8a@ݐ @x  '!@``&`0a@Ȑ @c  '!@_y`w&`4a@ʳ @N  '!@_d`b&`<b@ʞ @9  '!@_ӒO`L6`Hb@ʈ @#  '!@_9`66`Jb@r @   '!@_#` 6`Lb(@\ @  '!@_ ` 6`Nb8@F @  '!@_{`&`PbH@1 2 @̐  '!@_f`&`T L  *`: ` Ȑ"`6`* ٦@@  '"@_9`&@Šΐ@  '"@_&`$:,  y` `T@  @ "`@ `@*@L? bl   `   @T'$@ : '쀢 "@^',  "^#Yv@3 Q$"@^̒H`e@#@A-'>, "@^5`R@ -$"@^$`A@@A'쀤, "@^`.@ 4$@: 6`#@^`#@ê @@@ᜰ`?  @#0"@^l`㿘 (  #@ , 2 0#P 2 4#h@^R   2 H#@^I   H 2 8#@^@  8 2 < ,@, 0& 8 < 2  8@, 4& < #@^(  @; ( @^#  @^  @; ( @^  ` H@^   \)@ /-+  a @]= @; 8 ,`:`@] @; 8 ,`:`@]`耤2  "    @]Ԑ!   <@,`!`@]ʓ:`  < ,`!@]:` 2    ,`!@]:` @  4, #a  " @]a `% X'!@o!@j'XDP'H'L7'@! @" p !'% b0@E@=! ,@bP@<"bX@8"b@4"b@0"c@,"ch@("c@$"cД@"’`@"’`H@"’` c@"”`@ "’a@"’a@@""a@@i  (   @*`2 JHSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSKSSSSLSSSSSSSSOSSSSSSSSSSSSSSSSSSSK@KL0LMSMKSSSSNLNSO\P0QhQSRSRIPSS{H||||||||z||||||||||{||||||||{{({8{X{|{h|||||{x{|z{{{|{|{{||00000000000000000T00000000000000000000000000000T㶸 !('@!  `  @w   @q    @k  ’c0@w ”c@@ $@  @ A@ D@  "’cp@] !`Ð!@ @”! ܀ 2@ِ#`8$  7$ d'$ , 4 , @ɐ#`' r'r 2Ð 7r@ xX@!(5 à@Ґ$@Ô?   ?`$ * &@  q/(/)à @K Ò@E @*`:` p>* @€ #(@ â!@G@C!`@ n@ k@+@є! `@+!`ِ!@!!@@ @! 2ÒҐ!@ !@@@! 2uÒ!@!@e`r@ Ð@ O\@Zѐ Ȓ!@ِ@Ք!`@ @ @@c! `@!`3k!@!@@"@G! 2Òd!@!@$ @̖@.! 2ÒK!@@!`@ @ @Ӓ@! `@h!``   @b@ @ @f@  "Ð@ wÀ  L@Ò @ @ܐ!( L à!0Òa@@^ ! y@"" @@^!H@Z@g ^ `>`@ }@! 4)%#À`  !*`@ R``y*: `  !*`@ R` n !@aࠒ 2L "İ L`  !*`@ R` y2 V @ @Yܐ! @ )@ߐ"3À Ð" b0@ L #Òa@@ Ð"X@YÒZ @&Ð@1! ` @ ߒ @"hà!@~!@z!@v@ ݒ`@ @"^ `@!`À`@ і@! V@r!  @Y\!Ð@>!M"Ѐ `?"""Ò"@:"Ð@'!@#!@ ْL@@9" ! @"㻐 !'   "@Lb $ * :?    ,  Ð"c @ pᜐ `G  `C Ð"c`@ڕ:ᜠ -À` +à   , @`2  "    a//% )'Ò@ܸ p@c N,  ` @ @ܣ#   6 ,     6 & &&& & @ &.  . ($&  . 6@ w " {&$&@o.   +  ". +      "  +  2  `+ . @   2N& ϐ@ Đ @9 a&&@  28&@ Ԕ 21&M"Ѐ`" 2@ Ғ 2"&@  2&@ F 2&M" &̐ @є? @ @{ P㿘Đ ``x@ 2J  @(b07*   &  Ð"c@ɔ`0&    ` Đ"`@ۻa0 `   *  yb,*@  Đ"@ۦ`0@ P㿈Đ!a(@є 2J  @ޒb0.    ' ' '' &   Ð"c@u`0     Đ"`@ga0@ Ȓ w    `  " ` `       ĒaX"@: , &" &@ 5 D@ w 2T$ N$@ @<!$ $@  #M"Ѐ`"'   2! @  @ ޒ   2 @ )  $$ $ $  Mb̐ @? @㿘Đ!Вa@ 2J  @b0r *!?  k" `  " "``""` &"`"`"`"` `0P   . Ð"c@ړ`;` `  `  Đ"`@ڀa(`   " @Œb` Mb̀M"Ȁ      ` &" " " " ` .@ @a&@㿐^ .@7+"  y!* @7#"Ĕ  @7"Ĕ  @7# (@7# ,@7#( 0@7 #@ 8@7 #X 4@7#p <@7#@6# H@6# @6#>Š`#\Œ#ؖ@6  # a> 㿐@’ Mb"MbȀM"̘ `@@   * @  8? @ ?   + @@  @  #@    "&@+  "@ @    +  +   `+ &@@a/㿐Ő `@@ 2J j   . Ð"c@d`0o `   Đ"`@Xa0c@a@65 x@@ ` ` #\  #`@ŔȐ@ƒ?? / 2@ )! 9 `   # @  Ő"@a(0'" &@"@ @ &@ ` <  !P@Tb0`Mb̐  $@@є? @㿐@ɒ  @MM"Ȗb  @ # `@@`~@"@㿘L Ť!*b8' ”#(@5`b8$@ 2b8 ` ,b8 X ?4  " X* $ X @ސ ! b8@ ?L ", L8`?8@ Lb8`2Lb8@$Lb8 ?b8㻀  8\ ! `'@2:- a` ?/@5D$@  ` /X ?4  "X* $X @  ?@: ?L@ O ,@O ?O@TO ? *`O ` `\?L@`  !*`@ R` c" 8 k &"< b %'ODO@" ( m gO7 O3/,@ (,@+ $ ( (@6g,@ @^,@a؁ Ŕ$?@{ <O @O,@!؁ Ŕ$@l?O + -   ! '$ L@5 L "8?J` $ L1?' B!F '@Đ 'Ņ! F 7ā@' B'-:  + -"'`@?> '!荡B 8' !艡BaŅB!7ƅB' B' @!"8@!ڒ" @!Ԑ"Ő!@4 ! @!Ё㻈 !'@  0@^ǐ @`@ s ! ő-`,`@@   `l?l""@2 2``a`a@3ؔ@"       Ŧ/Ť - `'%"$* @3X`/$@  O X` ?"` X* $ X@ # O` ڐ?*  *  @ @ @^U&{`@ -`(2 @@^C ! @" !!X'@^@3b" y ;975/   y*` bТ "I@#(    a쀤  , @ 2  )@3:0P@Ḡ # )Ŧa%ő, @3.#h p@a  , a` ?"`a* $a@t   6 #xca 2   @mb " &@ b@c @! @9O )'%#  ,#\#` #Ж ?〤?@Eb ,& ,)'%#  0#\#`  p ?ˀ?@-b 0& 0)'%#  8#\#`  8PX ??@b 8& 8)'%#  4#\#`  @ ??@b 4& 4)'ƀ >b̀ <"@  Ɛ"@՛a` <  4 @ ,  4@ ( #\#` ?j?2  < !@ɒb <#MΔb̀ˀ @$ @&@@!(b̀8$b& <)'%#  H#\#` ! ? 0G@: h0C@6 @3!@0!@@-!`@*!@'!@$!@!"@"(@"`@"@"@#@# @ #H@ #p@#@#@#@ @ 8@ `㿘'    "@ @Z 2$0@L @ޔ   " @Z`$ <㿘   `" `2 @k ` ``   !p' @ t   , @ " "@ "    `d#͐a@  N r ͔a@$@7| / "`N@`r2G ͔.@$@`.@@;?, H@8 Ð@a@  )  " y"bt   @*  ` a*@ @#\#\@  `@ 2@@ɘ  @"㿐.` ʹ`" ! -+)'% ` #\`   #`k @)"% 2Ma@"" ` "Ȁ "@̒"H ` M"̀ "@Ò ` `"@Ѻ ` $` 㿐.` %%#̀``2   <  7!P  "N$ " @&E$ ΐ"@ъ`  c#\``  #`? ?  @b&   !@b "  ͐"@[c  Mb̖  ΐ"@N` $ 㿐.` -+)% '`#\#`a ?? @} @w` 2$`@E!8$` 㿐.` ` 7, J   @[bC 5) /-+ @@#\#`h}x??@#: @"@ @* a@/[ ΐ"0@" @/P,  㿐.` Ϊbp"x)# %   #\#`9 ?? @b  24 @b  㿐.`  ` `( y",*` ΐ"ǒb   , @@# 2 ,` 'Β@-_" !,`   @b +)'% ` #\#`c0#H ?ꀤ?@ ` ,`  㿘. `E A ? = ;.#!΀ /@ @W@  *&@’c0@̿  #@zb@c#Δ#\    @ib c@ 2N@  @W&@ 㿘 2 @@ 2  2@ `?@8@ʨ? ϒ`@K @`! #e’c0@l `r@ 6 &@`e@ݔ 6&@ϒ` @K &㿘  ϐ 8`` 2  g ?* : `3d#`*` €2( U!& (,& ,0& 04& 48& 8<Q& <`2`( B!& (`,& ,`0& 0`4& 4`8& 8`<>& <2( /!`& (,& ,0& 04& 48& 8<*& <(`(@%,`,@ 0`0@4`4@8`8@<`<@  !0@b0 !h@b㿘 " " " "   <& 㿘@1Ĕdd` #p?" @ "  ?^^^ $#p"!"# "X r#ct#( € ϐ!"aP$#p @8!  $#p  Lϔؖ@@ #pR!T`N @k K#p  ϐ! "aP$#p&@!  $#p  Lϔ@@a #p $#p+!T`' @D $#p  ϐ! "aP$#p @! $#p  Lϔ(@@:  #pϐ"H  "P"|#p ?1!L ^@˃   L!LP@@ ^ #p@:` 6 `  L!Pϔh@@  #p < !Pϒb@?Ӑ #p@ذ??$#p$㄀2 #pa@a   #p $t  @g ?2 $t2 $t  L`2$t t`2$"  `!x   ""c|s#!`i#*` €c?"  `!x "#Z"a`` @>c? !"!`"a`" !t  !` >"#?;"c" !!x  : `@ 0@%!x?"!`% 1 >$!`!`  : `@ 0@!` " $!`" ?!` &#&#" "c"`%  $| 㿀 cp   ^^"!X"`"a #  #t`# !`' ?`" * " @ː !@̓b@# c p!^@4   <    40  @*(aP$c "` ! !Ā`# @P @p# @P !  #t`2 ^! "@""@"a^ ?$p^  ""`" cx "cx! b"!X!`' ?`" * " @M $! !!aab@@`;"aX!@ʐ#   p@9  @ݒc #!@#0 #!p cx#\#`#d#h!c8?aX@@%$aX?c  #t ᜀ`' c|   ?#! #p@-W? 4#p$| @'#x㿘 #t "c 1 #p  @詒    #p@G     Lϔ@> ?㿘 #t`^ϒc@=ڐ ?!` !`!c@=͐ ? 㿘 #| 3 #t  cp@, `^  "" !"`^"!cp@, ^ "` $#|   L#x @= 0 #xВ`H@= 㿘 #|  cp @/E   ^"`"6$#|$#| #t @ & : !cp  @ .  > b cp@ê $  $#|   L?倢` E0   L  В`p@=: $#|C    $#|   "^ "`  В`@= 0'  #xВ`H@= 0     L#x@=3 0"``"@Ő Вa@< 0a8@< 㿐^ `g? c| b  b? Wap^ ^ "` #t 4=# 9^ 耢 # 2$| cp7  a'@[ 6&$|%| # ct % "% p  @]  > @@ dp@O   $|# | Вa@<  Вa@< ?㿘  >2@ `(=  #| 4 5#t`21 ! #p  @   ^ @ 0C 4 2 > 4(>0@ b >0  #p@     LА @  "@A "a  "  "@Þ   L Ҕ(@86   6 4? @@U x @ @ @B`@-ጀ n!`j " `?"`@* "@@ Y$!@ " x @ @ @lB@-0F? < @ጀ `!` " `?"`@* "@@q $!`2 ?" x @ @8B     @yà   LҔ@@7 @ "`( @3 M@0@% @⁐ h㿈 "?`'@, @  `, Ѐ` 0@.L @ -/@c@,       @  '  L @7;p0@& @,@,א` !쀢` @7  @@,Đ0!   "@  "@  "aX`@"X @{` a !` " `?"`@* "@@ $a@ג0G`@@̒a  !` " `?"`@* "@@e $a 6耢  쀢 @耢 ( x`  ` x @ `@6 `@( !Ȓ?,'@,ѐ %``4@q @ +ᜀ @/@ ! ?#`b '@   "  `@6& y"`D q"`  kaȀ  @,= c" @- Xa    b@ċ` "a x aȀ  @,a ""@-  @ "@(T  @vB "`(@+Ѣ @w   !!  "@ $!Q  @Ɛ  !Ƞ ᜀ`'@+ !@   "`D ?#`' ! @!?b?X? #`a? ' ܢ '@,2 !?L+ /!?a(a#X@M / /-@`-@,""a@'  #  Laܔ(@5f Pa< @ @aܒaP@5/ Ca@*r >a@ 9a@., 3!Ѐ`@,% +a@10#??b'@' 'Ȁ 2L!`;L /d?@Ғax@4 0cXb@z #-@Ȁ a   8c   @ c a ?`@ ?`8  @@* ̒!@# ǒ!!?#X @$ a  !`+" @3 $a !`  8#   @ # a ?`@ ?`8  a    "@ "aX!`"X@1 @? ! f!`b " `?R"`0U   ? @ @ !@* !  @  ?b  '  L @4Rp0 @I 6@B@)0"@Ր@r@6! !` " `?"`@* "@@А $!@Đ ! @跐 @-h@@a @!㿐 "^` ? ' 5- 3 "g?  @ `T  E @3a a@䀥 a $€ %` ``8 ( ` ! !ҒbH@3  ! @Δ ѐ` `8   0aK ?Ғb @3n ?aX  "aX㿘 !"`   (*` * & 6@ ^p?@ * @*`@"@ܒd a " 9 7Ҁ U@y O"  " L? @3 x @v 4  a@    a^!@*` *  . `@  2 " ? @2x  ^a @+""@Š" Ғb@2ڐ ?㿘ax _! "a "`&!x!x? Ғc  !ҒcH   "" Ғc  @2?0aP ""a`  ! ! ?!x  @8p"a#! 㿘 "_a"!!x? Ғc Ӓ` "@2q?0aP  W ?a`!  #!:#a _? "!`"c㿘!`Ӓ`0 x  !` "x "c` "# L s ! " c  @ :; F@@  @c :@ DȒ E@d (!`%!c@$@ %!'` -! $"  : c $%!c$@ %!a@cb  %`;a8p    "b Ӓ`h @1?㿘 #`L  "`Ӓ`@1 C? ! 7? ;  !B@ "!8"a(   :!#   : !c    Ӓ`@1q 0| !X ?㿘a" "a@㿐  p?a " :   2 @!  !@fU%!!` :`@ @@  :?@ f @ B D (8. !"@:`   ` @b:   2@!!  d%!a! 㿘#aa !! "@ ! c@_$a㿘`$" '#% a"@  @@N @?a@Ea&@@$a` 㿘`$'#a"@  @ &@ a@a&@$a 㿘' !"   @c &!?< 2 @ @划 @ < f $ ` 8 H@' !"   @c &G>: 2 @  @n  @ :d $ 4`8    L  Ӓa@0 !>@O    L@@0  >?8 ӐaX@/ > ( H@  '" ,@   ؀ 2   N> LӔ @/  >'/0- :2 @   #\@: !쀢` :!   #! : $  @ d ` "@%@ Ē   H`4   `@i 4 ` ! ?!쀢`2   @Ӓa @/I  (HP  * 2`  *` '     "2  @   @r  ؀ 2  ' LӔ @/@'#' a@ Ԕ #\@  <@ Ea@=㐠 怦!  L Ӕ@/ 0 H    @   Ӓb @.ז @   8  LӔ0@.   ӒbH @.   H`  `@ 㿘 c  )  $% # !    :a#  "a? a> B@"!8"a㿘!h!h ` 4+  1%!p!p!h  !h'% @3' Ӓbp@.Q >      =api"#!   "a@=ap] && %'   =ap M "a&& 㐢@ `ap <`B=ap !@١㐐 &"a$  "!ap@ <`C &!=ap@ل$! b @$!@Ϫ  "a?㿘! #  1 # 2?!=@ے  $#  #Ӑ &#b@- ?㿘! #  1 # 2? @⾒  $#  #Ӑ &#c@- ?㿘! #  1 # 2?!=@⡒  $#  #Ӑ &#cP@- ?㿘! #  1 # 2?!=@ℒ  $#  #Ӑ &#c@-j ?㿘 #` E1Ӓ!=@* @ ! `# $2 #`2? `2.1: #  @2 #`$#  @CH (!=@* "@@15   & ӔȖ& $@W `21#2& $  @Ô  &㿘 #`C E1Ӓ @Z* @ ! `# $2 #`2? `2.1: #  @* #`$#  @B ( @2* "@@*G   & ӔȖ& $@ `21#2& $  @d  &㿘@3 "[?N V c   &N?@&o!=㬑* @ #   @  #  7?! $c  @1ؐ c`$c  @&J!=@B~ (㬡, "@  @/ ?` &@ @ @/   $` $ $&@ $?㿘@Ґ "[?N V c   &N?@& 㰑* @ #   @  #  7?! $c  @)ܐ c`$c  @% @B (㰡, "@  @)3 ?` &@ @ @)'  $` $ $&@ $?㿘@!+㿘Ԓ`@D   ? H`@  ?㿘 <    < & +& $")40,H'H#"H(0  #&  &  &  &  &  & H   o @6 &  <@ ϐ ? % !?#`' @ '  'Ԓ`,7@ ` b0@ @g 㿘lԒ`0@+< ? 2 L 2N   Ԓ``@+' ?㿘 H   @   4!  H H@ @+ `? H,  ] @"&, `,@ N,  Ԓ`@* ?㿘`K Ԓ`@.   ?㿘 L h! x   :` @   & `  @  & ` @   6` @   $& ` @   (& `$ @   "6 `* @   ,& `0 @ ߔ  @&  H 8&  0& `A@@ : `;@ Δ ` &L < (  @ &,., Y ?  W㿘@"@ !c'@"K ư?``x   :`,& ",    A4  #`H  A @3  `` A @   !ǒ @   ~#`   @   t`   @   k`    @ z  b`$   @ q  Y`(   @ h  P`"   $@ _  G`,   *@ V  >`8   0@ M  5 ; @ E  - L  `  ``a      2 ,ܐ, 6 `ԒaH@)  ? Ԓap@)  ! @Ԯ!㿘`m Ԓa@˔   ?㿘`m Ԓa@   ?㿘 @"a㿘!쀢` n Ӓ n #`x  :` @  `& ` @  ` 6` @ } `$& ` @ w `(& `. @ q `@& `8& `0& `6 @ Ӓ `H:`& @ ` `"6 `> @ Z `F @ U !?# @ `*  * `& `N @ E `V @ @  @ `*  , `,& `f @ 2 `&`^ @ ,  ??& 8 n ` "  .< (  @   @  b  `:&,.,    @  b _ ` ?  |㿘 @ ;"a  !'?@ ? #?` ``,&!쀢`!’ @   `   ! @     @   ` "(`x  (x% #x#`H   `  b `x ;@ 6 @ C  `Òa,   ;x   ;@ 6 @   %   @       @   $   @   (   @   8   .@ x  "   &@ o  v `  >@ e  l'? @ `2 @ F @ X  _, `  N@ N  U V  2  @ B  I ^ @ :  A n     n  $ /  "a    # 2! ,ǐ, & , $    6 Ԓb@'  ? Ԓb8@'x   @ҏ"h` (:`((!Dž0: 2`(0 ?    ?㿘ڒ  ! ! x   S;` `*  & ` `*`@& ` `* 6 `  $`*`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  :`*`+ 2 *  @ :`R`` `*  & ` `*`@& ` `* 6 ` $` *`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  ;`*`+ 2 *  @ :``, 3`8`@`0& B&?&E :  * 3` < @ (@ `H   &,.,   `  b`x ;;   @  b  ` ?}  &p !?c'@% !D?  ?  ,& Ѐ J  `x] [x  H * 2` * 2` `@  c * 2`  x  ` `+=  `-5@ *   - @ (`(`(`(``-) bx, x; ;  , ;  `***   : .`.`.`.` )x   =(`(`(`(`)  q :  *   ǀ(@(`(`(`  2 *   (`(`  *`2`*  2`@(`(` $ 2 *   (`(`  ( 2 *   (` |(`  " *`2`*  2`@(` n(`  , : *   (`a(` 8 ::: *`@ `**`@ (`(`(`J(`<  *` @ (` ?(`h  b       "b    $ 2" ,C,   , "   6  Ԓb@$  ? Ԓb@$   @ # 0000㿘%   c*`.@4` 6*@Y !?!  `L ( $ @y  Ԓp@$ܐ  ?&@4 &㿘`@ @ɨ    LԔ @$ !`  ( $ @ a  ``  36   @  "` " ` 08  @a 8, @    LԘ @${ ?<   @B ԒcД@$> ?㿘`    @+  8 @ !`  2    Ւ`@$    8@ >% !`2Q @@`@ Ք`0@# @?<   @Đ %   @- % +   LՔX@# "?p@# ?#  L` @w`   @\ a 0  a  '   ` Z"*` € LՔ @# +?!@ ,!耢`, @ #?" ,@ < ( ,2`@ 2' &,*  2`@,2`@D `Ȑ, @ E Ւa@#8 ?$ ! L  @ ``!` Ր $ ( @ڐ Ւ(@#= ?!`` $( @_ ( @1 `ta  !  36 !  @c%`J) !@<!@ B@3  *!@X   LՐ H@" *`2`@>0  c@9a!  6@: @ )  "  " ` "@% @Ԗ " 2 " `"  08 @}   @͗!h8@ !!`2&?<  @E 6 `   LՖ x@      LՖ@"q ?8L /? " /!` @i@Ք  6,@ 2 , c@a$@` , @! / ,@ @! ,?8 #"#Ȣ%$ 3 b  " `cȐ@  b  $c " ` c $  LՔ @"c@ ֐   LՔЖ@! 㿘@] 6 !3 @&" `L  !` `L@D 2 ?`L@!Ґ ?㿘@n 6 !3 @" `L  !` `L@ 2 ?`L@! ?㿘o@   LՔ0@! 㿘\g' -+ 2 '&@"&`&& N    L "  2'<`  @  0L'P+!! b`@+ @78` $!Ւb@! ?@̫!*@@ٔ LՔ@!4 ?2&㿘??@˫      LՔ@! 0c@    LՔ@!  㿘@ @?&@!`  0   8 Ɩ ?c0 !'  `  &a  X 8?# :D @ 6  `@ @@ޒ  ! H      b%? @А     L 8   Ւc@ n ?  @     L0@  ? &  @o#P <Tpp㿘!  "a$  "$!`$ "$!䀢`$ @"$ #䀢`@63, "a(Ւc@  ?@  ?!` @y? 6 㿘 N c@6   Ւc@ ?@z?`$ N /".  c$$  $ $  c " "c "#"c 㿘 #쀢` "`!Ā` "a0!` `  # c @ٔ 㿘!` @- #䀤 )' %  4   2 `2 @  @8 2 㿘 # - @+$!# )+'䀢`  !(@$, /5?#쀢 "&# &#*?#` "@@Oà #`L`@@| ?@@ #h`L @n?0 $!((!$@3 $ 㿐a0 % "a0  % # @  $c а? 8?` 5Ð *` €!`c @ @ c `0c `@ 0c  c @ 0c  ., cx   ::&,@ : ;` ;` ;` ;`  (;`( 0;`0 8;`8 @;`@ H;`H P;`P X ;`X< "9("140NOccK -0 H?c7:c! 2&  8 0@& (c$ " @ & : & , @, 6 ,c L ֔@ 09&,  & c @,c&` & 㿘!`)"% `'`? $`@$`  $` *`@@. = :, *`,? ! @!` *@  2%,` `  2,0  !``? &`@`  $`@2`֔a@@  (a !'  !`" @p@?`&@ * &@j@ɸa `@ !Ԁ2  ` ;!@@!!@u` @7 @ /` 5 ` `  #h #`#d֒a#\ @ ` ? ?` 2  ֖ `a@ `0a@@pM`&@  * &@j0 @u ?` @p/!, @h  2 ֒@p#!, @\?`&@ * &@j@"a @C"8a !'  8;a @ 4!!%8@u@7J @ "/  @O֐"@Ŗ  @"㿐@ǶV` N N N @~@o N 2N0@o   J " 0" * 1 Є *`(8*`8( Ʉ*`8(  0(Ѕ8   J`/ `7$(@    8W0(2   0(2    0( :( ? 㿘@  @ O@ "`0"`A@I@Є  2`.* >а*`>@F.> +.>2`* ` >F *`@`@*@2`* >а*`@>F`@ O@/@7$. 㿘@  (  `0 8W.W.* 2`@2   * 2` ` 02 .   0.:. ? 㿘!4  "a`4`I?"4J@ -  a8 *a8 "aXJ!8`@)34 . :  "4"4'?@  :2J @ ֐"b` :2.  X  @֐"bx@  ?*@$"X. > ++,<,<+&h&&&&t&&&&&&&&&&&*L*d*d*d*d*d*d*d*d*d*d*d*d*d*d*d*d*d(D*d((*d)P)p*d*d*d)*d*d))*d*d*d))*d*d***4*d*d*d*d*d*d%0%8%|%*d%*d*d%*d%%*d%& &,*d'''('@'X'p'|*d(0/(/4/x/x/@/L/x/X/d/x/x/x/x/x/x/x/x/x/.d/x/x/x/x.x./x/x./x/x-./x/x/x/x/x/x/x//x//x/x/x/x/x/x/x,-8/x-D-P/x./x/x/x/x-/x-----.-. .4.D/x.X99:$:$99,9@9@9@9@9@9@9@9@9@9@7L7X7h9@789@8T89@9@99@9@89@9@9@9H9@9@9@9@9@9@99@9@9@9@9@9@6|9H669@69@9@69@9H669@669@79H77(709@9@9@7@㿘@@+ /`"!`@$!!@ː" ֐@0!@" ֐@G0#$!@P  5Y- `JTȐ Г*` €O# a@!$!x`Ga֒c@@. @? "a9 "a4 !"aP. "a)  "a$@ "a "a a@s 0 !-* : `Ȑ *` € ""   "" ""#" ""   "a  "aLcX@Ґ @( L  ݤۤ @a Ӥ "!ͤ  "!Ǥ   "! @! !# 'Β` #@ @ݖ H "b!֒cp@   ֐#@lmb`  '+@"@㨠  `H"@l^c0P֐#"aT! @5!:hh h!  ah֒c@d @ah a ֒cؐ @X"@g "!a ! ! @  ?T"c@jF! N"cג`@6 0 @ Da A "!;   "!5  1"aH@"!,  @ a $ @ a  "!  "!  "!   "! @F@&ޔ??B   sې! "b !%qȐ   @@  !  @  ! " % @@א@   ` ! "b`AȐ |*` €! ! !X7!X *@@ !X@!X $!X0& !X@ג`0@ @?. @"a!X !X *p@ !X@!X $!X "#㿐  ""'    ) 7; `JȐ!*` €# a@ !` $!xa֒c@@A @!x* $!x %" "#  aJ@ -2 J` "!P ~'"!Pz' w"" u s  "am" i"aĐ f%" @a a@]Z%"a U"a Q"aВ  "" L%"0# !D"aL @"a@.?-`   א @ْ`@/S  aL,"?'"? #"a!'" "aא "aT      !א!"aP@^X?O? !X& *` @" 2  " !'b"?  " @/ "   y -;97U5װ` 7@֒!( ) !`@0 ! 8@^@ !@ݒ  @@ !(@ !<@h!< #גa`@? @@@ax 2 @`@ (`%L `L@` 6 @@ "@@za  `@ 2L`"!L  !@ ! "b@i! @!L p+   k+ @h` D ے  !@!א@;!(  !`גa0@D !גa8 @@t ! @k@ !(@ !<@ː!< (גa`@ @U!@@ax 2@`@ ".%c`  @?  ` @5@ @@גa  `@ %c !!P "J @! $!PJ א $!P8צ!%+ @@pL `?,@ `L @! @' ?<   @D  ?` /,`ϐ P !  ?#$! ""a#a" #!P     /9 `DȐ#<*` € "a  h&! "a %b "a &     "b%b %b "a ! "b%b& "aw# ~%bz"ax @fat"ax! !@a0  %!a8@ @[%@ @Ő @<`V!גa`@ @FO aJ - J !B%P!?%P! !# 'Β` #@ @ H 0"b!גa@`   א!@h:b`  %)@@  `H@h+#@  "aא  "aT   "b@@#'ᨀ?@?!Xb* `G@Ȑ#(*` €@ ? @` 6@@@ 2@01@  ג`0@  @@"a܀ `@@  @ "#%!  @"!` <  גb@ @@㿘!! גb(@k"   #J 6 גbP@`"@͐ 2@ "`?"`" * $"@a 㿘@@    㿘  `גbX@ ! 1א"@," 2@ 㿘 N  b@ ג`@~ :?bג`@v @*0?L , ' @s , 2,@@m = @*s 䀤`."@ "`"` `  ""  $L ې 㿐 @  "a 2\ `(Y "V J k" m b /J w)J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& @8"  'J`x 4 ``*2   @[ @  㿐@  2  J?` '@)  @J@* "a<  㿘! ג"@f"ג"@f"%ג"@f|#ג"@fxc0ג"@ft#Pג"@fp#`ג"@fl#ג"@fh#ג"@fd#c0@fa"ؒ"@f] ؒ"@fY ؒ"@fU Hؒ"@fQ pؒ"@fM "@fJ#ؒ"@fF`ؒ"@fB ؒ"@f> ؒ"@f:! ؒ"@f6!H"@f3`ؐ!x@f/"@*ɐ 㿘! ؒ"@f'!ؐ!@f#"@* 㿘! ؒ"@f" ؒ"@f"hؒ"@f"ؒ"@f"ؐ#0@f "@* 㻐 !' "N c `L@` `\*`: @2``ؔgc@)  ؒc@ t?,@@S @ؖ$ٖ`(@ @)$^?`,@ J \2N22 *@D @) ؔ*c$ $J + !ّ*:  P" g G" 0  p"0 $ $@ @(,@ X@ ?J   a $ "!"a  a " "a! @ 㿘 N  `@(  ْ`@j ?$@$  $ $ `$ $  a " "a "!" 㿘 !  )' %  2 `2 @> Т @˒  2 㿘 !`  !Ā`   \$  W !`22! 2 *`2)!2*@~m   $ْa@  ` /*@6$  ` /*@$ @?$ J / * $ $ & !       2    @( " &ْa(@Ɛ ?㿘 a  &!Ā`/!`4?2   #@.         J@ /2 @m 2  aa`? `&  T &?& 㿘&N ?  [  **`:N@-*`6N@N@ !`2/1?&. N@ ߲`(? N *`"   N@Δ `N@ ?N@` `@ 2N?:  `?J!`?   82J! -(J  ] 4  @$  (8 "   ](  㿘 "`! N  /N    . .  @w@+&   $aH@ِ  ) N, /%  ` N, 2,  . ., , @M@,&, 4   $aH@  !` ,@Ԗ  *     , ,,@Ö !Ѐ`@     ,, @,㳈 a !'@D!-+)'#!G@9@7a@5"@D, 6@( @(b00@ݐ,O@ "X0〢  .@"x  O逢 @" "@  @Q@,&` ? @="㿘 @ ? ` ,, @ ? 㿘N@`/ "@l$&@ْb@ ?  ?*@  * . ?*@ .   ! %?a''L@y, F D@3٪  @A 3   ,@` @* @#@p  %?Wc@ Z L@ @"@  L    ʐ    2ª  ?@0,@` @@L  @,@L  $ْc0@] % O  O耢   ِ"cX@ޔ Oِ"cp@֖O耢  @~L"@  ! @O#㿘 =:  & \*N / 94 *?Ѐ$, @*:  \2 .N  . ` `  "  '@? @Ĕ:&* &TtTT$T4Td㿘ڒ @ 0  "a  Lڐ @8e!@ ` L@ ڢ h@L ' %J?`/"?@$Ő  $ڒ`p@ Aἀ ؒ@5" /* "$@N &+@< % "`Ԑ"*` €i!T`ڒ`@ 3 ἁ㿘 "a "ڒ`@[ 0ڒ`@V 4@!`@@%Ő h @   ?@ @   ?@} @ג   ?@r @̒ 2?@g @S!   "@   ?؄ؔ"!  '''@   Ȁ    @ Z  @   Ȁ    @ H  @  Ȁ    @ 6  @  Ȁ    @۔ $  @Ԕ  Ȁ    @ɔ   'ؐ @ @º      Lڔ0@  ?bc bc btc b4c ac a|㿘 " ` @s 2  "$` @ې 2   "`" @   㿘 "S?N # b   !=@a  $b 8aN # \N  #" @ 2 ڔa@ 9 ,?  @ @!=@b , @ " 2@#0  b ڒa@  ?, "  "" 㿘 $!=@e b * `"  @ 2` `2@ 㿘 "S?N # b$   !=@  $b$8bN # \N  #" @  2 ڔbH@ ǐ ,?  @; @ !=@b$, @ " 2@"  b$ڒbp@  ?, "  "" 㿘 (!=@ b$* `"  @ 2` `2@ 㿘  N b@* / "N,@`N & ?А , *: * :  .2b 2b @ J ڔJ 2 @"U  `b L@ 2$  *$ L@ & @ڑ*:  M"  c C"  L@ m2 L@   $   $ c@  Sڢ`L@  @@x} N$`$ @ 6 ڐ c0 $ ( L $@~  6  ڐ cP@ @"!$ڐ  $  @ ږcp@ Ґ @"? b $  """b   b " "bc@  ? `A@8` "$ #  @ &)  `$   @    @   ` ` `2` `?㿘@N`   "lJ?   ` 2 .2? 2? J 뀢?@c[  @ѐ 2?L?Г* @L *`В@ `=r$@$@` kՐ#*` €N Б* N * ?Д * *  * 8$` "NNБ*` N * `?А @$` ?Г* @N *`А@$` D  d$`N?Г* @N *`А@$` ,  )?$`N?Г* @N *`В@$` ` `""?N?Г* @N *`В@`$`  N?Г* @N *`В@ `;$` ?@f7&@?? 㿘1 "( 2 )@  &"( ے`@  ?㿘 "(`m%`"`b )@b(-  5      @ 2  @ 2  ,@z", ` &,  &  ? $  $@ @ $ @ h  @v  $``$  `"$  - b( $ @ $  "@ @ xے`H@ 5 ?㿘! "( 8#`"`3` / - +`@})"(*  "  2  `   @ 2  @ 2   #@ 7@ 5㿘 b(   (*@  "@`@ @ `2(㿘1 ", 1A !G@ْ  &",ے`h@ Đ 5?! 1* * * * * * * * * * * * * * @! "b@!@ 0   L!ؔ@  ?㳈 ! b, ' 2  1@WG,- @`;+ -@2&``! "@  @ ` ` "@`L@  [?@E@e ```2@`  8`  ?$`= @L  .! "@  @  <`"@@  8- , $`$@ $`"  L  L۔ @ :  `  Lےa@@  `?@??a @!h㿘1 "0 2 "@  &"0 ےax@ ?㿘 "0`ےa@֐ I @"b0, @`0` `@@~* 2```@~! + @`@u &`a@ @u  &@@u  &`b0,   &` " @@@ѐےb@ ?㿘! "0 @@_""0* @ @} 2  @x(&@ 2㿘1 "4 2 !=@p  &"4 ےb(@Y ?㿘` @  ? 㿘 "4`-!=@b4, @` `2` " @<  b4, ""  "" ےbX@  㿘 "4 ` }  @ 2  " *     +2$`& `W& `R   B`25 "5 @ 9"" "$ 5 D  &DDz  D @!q  bx  &DbD @  bD"" "$  &   &ےbx @ ےb@  㿘1 "8 2 !=@  &"8 ےb@ ?㿘 b8   8*@    g   2<8㿘 "8`6!=@︐8,`@     2  2  @R  @s  $8,`$ $ $ $  $ " @iےc(@& 㿘! "8 &!=@}"8*      "  2  2     "@ & &@<@:0?㿘! "Ж "< @# 6"< @Ȁ .Ж "< @ &!`䀢  ؐ "` " `ܐC @ "<??@  "<@@"<@? $"<ܒ`@/ ! @G H㿐`@  @6` `   *  `'  * @Xd,88$$$㿘 $ $ J@" ?   " @   (  ((( ( 0(2    0( :( ?   @    *  *** * + 3` ` 03 *   0*:* ?  !    㿘a$?N ܒ`!@a2     Ւ"? "aH ?㿘-)'+/$%@z3 ! @z-ఀ    `@   b?  @  ? %D ۢ  㿘" ڰ?!!   " 6 & ` &   @tA,&@!$! @t8,&`d 絔 ! / 6`l 答  $& `t 秔  (&  `|   H :  皐` @&     ; 8& 0&  x:N` `2 `K`0"T.,  P., "& `L`5"=G., " N`C.,   & `,@s,  ( &  " 6 `,@sې,  @ 6U&, & N` K  & H @ "@ b   x a:  ;@  & 6 " 6 ., -&,&,L /`  `"` &  6 6 `H@`  a"@   b  `` & `x6 a : :L /2 ,?& 㾈   ` '-ݐ"P*` €!D`$%°  a@ ap a a, dܔ, a%@ . .. catchmodchgrp cp4 ddD dfP ed\exprhostname*V ln lsmkdir\ mt mv pax tarcpio rm ksh sh sttysleepsyncA . .. binBmdecN(sbinN(shareN(B .A ..Cboot nDbootxxEbinstall[PF installbootmp_uremxdr_inaddr_encodeinflateSyncfile_systemufs_readmemsetmainarp_replyufs_opengetcharinet_ntoanfs_seekifnamereadudpcd9660_closecngetcstrcmpzcallocsocktodescxdr_string_encodegetdevtypedomainnamelenprom_open.urem.remrpc_pmap_numxdr_inaddr_decodeobp_recvdvma_mapinprom0_closenetif_getdbufprom_boothowufs_readdirnullsysin_cksumgetpropprom0_xmitkdoprntexit_divesymufs_writegetpropstringstartfile_system_nfsbceaarpwhohasufs_statnetif_closeinflateSetDictionarystrlenopenreadether.umulhdrinflateEnddevswprom0_iopenobp_closeinflateInit2_dvma_freecloseprom_bootfileget_crc_tablefbufinflate_tablefreelistrpc_pmap_putcachefree 44d4 gcc2_compiled.filestore.9bootstore.10prom0_fakesaveechopv_putcharpromdev_inuseprom_mapinprom_mapinfoprom_mapinfo_cntprom_devmappromvecstore.47putchar__maindvma_allocprom0_icloseprom_ioctlprognameallocprintfprom_sinetif_debug_udivpgshiftmemcpynbpgdevopen.udivtwiddlendevskprintnprom_bootdevicedvma_mapoutobp_strategydebug_rttbzeropgofsetcputyppromvecloadbootblock_countioprom0_strategyvprintfdvma_initdonottwiddlecloseallprom_initpanic_uremmemsetmainblock_tableprom_open.uremblock_sizedvma_mapinprom0_closeprom_boothowkdoprntexitstartdevswprom0_iopenobp_closedvma_freeprom_bootfilefreelistfree4 `@# ` "" $@` `T@  p b@"@H*/+  "b   0  "# "# * "#!` "#@㿐@#  a"a @ "  "8@c@  @   " @@㿐 c@T    "P@c# @ D ?#c' / - + ,`2 h@k㨒   # #@^㨒@a#@`b@S@?@2 @a aa @F`#@Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1? @"1?㿘 #@(1 @"1㿘@ʐ " ܒ㿘 @  㿘 #` @ "  `  "  ` ""J  *@J` )*@㿘@  #` @ "  `  €b  $€b 2$   " @ɐ"0   $  $`$` 㿘# b `   ``*  `b    '@`2`0`,6 * '@ 㿘  ?& `& $& (   €? " '@ 㿘 "   @@ 0(@  㿘  @ $ ? `$ *㿐 " /  0T@㿘  㿘 " `t€㿘) ! ?N  @  "!Т!$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @ "+  " * @7 $`0 "$`4 " @$` @ 2!&  %!  @# 㿘# a  @ 4 "$a & 4$a㿘 #*`@   #0@ \   #         #H@y` ` #@  #8 <?*  ` آ&@  `  #`@㿘?( ,1 \&" H L` T ` X P d l$ p  t @  .@ dd ? * `:```?  `h "`h"     d?"  d㿘 a'H'L'P'T 'X "a@/H @#h㿘 #p4 (4 4444444444 444p4444 44444̝㿘 'H'L'P'T'X#`@ H㿘 #`@8N@`N@`%` N@`|`  *` € @wL` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @/ N@ @& N@ @ N@ 0 x  @ N@ % w ls㿈 #x@ @,@  ?L?㿘  l`  !  cJ@ #! @ @   @ *0   @ *`( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" %s: can't open device%s: alloc failed%s: block table corrupt%s: read failure%s: short readdvma_mapindvma_mapoutpromprom0Can't open device `%s' Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d exit0123456789abcdef|/-\bootxx44,44444444   444p4p44444p4,4 D74@4K4Y4 Hd4q4\4`44`4l44444 4 l 4 4444444"4|*4048 4H4tT4a 4g4l4tr4z4 4 44 44,4 44l444 4D4@4444D4!48,48 4E4 M4 R4X4^4j4t4~ (@haB   @@haB,C( @@=@@<@`dT U@haM@@;(0pLl A@haB/@haFe@haFe2ɲA@haC@haCX;@haC X ?A@hU:@haM>@haM> m@hU:@h@z@haMĴX`hpx0 bMm"@hU:@h@z@haM hD@hU:@haMC@haMCeD@hU:@haM>@haM>N>ٔ+ X, :9(LbS&r57-MA<[W~brPbŏHٌ| #BU@`e;LӸ*9%y)aA"5s4'v?ty#7OE׸|jJGp,[_LuF<`u:W<42M,B^yI=h}8(mO! #H: hit EOF unexpectantlycallrpc: error = %d recvrpc: reject, astat=%d, errno=%d getport: %sbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %drarp: bad socket. %d No response for RARP request sendudp: bad write (%d != %d)readudp: huge packet, udp len %ld sendrecv: short write! (%d < %d) exit1.2.10123456789abcdef|/-\arpwhohas: overflowed arp_list! arp: no response for %s`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     error inflate 1.2.1 Copyright 1995-2003 Mark Adler  #+3;CScsLB !1Aa  0@`@@ 8% 8(8)8)8)8*D81|86h86878788p8>\8@8@8A8A8B888 88 8808 88 (88888888   8@` 0123456789abcdef/888x8x88X8X88x88|8)858B8M8V8xa8p8du888888 88@8@8088x88(8\8v8! 8,8H88@A87N8W8`]86i8ep 8Hw 88 8L8D8H8G4 8@8HX8D(8`888T8Bp8H80 8 88p,81|8 8>8adE8Q4K88P8|X 8g8$o84z8o8+8@8b<8 8P8`88|878o 8T8S88 88h8l|8 8\8R(" 8X'8-p28hT: 8`C 8pS8(b8n8pw8  888dX8]88l8u8(888 88 8t 88.!8{.8>\78$E8 P8@Y8Ac8 r8Bx{888Vp8O8e8N8X88$8V 8=8 8c 88o$88B888Z 8`%8/888H8,N8+tV8`8j 8r8){8  88U 88K8y8U\8sT8/L8 88)8h88k 8% 8 08Q %8A. 8h58L=86hJ8 Q8o|X8VP`8k8.}8h 8x88sT8v 88/8 88 8 8 8x8*p888S(#8\+8 x68e>8UC8l|H 8M8)W8e8k8{8h8i(8*D88L8o8YX8Tx8rX 888488 (8z 8T8ZT 8|'85 8@:8hH8Q8Dc8`hgcc2_compiled.open_countnetif_promfilestore.9bootstore.10prom0_fakesaveechopv_putcharsun4_idprom.65dtabstringbuf.75promdev_inuseprom_mapinprom_mapinfoprom_mapinfo_cntprom_devmappromvecstore.88elf_execaout_execelf_seekputchardvma_allocprom0_iclose_remprom_ioctldomainnameinflateCopyloadfilecd9660_writenet_openalloccd9660_readprintfnameipprom_sihostnamelenrpc_fromaddrrpc_portstrerrorrpc_pmap_listsnprintfrpc_pmap_getcachehznodevether_sprintfnfs_readdirrarp_getipaddressnetdev_socknetif_debugcd9660_statcd9660_openerrnoocloseintoagetsinflatebp_server_addrversionnetif_open_udivbp_whoaminfs_closeolseekpgshiftswapipmemcpynbpgdevopencd9660_seek.udivrootipsendethercd9660_readdirrpc_xidtwiddle.divgetsecsndevsip_convertaddrmyipbp_getfilekprintnhostnameprom_bootdevicenfs_stat_typesdvma_mapoutrootpathobp_strategydebugprom_getetheroreadlseek_rttarp_numbzeroufs_closepgofsetinflateSyncPointcputypnfs_root_nodefile_system_cd9660promvecssymxdr_string_decodeinflateInit_nfs_opennet_mountrootprom0_recvnfs_readnfs_writeprom0_strategyrpc_calladler32netmaskzcfreeinet_addrvprintfsendrecvdvma_initdonottwiddlegettickscloseallnfs_mountobp_xmitoopenbootfile__ashrdi3crc32nfs_statnoioctlreadgateipnetif_putpeekcharfile_system_ufsnfsysstrncpyprom_initnet_closesocketsufs_seekarp_listfilespanicbp_server_portsendudpinflateResetmemc   cܔ a !@  d@s* x :?, /,  2  1,, @s d d   c!H ,d  Vb" @  b a:!   `d < $  `l 3 (  `t * 8  `  !!`   6!  ҁ  ?       ܒb8@  a @"`㿘= ?U  ?㿘 ?   ?㿘a$?N ܒ`!@^  2?   "? ?㿘ߒ"  ?   " 6 & & &NaY   aY@r?, /, #a` ,"@r1 &@a$a" @r(&`d 奔 ! / 6 `|    H 8  喐` @&  8&  0&  (.aHa)  6 $`t 儔 & $.a(a ՟  `l w &  x  ;@ 8 ,& ., &,N``Lݐ"x*` €  @ 6 &     "  &6  6 L /2 &,N` 4 `  ` `  ` & 6 aI +  aQ& ?c , *`  ,V&N` 2 `  (` &  6 `   `"` &  6 6 `, @q{,8&,N` K  H@" a  bx& 8 :&,., `H@`  a"@   b  6` `x& ` a: : 㽘  !`'`bh``   , cܔ, b @ ܒb !@'x    :,Q@q  /, @p d ?` E*`ݐ# € 53,` ` 4 3,` , ` aI  ? @ `2 @aQ     6,` ` 1 2,`,  d@p` `|   % `  0 7,`! H @" a  b  x ;@`|    bbܒ` @aܒb @a!   `d\  J $`l S  A (`t J  8 8  `A  2/G  @}a ӟ  @va)!` )  Ȓ!    ?       ܒb@|  a @# `c` ?J/2 J"`4 ` 㿘ܢ#p@$  @c!  $"Hܒc@  "bL@^"H@C!Ѐ` ccp@0 ?㿘! "H'H'L'P'T'X H@@"H㿘`  "L@o 2. ?@s 2* 㿘'P'L'T'X L "a!` 5 1!  @b@k &!!ܒc@s@?@] 㿘'T'P'X P "a!` 7 1!  @b@B &!!ܒc@J@` @bܔc@<@* 㿘@[$HHHHHHHHHHHtHHHHHHHHHHHHHH<HLHHHHH4HDdH  ,<L\l|Xh L\l| !  '//'  @ө ߬ /'|"`ݒ`h@  @ʴ @% @#@x+  bX Ȓ/; 'd9 'p'l'h't'x 3* @€ @ ` #`c $/$cc @$c@Ƒ  c!ݠ @aҐ @   `$c@9 @P c@, 2 `@  / , , ,c"$c@Ւ ㈁ =b`# `@ѐ c b`@F  b`@a ݔ`@ #)=b`c b$c / ]% @+  @an ݔ`@  @ۖ!Ic E$cc@:$c>c 9$cc 5$cc 1$c? @a(('bTcݔ$c  @!8'|cݔ$c  @aH/c!$c @!X #bh@ݐ@ $p?? !X* & @ @yb`ݍDcޖ#L"#L""ߪ`’    H`D" @6@ߒ *-`@OF "@+ 2 ݒah@ -` @ @m!##c  bTݒa@ ` #`` @' cݒa@/   bT @-T`@  @?c cހ#"cH`< 8   % " +c *" "" @ߔ  cݒa@ c䀊 @?c @ c䀊 ?c @٘ c䀊 <` 8   % $cc d $ dݒa@ $  @ #H<* @ *@@ |"cHcH, 4 4 4  `, $ , $ c䀊 &<` 8 2 ݒb@\  ?Ȗ   '/?//??? d @} ( 6 @gd"8@    @l   ݒbP@n    @\   ݒbp@^    @L   ݒb@N  '!?%#@l ݒb@= @'?#@*  '?ݒb@, ! %"< '"@!  "@  "?@4 `ݐ@] ` `p@Y'ޔ#c8@bT#ݐX@bT@ !@| b\@x @2c䀊 2@a  4*`@  ݒa@Ӑ #'c䀊  @ ''@ 2 * +  & l  @ c ' h@/t  x `L c@fpc'@ h@ @ `c#쀢 c@g@Y @ 㿘  L@8a@ ` @  ޒcL @h $L#쀢`  x @| `"  "hb@ߐ @$L㿘!  L @Ӓ $ L?c !+ bX' --  "P 5 ``!J*5 #`5 @4`: @4`   *@* %,!?# @c#' ##' #bX#* #* #*  #* #*  *  ** "T @bc  5 #H 5 @U5 `ߒ  @   䀤@e#?#cݔ@@@(    b] @ ᜐ @ %@l#x @ `-  @ #䀊a@X8'ݐ#@ے0&@ #H@ `   V"  / / / / / / //?" "@ ''Вb@ ?? *`" * "* *… :@B:—@~d  b "p "pB;b ( 8p "x "x1  "P:x1 "P#`@: M@~ <   #`?"'#@n: "P@j   *@ - #䀊`e` b\ @Z v@W'ޔ@ @ 8`` #@{c  @|# ސ @@ `@ X "X T  `@D @ T@͐ `T @ 6%#ސ` 2 @ @彐`T`@  %`@  ޒ`#䀊a  *  @@a @ޔ@嗐@c +'  "    `D " @w   ?  %#ހ`' ` ?"`* "@F     *   @ *   *  @J@I@C`ب?Բ`y?    @?mb@ `'b@ `'䀊  `'޲`@ R%`'b$b@,$b@ ! %#ހ'2 ` ?"`* "@FR     *   @ *   *  @?@?@ܐ`زմ?@Ր!?@ѐ ? `@̐!  % ? 7 䀊   a`?"`! * $!@F  @.!`  ` `? (?888* 2 ?cx !?c' `/   a`?"``! * $!@Eϐ @! ޒa0@e ?#cޔ8@"?#@d?#-ߤX@?c @dߐc ޔx@@dc耢  ޔ@@d`:#쀢 ސ@*?'`&'@B' "@BH` B()"@B ސ?@??#c @d?#ޒa@d#쀢f? ``#  @yI  @yB @{ђ@ @[d ?p   #@y,  @z#  #@y   #@z x#\ #@y#` #@z#d #@y#h #@z#lޔ@J@d?#@@ɐ   @"8㿘     (   @xВ@B: 2   B* 2`@ : b`D 8 怢`  㿘 @   #쀠 @e`?#쀠 @9`?㿐`ݓ*`  €@'"P0 `O |*` €@"`0@"0@"0@ "0 `@"0@#0@#(0@#@0@#X0@#h0@#0~@#0z@#0v@#0r@ސ 0n@ڐ H0j@֐ h0fc @А 0`  00@⼐  @ⷐ  @Ⲑ   @⭐! @⩐!0 @T1'@⡐!P01@❐!`0M@♐!p !@ 0D@␐!0@  "@ₐ!0@~!0   @u"80 "x@p@ 0@j"0@f"0@b"0@^"0@Z"0  @U#0@P#8㿐ߦ  `@G#P 2` 2`  @=# 8 ?ߔ* 2` @4#  # @-# '@S@%c @S'c@,` ! # @c`!`?"`! * $!@C^ 㿐#䀊` ' @%  @Sz'!ݖ"0@!"0@Sn'!"0@!"0㿘 * `  * ߓ*`@ @#0`   * *`@ @᳐ ((N@ ĠȢ̂ЈԖؘܚ Hl `@ ` D `X@4 H 2H#l;p#\#`#d#h;x;#`@ݔ ?#" 8ބ @ @ `. @ ( #䀊`@S  @ #@Kc`@&@D!< @2 2 2`((  H``? 㿘 `@9"@ ! 㿐# $`L@k L J``La`@  " ?a`@ ap@ a@ 㿘@8HXdp㿘a@ /%#)!+-1 '5 -9߀ 8" s* |@€ $@!$`D % <$ , $`D %`H %0$ ,!@/Z   $ , s# "@a@  @ᨀ?А?X@* `@ < `D  `H 0  , @0@d@{! a@K @ h 4㿘 ߒa!` "8+)'%ߢ a耢 @j>a`  !@fL @O$4   %8@ @z 2㿘   % $`  H`` 2   D` @`` b@& `@2 ` `  <`` $?"`` $* $@AJ $Ȓ`+ 0`` ^?"`` ^* $@A+ ^` I?"`` I I* ,`k`/` M?"`` M* $@A M` -?"`` -* $@@ -"j ` bl `  `  `/` ^?"`` ^* $@@ǐ ^E` ?`@`? "`` *:    * `? "`` ,`:    `* $@@"  ? & @}  &  @  8@'! ߐ "4 6  `@a@ 㿘 !`R ߒa "8+)'ߤ a耢 @h   @zM !@$4 T` %8@T` @m 28 Ra (`)+ߐ@|  8a@ d*$ @ X%`$ % (b@ % (@@ 6@ @ (@o`$ 4   8@!ߐ "`4㿘@8 ! ' ' '@K`@c@hl? 2@_ @hdcЀ 2@ V'@h[c؀ @@hUc 2@ F"#L@hKc耢 @@hEc 2 @ '"#L3 @h8c 2@ߐ ?"cL `@!@!X@bu  (?@`@}ؐ @h` ! '@!X@b`  (?@`@}Ð ?` ; +579Ȯؤb"!@@ " !@@g@ 2`$$!@?`!@a ` * 'cL  #L`@@@   @@ @ ܐ Xa@b  la@{ @ ϐ ?"`p "`t@@g(  @@> ?`@   @@g x@ @ a䀢  @  c'+"`"@g@ 2  2 a< " $      `0@}* 4  2   "/? ?@` `P@}  ?`@` ``2 `h@| €?`@ 8 $8? `@cL   P cL`@ Β cL   @9 :@5L /ߠ!  @3  @/aDaL ߠ  @!  @aD  @zט "  @@a X`@a% aD`@z`   L 1aH  `@  D X` @a aD` @y` `@ @ 㿘# cX?!@A!D @Ť $!D?$cX$cX㿘 cL!D '0`@{ @y 6V # ``LD az@y 6D $`L@y 6V @ "?"PD0a@y 6 @t "!"!D0a~@y 6 "!"! 㿐@d̐    `@-  @]0 a@" @P  + , J?bl `@ `  `  @f  @L 2 Jbl `@ `  `"r !X@`A  `  ߰#А @!   "!!& & & & & & &   @`'  @ @ `   : &C @* `< "   @e 25 ``!@"*!@   V  ` @  b` b V   2 $ @  $ 2  ` "  c@e~􀤠`@U`  "a@~X@ 㿘Ő !aX @_!aD! @xaz?a(@Q 㿘!aX @_!aD! @xay?a8@< 㿈  ?' %D#0ax@xl?2aH@% @ڑ*  ah@ ax'D@xV'?a@ 耢 4' % )〤 ` ?"``* $@! @b!䀢`"J@ "c`@x aD @va @#p㿘N 0   ` !*`@ R``x" 2 # s)  bl@  `D " bl@  `D #@i  #@Ԑ#] 4 bl@  ` " Ѐ !*  R ?*  bl@  `  А !*  R ?+ N \2 `" N @_ 2 ,  N` `@_  $ 6&"@ &㿘 `  0  ` !*`@ R``x#  "l?  ` 2    ? J    `〢〤 2#А#ؒ@0@#  #@c &` ! ''ĐȒ Ā !/aX @\!aD!0$ a@t a@Ԑ#a @i  ! ''̀''e  @Jg '̐!'Ȕ?"? 6"P  @Jm  2NȰ !'N?  bl   ` ) N  :% *: ?'̰  )t Բx't ( ;t`$$? `` @ 0-ax't tt "t''Т ` ԑ,`@""@```aX @[|aD @t]a耢?a@= Pa @Ґ `x !'aX @[[#aD0a@t<?aD@ p 'a@t/?@  @ x !'aX @[-#aD0a@t?@ p@  bɒ!`?"`! * $!@7   ???????aX @ZĐ!D0a@s x   a@=ܐ  8  " " `? !D0a@s?@ r      , `"  $   "l `     :"     @H   @ ؠ / ` ,?"``* $@7e ,@`@=kḠ  ݢ``?"`Ḓ * $@7F   ??x?aX @Z!D0a@s  a@=< `@̐ @! @h!h!8  ߀`'%H  ?????aX @YaD0 @rŒa6    L`a(@y "#HH aa8X@u0  @(!P㿘!8`!h#cHcȐ * !$cHaX @Y!cH!aD$ 0a5@r ah@@ 㿘!8  ax@t %a@t H `4`@,`$H㿘|!8  a@tؐ b@tҐ cH@ "ah㿘b!8  b0@t b`@t cH@r "cȁ㿘H!8  b@t 'b@t H?# @ ` `@:}`b@t *` $H` @2```2@"`"  @2` 2```2@"㿘#@<? ǐb0@tF 㿘@U  a@u # <@2 ?!"P@t% # @ @os`( @7㿘  "?` 2   @G 2   2?㿘` q@H"p"""x @9x`<` 16 %? #-+)@`2` @  2`  xbb@x  (b@ `@ @ `` 2@6 `@"p !'"// "@aX @X)aD0@q aK , @ !#\! @ `" @l!#\ @ "@ӷa @X"h ! 'aX@Ӣ#R#@!`@Ӕ 0!䀢`@Ӎ @  a`?"` * $@4ڐ `` `  ` @@@j P@ :'@ #0 @   ?????!X @WDa6@px 耢  `@|!X퀦 @*  D`x@# a6@p_'쀢 6`@ @0 ؒ ܔ ؀@;`?"`` * $@4s `?"`` (* $@4a (  `?"`` )* $@4K )`?"` * $@4=  U-@ِ  @ 7   ' )*" @2 @2 bxఘ  ` ` @ҩ  ؔ*@`2і @җ `?"` * $@3 L )   ` -+) @ 2耤@q @n`@  @h  ``$ݠ @$ !@  @ 0"`"ߠ!  ,  € $ 2 D  @ x ! 'uaD     L`+a`@ #! !X@VXaaa' '' '@C'@!X @V>a!D0a%@o a䀢   L`1@!$$ $$`" +aP , $0a"!D$ $ $ @n? X  L`12$ $$ $ @ѐ!X @V!@CH'ܒ@Ѹ! ` @ѳ!(aP`.$0a#!D$ $ $ @nȔ? X  L`1$ $$ $ @!8X!@UΔ `  '@C@у!H `?"`Ḓ * "@2ѐ a @!X㿘!@`€   "cP`??` *` "`*` h !' aD     L`+J`@  ܐ  ! #\ ! @ b@Uc!@ !haPЀ I) ! @Ȑ!X @UQ 0H a"' ' ' ' $' (D''@n%   L`1" @!x  ?  ?//?' !#\! @ b@U!!@Ӓ ! @!X @U  0H a%' ' ' ' $' (D''@mޔ     L`1 @ﺐ!  @@Ц! ! @T!X @Tݐ 0H aI' ' ' ' $' (D''@m    L`1#@! ` @z! @t! @n! @h" @b"`"(@\ #T`` ! @!X @T (0H ' aQ' ' ' ' $D'@mb' 6   L`1">@="89瀢  "2@Q$ @""P &@""`@!@"h@ "p &@""`@!@"h@  @"㿘#Ё㿀 !'' aD     L`+a`@ !"! aX $ $ $ $ $ $ $ @SD0a!@l !X  L 1 /2 瀦 ^ $ " " " @"!X @Saߠ  ?? ` ` " @ϓ aP # D0a"@la䀢 a  L`1&!$ $ $ @!a!X@S ! " "@m P   !  "@a  `?"`Ḓ * "@0 a @"㿈 aD     L`+`@ !"! aX $ $ $ $ $ $ $ @SfD0a!@lH 6!  L 1 /2 瀦 a $ " " " @"!ߔ !X@SGa! 7 7 7 7 7 @e7@#aP ,D0a"@la䀢 !X  L`12&!$ $ $ @!!X @Sa! 7 7 7 7 7 @67@Ő!  `?"`Ḓ * "@0 㿘 #@"#@ !D`   L`+`@퇐 !"! """ """"aX@  2!XӐ aD     L`+`@d !"! aX $ $ $ $ $ $ $ @RD0a!@k 6!  L 1 /2 瀦  $ " " " @`"!ߔ !X@Ra! / / / / / / / / / / / @1/@.#aP 8D0a"@kKa䀢 !X  L`12&!$ $ $ @"!!X @RQa! / / / / / / / / / / / @/@!  'a( '' a' '̐ ''a !7'ܔ''''` 1  " ``` "`@2```@;# !`?"`! * &!@/  ` !' aD     L`+`@    aX?????? @Qɐ!D0 a!@j   L 1 /2 瀦 f????@}#0 aX@Q@@f@!D0 a%@j   L`1   ??? ?@\#P @m@H#h!P`!!D0 a"@je aX  L`12   ????@:#xaX @Qi@I@$!  `?"`Ḓ * "@.r  @#㿐 #\.`  `, ,  @2Œ @6 @  0@;  #@`  @*$ c@l 㿘 #\.`  @T   c@lr `, ,     @l 0$  * "@  * *㿘  N 2 , .`#@̘2, #@̑2r  a`?"``a <* &a@-ؐ * &a@-{ >p #l.`  ?ؐ ??? ''b`@wԀ  @Jc@k ` "`c@k  @ `? @?@  `  ` `&`6` @1tԁ㿘 #l.`  @S  c@kr `, ,    @l 0$ $ $ $  * "@  * *      " 2 $ " 0   8 2 `8 씂8 2  &  㿐ߒ !*!`, c@k  c@ ` ?#@  c@j 4 , 㿐 {77`@  @ `@j̐ !2 2 㿘`0@U  ߐ *a`8@T ߐ *a`@@j 㿘# a a ,a  2  4 4    X  @ a   8  `@j a6  6  6 㿈 #|.`   ,, #@@ 耦`4 4 4 4 4 4 @ʶ 㿈 #.`   , ,#@@  , 逦`, , , , , , , , , , , B4 @ʅ ؁㿘 .`# @S @ `  ,,  , ,㿘@/"c㿘@/ "cHa@j !@ R  a(@i   K* 㿘! ##  㿘 aP@mM"@5 x !' @aDߖ0a: @gD"?耢`؀ " a  @  pa @ x' ᜐ'@/#,2    ""㰐@ؒ ߰!aD0& a:@g?aD`@ǐ  7a9@g?`@軐  @w ȁx #' ᜀ`'`@ii @ ߢ!%D0a:$`@fٔ?`@蒐  @M cD7 a9@fǔ?`@耐  @<!x' ᜠ'@q ߢ!%D0a:$`@f? `@_ @_D a9@f7耢?`@P  @ !h !  aDߔ'?"0a???@fr'耢?̀ Ȁ`!8 #*` ̐!H@7! @ؐ!xh'   !%?$ ???D#0''a@f>?a@ @MM Da@f0?a@  @!h' ᜐ'@. a@h !%  D?& ???#0'a@f?Da@绐 '̒a@e?a@簐  @l!ȁh' ᜐ'@.K%߰!  D?& ???!0'!@eϔ?Da@爐 'В!@eĔ?a@}  @9!؁h' ᜐ'@.%߰!  D?& ???!0'!@e?Da@U 'Ԓ!@e?a@J  @!h !' $@:aDߦ  0"@ena? a@' #  , @@: 2 'D0a@eV䀢?!a@  @ː!x' ᜠ'@ ߢ!%D0a$`@e5?b@  @LDD a@e&?b@ߐ  @"(x' ᜠ'@В ߢ!%D0a$`@e? b@澐 @D a@d?b@氐  @l"@x% '@-K#߰!  aD?& ??0a@dє?aDb@抐  'a@dŔ?b@~  @:"Xx !' @naDߖ0a @d"? O؀ "p@sa @"㿘!ߠ P@m$!㿘@ה㿘 D@QD`D㿘 D@Q>`D㿘`@ @ ` 4   ? $`$  ?㿘`@ @ ` 4?    $`$ ? 㿘`@ @ ` 4   ? `  ?㿘`@ @ ` 4?    ` ? 㿘`@ @ (`( 4   ? ,`,  ?|㿘`@ @ (`( 4?    ,`, ? i㿘`@ @00@4 2  @44@( @ `@00@4? 44@?>㿘`@ @00@4?2  @44@( @?`@00@4  44@ $&h&h&h&h&h&h&h&h&h&h&h&h&h&h&h%x&h$&h&h%L&h&h&h&h&h%\&h&h&h&h&h%h& &<&h&h&X&h&h&h&h&h&h&h&h&h%t&h%,%&h%&p%%&h%$$%%%&&&,&L%<&h&h$㿈'H@z  !'@iܐ"Ȁ @+ "``h @c2 ` "  ""\"07 "b -@   "b'#)91/3;+ % G}* T@€ &%!$bX %\%!&$Tn$bX $bX'"D%!&$Tf%\ %!$T%\`& $T%!&$bXY%\ '"D$bX&S%\ &!O%, %,K&! G"H ?D  A&b   <"b "7&b  3"@ /"b +"P$ 'b4&' ""bL " "0 "b$ %` "  "< %` "b@rH@ܔЀ?z? !XH*bX'H`& bP bX bXH  bXb bX` " bX    bH " b 2 bX  b4@ѡb4b4 &!: 'b4b$ $`   >  : 42, ,`! &#8      b,,  ! `d$  T |bX  b"! H"a "耦H@   @ @b8㿘"@`  !@    @n @B@k "`d" ` `  @L5 ":  "N`D0B6 "5`0= . !V`6 "`3! `@R"  `@J" $!@@)  @ 0#@h`D0 `!@;# `D@_ "b8@ 2`8L c(@  !'H'D' M "P` '`"X` "`H '`H'x'|' ''t'p'l'h  'd'\8 D@;RD@#  $  ""82 LD2("`2($ .2 ("`2( $ | 8'|` @8< (< 8' x 8'x08 040"X `z'"D` #8 \@iJ @iD#8 \ @Ԉ @Ե @h4'h@l 4'lbL  @x\DN #@@op@ 4'p   `  @  `  @*   @G~$@ @  $` @Gv<  L 'tL ` @  $`@G_N`-"$@$d 'd2(8d`K|'`'H /'t''# cH@h@'l p''cH@h@'xcH @h@' P@h@h?!@"X  "aH  @  @e#X㿘 8"0 @`8 )   "  ?L"R 6 "`2   ?!@€㿘_㿘  "  @  ` ?"`* "@#   2 p !'R6 "X`"` b4 @@?#`)'  6􀥀` ? "`* $@!   ߬􀥀   ! `?`$``@ * $@  2 `?"`Ḓ * $@ ͐ 㿘"P`   "` "H`2 `M% ` E >` ,?"``* $@  , `( ` ` ?"`* $@   ` ?"``* $@ p   M ``2` `?"` * $@ X 㿘<(@-  @@ I0L0@-8@8 I0D`?"``M /F /`?"``@ |9 |`?"``3 @, @ `?"``% = = `?"`` % % `?"`` *Ḓ ** "@  㷐 V 6!'2   D@d9$   D@d/$@[# @5`L "c@asa. @S @(a @} 㿐"`@A?? @40#x@-㿘N 1% #*`: ?l  J   2Nb0  ?N !`?"`` !* #!@Y  N  㿘 s# `(@a"@ 㿘@KFhFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpF4FpFLFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFFpFpF(FpF@FpFpFpFpFpFpFXMN|NMMPPQPpPp㿈@  @J?`d   "!<`  h- ) # ' !+ `< t*` € %!D $aH $aH  %<  $@  "aL @@۔?ܒ?aX!D*`@&  aH@אaH <  "a8< @@ŀ /   @鯔  !8`` * @鵐?@   @E  @B <@( @O p@!  @H <  @3 @ 6   `@@ ?7'@'耢 " !D `@@  `@ @ !#@b " `@  @a@ܐ @ @  ' `@p(@ɐ 9# 쀢` `, "@`L 2@`2 #* $, @, ?@    L @4 @;aP0 @8@Ք 㿘@)  a`p@ O?@h`  a`@ 0 @ X   a`@ @"4? X@  $ @­@V "   $ @\$ ( (`$  <$ @  $ ,2 $ ,@C`쀢 2$"` @?@㿘 쀤   @ T @@ؐ`$쀢`"  `2@ `2` 㿘@u    a @   @& P    a@@ ?*@& T*`*`*`*`*`*`*` `@V  㿈 @k a0  a0'쀦 ' @@ D@ f @4d @ !H`  ,b`x @M  ,`Q!h*` €@A    D& ,2 @& ,>& , @ & b` @&  & ,  ` $ 8"@`& $ & $& , ` !L`@z0 & , 0@0b`@ & 0& ,@_ @耢   D쀢@&'  6' D' 2 @00 쀢  b`@ѐ 4 @ @ @ "`"`""`#@ " b`"b` # А"@# &"` !H` "` "`b`@ "`㿐 8@zՒ  ,4!|* € 4  && 4 <& 8& 4-  !L`  !0!0& 8 & <@`!@"@@"@& 8"@@q& <  0   & 8  c0 @Z 08a0 8a0 <@& @& DcX @E 0#@jʒ  8Дb? <& @ & D?/a & @& D !H`  <c 8p @" 㿘 ! @}J?`d ! c@]""@]~c0 c@]y""@]uc@] 㻐 !< a'P 'T'X'P !8 4a!  @a*""@]V` a $@_@柔a @yА (㿐! !T?' ? $!TaTP*`@ !T??$!TP "$T@$P$T@B z  PT) `F`2E`2B @"> `29  T P.  @C  2  `2(T  !H`$T@ 0TP`@䵓*` 2 `P@ج @:$PT P*`" `X@ؠ T $T 2 T`"`P@䔓*` T`P@؋ $P* "@ aH T  P!.   @ǐ `TP@CyPp at   @ @ $at`p ax  @ @  $x`p ? "aX aX*aX *  " " " " " " ! @֒ Ȧ `pЖ  |?  @> :1• &  `L@0?`p 0g'Ԓ ) @W   6  @0`L `p͔@& 'Ԓ ) @V  6  @0`L `p@  ??`@??'  : @Vۘ ?"!"h$ |atx` DD @"` @" |%#`""  """ "" "  `L@0E?`p(z p  "``'!X``!X''  a '' ''' T "  P" ` 8   $ )## # #  """   "  ?  @      # # ##   ,%HX *` @    P@  L2 !H`$  0@/א H   0 & 0 @x!P !'! D@XU      @/`LaF D`  `)%  )   )`$ )` ) ` ``"` ? @   `2   ! ! D @  .`@) `@;8   .`@)u `@;`u c!  .`@)^ `@;Ғ^ L!`1 ? ?    .@)A `@;`  . @)/ `@;0 !  .@)  ,  "  L , ` $ L``!$ ,z$ 0! @w #H ก p !' @#`0a@To  @.`LcXh H?2!7` a@TV ;? @.`LcX.  #Xǖ@P  #X   #X   #X    #X ? @v H !  Т '???? @7) 0a@S 6  @.;`L`(@)  A A26  ( 1????? @ 0 a6@SՔ   L "& (@.`(` F?a` Đ  `   a @v.  G  㿘 .@ G.` ` .` * * * *  * `@^ X   ?''''   @tƚ H @ C  @t @7 @@%  2  T@۔Ѐ`" ` 2 @y0 2 @& * @ @v @@Ɛ0 㿀   )'''''  @tj ?㿀   )'''''H' H@tS  ?h !'  @   @--`L `b@Ố @>0̀  @-`L `Q@᪐ `I)+@x`@x2;@`@x@&` 21@`  2,@ ? ? 2%@ ! @/ @א @@u0HaI@R   @,`L  a@i @?N@n `@?E@n? @t!  : `" @ ``@ "`㿘 a|  @Ȑ @  &!|a0@̐ 6?  @ ;•`"  `L@,?a0P 0  @+  !| ؖ   @" " " " "   `L@,a?a0` 8 !  '` @ג   @,G`LapP| Ta !(@~~a @90JaJ@Q   @,*`Lap_ 04`( 1  /-쀤"" 2  @ 2`@ ` `@  .@&3  p: `@@ `  ؀@na @t !0' `ᜢ'  `  ? ? ?  `"//'''''#@`"``  ` #` $ )#@#`#``"`"`"`"` @  ?@``@      #`#@#`#` .@%ɐ @8<3aȐ ` @ @8* @+~`La   @s"8㿘@?rrrTrrrrrrrrrdrrrrrrrtrrrrrrrrrrrrrrDrrTrrrrrrrrrdrrrrrrrtstlx@x@x@x@vlx@x@x@vvx@x@x@x$x@x@x@x@x@x@x@x@x@qrs,sx@ssttx@x@uvDvXx@vxvx@whwx@xxTh|4H\p(\0D T0000000000000000000000000000000000000000l0000000000000`` !b'b" ""''''''"b" " " " " " ')jX '''ЖВ(' 7%j-j/j''''8 /* @€"T* h%"TL  * :  2*  @€X 4XX 4XX 4XX  4XX 4XX @4X@ L  c $ "L@  "T  " Lb@Q  `%"T@Œ '"T@ @9$ ""J $J`b@Q !b@Q "T@'%"T'@eu$ J !$J`c@Qs  9F@?  @)+ c @Qb F`  "'"  …DB'$` !c@QJ  "T! #@"T@ʐcH#$`"T %"T@ "   " Lcp@Q. $@93  'J`$J` !c@Q c @Q "T@*@y%"T"T;"T@ %"To"T j%"Tc@P   ? ???   :'''' @毖  @s`@Pߐ jx@qLb @""T :%"T$@8Ԕ   ""J` $J`" !`(@P #Ѐ `H@P "T* "T!%"T"T* "T* @ %"T@IH@f\ aX* & @ @7  ? @ 2'`p@Py "T@ . @@    @ . ?  ?  ???  :??@ " @r`@PM   j"Lj"L `2 `@P< j@p0 @ %h`@i "T@b" j@Ax `@X  4  ??x??   :'|''@ϖ "  @r`@O  `"T!@`  )` h@N!` a@$ @ "T! 'h ) @N  ha0@  ) @N  aP@ @C@rN@?@"T ` ap@O @(   j"j"""T! )0 b!0j "")0@ڏ 'a@ѐ "T   /@ `@ ?c jbbp"*bp *******@U$  "T `@ '?hc @M j "8 @`'h ) @M ?"Ta@Ύ "Tؐ   ?p?X?`?hh  'hh 'h @yA h :ؔ @Mf "Ta@h ! 'h ) @MU  a@W 쀢`(' ? '`@  `"Hb@N b"  " 쀢`%`'" " " "  %` )%` $b%@``8` `(   @7 耢 "`b @Nΐ   %` )b%`%`%@``(` `   J@U  b@@N +'%#, @ @f " @q9@N   ` X@N @?  b@N @r ޓ, @S "@b@Nw bb  ?@ @ "T@L '  @ bb@͗ j0j`x` ` u` " ``* " " " " 2  )@Lq  jb@s j@ x 6jb@g x@ b@] @h`#  @͟ch!?##`@L@  hc8@B #`@L4   cP@6  @@|0?'hc@L  'h ) @L  h@<chh ) @L  @1@@  (?@jbx@  @j0@  @  '@??'!@wm !@wi "T`j!"@wa  b b ''Ĕ ''@KȐ jd`j@j"PPb"b$b  "(b$ j@b""$bbP b@ j"Pb( "T@b""(b ?@ h '7@Ē    `L b"b$'L  '<'D'8?('('@h?0','H@M  `L b@̈@m b@ b"T!@jb@j"l`bj` @j`@Y`?  b   j0 b0 $ $0P P0( (㿈@; j"``  "0B ąB' ' '(a4'''@v  @J jT2 2  (   xj"l`jd  ? d" "d*!b "0. . . . . . . @c-: @c)jbT    ,* &,j bpbp  .   . j b8  -" .  . . . . . . 6  . . . . @l˔  "b j bpbp  .   .    6  -" . . . . . . . #. . . o. *j"Xj pp `* `2.  ` . ` `2 ` `-". j. b8. . . . . . . 6  . . @l  "bD j bpbp  .   .   6  -" .  . . . . . .  . . . #. b"j*`,2`2  -"2`2 . . . . ` .  @\[ ''ܐ@ng  "`jbhjb  0?# "`"'? "`"` '@ bT 6j@ (j"L 0@bT    b @;   b (b`?㿘j br@u `?㻀 @!' .S-   `?$  '$ @,F K`M @2J &@@`+=`) '7 "l@J   `h@QK$$ې@,Ր  * ` `@X@,:  ` ``2  %@ @j p@ !' '@[{  `?@ j` j   j"Tas@d p j"Tai @ @Ua @@K W @& 2@A M 2  j j`*`  b  /"` @m: ''@)b  ȅ "8 ?b@( HD LL? :"8H:b@:( "0 -:"0/ ,  b2`"0 @a : L@a <  j\ "``?"\'"`@`:  @`   *@ , j"T`ܸ` b @ "T @w6`@!@!8"Ta  ?Ȕ  ??'//  '' ' ' @S'ܒ@g!Hjb !P@^ @Y!` 'b '``:q"T @  !h@Cg"T Sj_ M'j , 2 `# b"0b $`@`y: Mb @`t <  `j"\`""\$`b @`d: @``   *@ -j"T`I @!@  "     @!"T@! "T!@ "T  * @`"``  `  @ː""T@%@"T@.%@"T   `?!' M'% #! " l@J  `` h@ `  '4"T 3/-)` @  @l   @l?, ' `("0@v  $ ٤@gb"T!@a"8   %@ "@"H@Q %@ ` `?Q"``N0Q @<"(   "X"p@/`"@*` `"@!"( " '`@"("@` 뀢  `@"( "@ `?"``Ḓ )* "@ L )"Tj"Ta) @͐@!@"T    a`?"`! * $!@ & "T!@@iA! ! @ha"㿘     0'%#  )2  "     @@ @b@%   ?  @   2 㿘 `?"`Ḓ * "@ ʐ 㿘 `?"`Ḓ * "@  㿘 ) % # @@K"    " 6 6   " 6  6  `6 `6 ``$    *2 2@@@@6`ƀ 㿈#@ jbT !    "@#(@@#@@c#   &? % @"0S Q O @/ `/ `/* ` B/.*2  * @  6` .@, ?#5 @*`  '`,`,`` ,X` 5 , O  ` * @* `j"T a '        @"@ @|"H  @v#P  a`?"`a * $a@Ð `4@`#`@G  " `9/-+)  @ . p@ .@>x #@7ca@3a` ?"`a* $a@ `Р  @f#   )   `   2?   )  $ `   2   `  " Є@"" @ "㿘@  @p @@̄ @Ҭ 㿀j"L!j@#"d@#j` @#j b\`@ "d b`@$'@  '  H…F? @q   a`?"`! * $!@ b`/j"`+\ ' "@b8 ƅƍ"?#FD @3 ? @-  "0 "0 #\(,;` `@2@f!@f!P !`'*`! € `!!ԓ*` €@ p @ !k @!@f @!ha @!\ @!X   * * *` @  H!   "  @ܐ!< @ؐ"8 "(@Ӓ `3 @ΐ"H  "     @"` @"x  @" @"  * * *` @  "@ @*a@"%a@" a@"a@#a@#a@#  a@{#8a@v#Pa@q#ha@l#  @ . 2cp@ .@Z#  @ . cp@ .#@Ia@D##@?$  *` ` *`! €@0#j@+#j@&#j@!  j@ j@"Hj"Ta"a  "   050    @ . 24 @ 8a@ @ Hza"P@ X' $  h@ڒfa@Ր paa L  @i . D  L*  @Ka@ @#  *` ` *`! €@#j@#j@#j@  j@ j@"Hj"Taa `@ a "X*` @{ a@u a @d ȁX % ,  *  *`@ *4 #? '*@U   +     2`#\@G   @ߖ . 2cp@ .@5!   @Ζ . 2cp@ .@$# @cŐ!(㿐jbT@ `?#\! ! @ߚ 1#p 㿘&@ '@!0h K ( <? * € !8 !@@!H2 !P@ `)*` !X@0@@͐!x0< * *   @!00 * *   @!0$!@ 0 &@  &@  `?"`Ḓ * "@ 0@!(N@ ĠȢ̂ЈԖؘܚ Hl `@ ` D `@C H 2H#l;p#\#`#d#h;x;#b0@ #" 8j @ @ `. @ ( j"T`@1"h @ #@)bx`@&@"" !'@* . "@f)"`?Z@hNx,   bl@  `  !*  R *J 2   ???????????@{[w/w@{f @{b@{b @ E  @e  @W!  @# @bR"㿘 b@E"@Τ 㿘@㿘@p#p"b#p`@$c ?L " s $c s#@,qc`?#p$c@a֐ %p@$@8@4@ @!@/c @-0#@--#@-*#@-'###@  @0 c`@,= ?@- @J@ - +J` 2@@. 2@@. @.@   ?@@ "@@U`@" `?  @3  @3 @@0@  @9@ɐ  @  "  p# c #@1 @)@=;@ @< @  @  @a 0@i @Y @S @1@S 㿘@dא  @@%㿘@kJ  #@1 @6  JJ "  " J@! J ?( J@( 2  `J@   㿘 j"""p "c@  "t p" @@@0@. @<@Z(4@LXd|`' % ' q @a# b j"@a1 , $b@=bX"h #`n"Y `2"Q `"K oĀ`KJ jĀ`"K `E aĀ`Da,E Z !@"J g"@ d: KĀi`"9 "@6 A%"@"5 #@- 48!@"* p"@' (%2 H"                      2`Hp̐ Ӓ ~Ր ?'pp #<","h''////jb@` ,!q  @N7@  $ @` 㿀# a'` @$ @ @ːa @_ (㿘 " kJ    0 @ #X 2 @%㿘͐ "k@ #X 2?@%ߐ㿘 "k #X 2 @%㿐`h @=/     2 2 p"#(@j 8 "@ p @ p"#(p "c(`p"#X@Q H "@h p P p"#Xp P"cX㿐!j?"؀`'2'-"*`  X ` h  p  x    ~    ","ؐ *` 㷀/ '@  !k$#X@$ 4 $#X+  $#X`-p@0P#p p"cd p"c` %D $c@  p"cL p "cP"cPcPppppppp##8"c #c0"H T"\  4p"#jc' k`"# @ * J k "cH "cH!k "cL "cLp# kp# 2cP!k"cP!k"cTkcP 2k "cPkcT  "cT!˒!k $#J 2    "$#! c@k`"#J     "$#!(k "J  !0  ""!8+k %cJ 2p p%c"c$ "c$)!k#k #\!@aH # @c$# c$kk#\!P(,@aX%# c$kk!`04#\@h# c$kk!ph8<@#\K!xk "c@ "c@! k!8!k "cDJ !"cD!)좒 " cJ@    @$s k @"r"@aF @'@qk"c!좒 c J@ p #( @$I k @"H"@a @'@Gk"c !ؒ좒  !ϒ젒 D D k "#@(k"ck#J   "a @]t!ȁk\ \㿘p#(!k1@$$#\#\㿘N  N@ *`  "b*` "N@  ސې6㿘\t &&&k &!hd&  &㿘p#쀢  pkp]#PT@$_c(p#̀ 2  kp]#HT@$Sc(  "b㿘! " p#̀  pkp]#LT@$=c(p#쀢 2 $"kp]#TT@$1c($"㿘k]#T@$' 㿘kp]#T@$c(㿘k]# T@$ 㿘k#@#Q ]T@$ 㿘k#@J p#(] @#T㿘@+ؐ 㿘p# 㿘kp]#T@#c(㿘k]#T@#Ԓ 㿘p#@ k]#T@#ǒ 0k]#T@# 㿘 "    0 @(@P@9@)8@J@: @[@K㿘k# ] @#T  "b㿘k#$]T@#}  ""㿘k#(] @#rT  "b㿘k#,]T@#f  ""㿘k#0] @#[T  "b㿘k#4]T@#O  ""㿘k#8] @#DT  "b㿘k#<]T@#8  ""㿘k]#DT@#- 㿘 ?@,?@  "!!!@K ?" @c 5  "@,  05!X   @ ?@S$?쀢"@@+ 㿐k#`d$` ?, @  #`  @#` $@ #`( @Ek`  #`k` @ !p`?#`?k# `$   "`k#`$ k@} 2$#k#`,    "`   "` & > @ & & @ " #@ %k` * 2@  * @ @B ? 4`2?@(?`d2d d@ d 2d ?@Z ? `2 :$"X@+U bs?:$ "? " `  ?*#"  k #`$" @(Β ?倣  k"h@+0 = k#` d;  B;d   & p#l ;d0  @0 '"x@+J@[F  q  2+?k`@, `"` @ "@@& &@" #@  "`   "` & &  " # `$( @[%k  㿘?  "?"@*Ӓ  ""k#` `?( " #` #`  2 㿘@ W? 4^ @ 8Y  c @ F%k*`2  $ 1: $$@) %``d45 d8/  d@?q  `d2 d@ ` 8  +  c @ F+ 3` @* @ ( 㿘1k#`d @d#`:0@D?     @L?q 㿘 q k$ #`2 k@4  2 @( #`2k#` "(: pl?k`0?k`$ ( 0 $(( @B 㿘!k#` @$@ ( ?#`?(#@`"( "(`B : 㿘1k#`d( ? "d(d 4#`21?d$  #`d  #`d ̐B? #` ? B?"(: k#` @$@ (@     ?  8 ⠄  ⠁㿘k#` 2??0:0  !k??:#`2?!k#`@$#` ;$0$0 $4;$ ;$@#$($ ?? ?#$ ;$0#` $ @Xc ?"@)* 㿘` @b  k#`?d? "d;`#@``#`` "`"`#`#` `" "`   k`*   ?㿘!k#`@ c`` @"`@@ä"c`@2`#`"$㿘  @X ?  㿘# bl@!k $$#`$8@bO   ???:$ "$:$0"$ $#`" ""$:$"$(` blӐ bl#`d ?"d bl@#`k#`d?""d:㿘!k#`$  #` #`d 2   2#`@R d#`?"d` @9#` "l$#`@Β k`  ? lH `?? l   㿘  "l   k#h k#h@= 1kk@ "l@    k #h@=ݒ 1k#h@=֒ 1k#hL\(x| lxklplll"!x(p"ap"|"ဝ㿘ll"!t"ap㿘@&@Zlp!l@"p@Z!t@$!t㿘k@Z#p㿘%lx@&d@Zapx@$ap$x%lxJ "x#l@ZzappX@@ x@x㿘!l#l!pat@ l !pat? $!pl!|k#p@l"!x㿘)p'lt+l#X%k" 2  a|p:  @ J pL@Z7 @t#X"@2`@:`@ pL p$lax%a|㿘)p'lt+l#X%k" 2  a|p:  @@ k?L@Z@t#X"@2`@:`@ kp8?k#p$lax%a|^㿘%lxJ , #l@Yap!p#X@@ x@YՐ#Xap@@  xxJ  "yx`@%$x@Yap @$ap㿘#laxk#p@JP!l@Y!t!l!p@ axax@Y$ax!p"@$!pCN   㿘!k@Y#p!v 0@Y#plx#p @ x @*`@ : @x *x㿘1l!x!k#p@ !x*@`J@ 2 `!xl!  !x#p@ L#p   㿘l!xJ V 㿘!l!x1k#p@J #p!x#p@J 0 !x#p@J  㿘1l!xJ  !xJ 0 !xJ   㿘kJ#p  l"!|lax*`axl!   l  ᄁ㿘 @ Z?`dp6#ȓ*` hd1l!xJ  1l!xJ N !l!x1k!x#p@(!lJ !l!x1k!x#p@(4 J . l,"!|l!x 0%1l!xJ  >- [l "a 㿘la "a@C  z  㿘kHp  p6.@.@H@(0?д(`? H@F26k#ptTdd xlp\lxdl4XH Th̝㿘@* @"㿘ls"!z7l쀠 @ 㿘!l! l  W"a! @Z"!!T"! N"! H#!"B#! ";# 7#(" 㿘l"? @#0#8l /"a `#@``   #H  #P ɒ 㿘}}la`*:9#*` l!@0.L@ +"` "`! "h "L@@=L@ $"h$"hl"!lL"@,"l! L`&L@0l! L@L`㿐!l!쀢`/:!D*` ?Ѐ @֒  d} l:o$! #lLb  p plb ! ? +   @p p " Y"bk  #<Mp#,ILb G !l" ? ,b@  "@cXK @  -/// / ٖ : d  ?`; : T*`   ! " @la  "a0  o !  ?݀   3  㿘@# pc? c?c  @& 0c@"0 p#p !p# @$#$#㿘 "`l!@G@"?pl:p# pp#t   @c"l p p"##lb @'Z @!- :$b@!>p#؀ b  @U\pcX ( @!,#`$b㿐 `0'#@";㿘 `l!@"J" @#Q l!쀢   g   0 @-o㿘! " "l!$""l!쀢@ #@!  "* $"㿘@U? Lݠ?:L㿘@!l!!! @g @j !@Ɛ0+  >$!@  @  ` !l!@*! `$!`瀊``#@! @㿀p#(l 2  :  p"" el"!#q`l  l:  *@,op# ?W` l e`;` 2l e- e!l!쀢 "/ "l !쀢 "/ l l)/@'쀢`H ??`c:"*` cȐ   `la a !l !a p"#!l!  !` @: l쀢 J lll  "a     :\ll  "a     :Jl!l! ! `la!l! ! "a    J@H  @3` @ "` g .`"+ ? & +`J`g+` f`J@`J@J@"`J@?`J@2`?`@ Ɔ d㿘 d  f   d f" d㿘 !@㿘 !D㿐 !Hؔ @0E 'N   !Lǔ  pp#<) !'@ p7 #,@ 1  +, ,԰ ` ` 6 d` d Ԁ!?3L ?! !C! @Kϐ!㿘@ @O5w@O/&@@  0&  & @   @Ք ?@   J"N@ "    J"N@@`  ".@ `@ Հ㿘`@N@ @*N@  N@ "`@ `@ J"?8J?   ?J?8?㿈# bl "@耢?bl쀢?bl@@! !T "  @bllb @!T@O!T$!T ""l㿘  "l@0 @㿈+ bl" @abl   @^ @'@ @ V a(@5  !P L'@ '!0@>@耤@>@@ @@@)q @&z  '@'!0@@p#Ѐ  @` @ !8'@S耢 y Y@DĀ@ ""p@ l"!T"b @8%blblp@/cp "c "h ! "t@`?p" $"t@@@!u" q !0'@@z 㿈@  @ |     @"l @Q ! @~ "l@"l @{@m 㿘 ""l@2 㿘 ""l@: 㿘 q   @F@P퀤 А 耤  㿘ݔ 㿘 "lՔ 㿘Δ?㿘 "lƔ?㿘 @ "  @_㿘1 "l ""l@` "l㿘 @W?㿘@@}    ` h 㿘 @I2!P " !h@ْ Y J!(㿘0@?@{㿘@Lΐ   J"N " N`6 J"@2N  2/,  ,N`&  J"@2N  " ,@@LN ",`@O " ,N  ,㿘! !㿘1 !X 2 !XӐ! &!X!&!X!X㿘. @> @ 㿘٠@L]L    *`J":`@ J"@ L 2  L   `/ @L2 c    J"Jbؒ@.ΐN*`:  @"@ ; ,N  ,㿘 - L@ )@K@K @Rt   !@.@$( @ @BS@㿘/!˒  㿘L@) *`: `#`%2 @(L`L "L`L@ `%`#2  "p "l "@΢`@K`L@  @ʒ L@1*: `#`%2',@(L`L " ,L`L@  @`%`#2  "p "l ",@`?" @ @Kf `L@  @,P% 'o !  @Gs ?   @ @   @    @G!㿘  @GG ??? 㿘 dG  d@ ,,;@ +@@J, ? $@&N  $` ܒ$,㿘@" )L &x  @JӐ@JА  @T@-o@qb@ @j0@bhp# KאȮ( @pȤ  ؑ,@6 "@J`@@Ȥؐ廒 Ȥ 6ؑ,@ "@Jv@Js%@(@-@Ȥؐ@t8,@@㿐p# = p# 2L h?"0 0)@""@ "> L | @J<@J9  i@,ݔJ@ܐ  T @ؔ  @ 0O&&@;"@ @L@  㿘p# )"@X"H @I@I@I  @,@ @8@   <  `?@w8  @I  @ ڔ a`@.0$@ے p@W#Ѐ <  @I * Ɛ@  ap@ @88@$@ 6U "X㿘p# YD㿘p#l q  @Ȑ??  pR@ pct "ct㿘pcx @U"cx㿘    p#(?4 p#  p#(? 2?3pcp` "#|p#(?@ @Ƕ @c  ! 謞@d? @ @ "d?@ @tc  S? ! 2N?@"`I? @  @   p#( @ Sp@G.  ! ?p#p#  p "| pp "cxp# @p#L q  "?? ` Ţ @Β?  @ ? p#l p"#t q  pct "ct  " @d "!@ 1?㿘@   p#(?p p"#t@ْ`@R? @? `@#@ ?㿘p# p#t    Ep 0A@c??5 3` p#( @ )p#l @   @D     @<??  Spct  "ct| 㿘@  ?  `@?@1U  p  pp #(?㿘"p@u     " 2 㿘`2@ !@ && @" `&@&  aؐ "a؁㿘? " " aؐ?"a؁㿘 0y h& ??> . & & Ȑ㿘 @ ! "l@'$"lΐ@ @Ӑ 2    2     㿘 2ސ   ؝㿘#  a@ ǐ 2a2  㿘  "   @: `: ( :@ (:` * J   "   " 㿘?p-#Ȁ  !*  :p@ lF?  @Qؒ @@͒? @?`? 0#q- B? @ p#܀ p# x ?ep "^B? c#q` ǀ ?L  @Bp#  0` D  ?f- 㿘 p`#Ȁ  !*` :  @ @ f   @??F? xp# '-q/-  -q0q  a   ?0U`B -q K  ?2-q  9 @0@A0%B? @ p#܀ pp# p!"#@ ۤD@? @? ?D  @|㿘?" 箒 0`F w?   :"xm`F ?   :"㿘 "@5 0I ?   p#(  @0p#(  @㿐@~?  ^  p#Ԁ p#@0`8?  p@n"@ 0?"@㿈@*@@[㿘?  "@ ?  #@ 0@   2@ 8pD?p# @ 㿘 p ?  p#Ԁ #@㿘@@ &@?     8 wp@ݐ     ! kp橒 #0@Q 0@Ɛ  @??   W @8R(p@8#("?   0p ? ܀@ Npppp#("ct"x"p%? И 054@  p#Ԁ $@ 0 %p(? =? ߀@ p"#p@(?  㿘1#Xl "bPJ 2 #p"bP $ "a $  $""㿘+ a $@J2@J. # @T @O aa@@! !a@@ @A!@?a$a$!%apllllll ( ,""0"b4*@#"8 #"8l  2  lb( `"b( 㿘%lL@  lbL@2bH ",@+   p# l,@:"H @pp#| @p#Xl2  ,: @  !lb(*#|"@㿘 p#      0Qp  l"( l3lb0 + ⤐?`(&b0 %!l"( # a. J?:`@a"(J@  Y"( $"( a&b0⤀ -  b0 (⤐ $!l"(# a. J?:`@TRa"(J@  +"( $"(l 2"b0⤀ ,#lb((  l"0 "⤐ ! !. J?:`@$!b(J@R  b( $b(l "b0⤀ !l"(`   !@J? "( ِ ~  !l"(. !: J@  _  "t`j _  _ /`_⤀  `  "( !"@ @  *"( !" J@ "( !l!"(J  0 "⤀   l    l   l "b0 i   $p [  Y"( c$"(  p# \ F 2X p 8p#䀢 A  "> b@?8lb,p@@X@@42 N -*`: l l"(`""( N       M lb( "b( 㿘lJ"@  l !plbLAbH!pp##|@6lG" l",pcXp#d  p#`  p#䀢 l !l( + (a*@( "(l ! (p*@a(* 㠀  l"< ! **@a *@ 2$#|l4 "@p H  H"@l p 4"#|㿘??  ??  ?&?!*  ? p !?   aB? a*a&㿘 42 ?`F?  ?8? / ! !?*a  *@a" !?*^  ?ހ  3 [a耢  `B  !&㿘5l 1n   l 3n"X&`  > 7l&x""X  > && > lX @b:㿘l bX2 ObX l 4 x 8 lx  @"xn " :`:`"@"`$  $@n #lXX@    4 2   8  X 2 n  " "㿘#@    "bx㿘!n Ā   d$ @ $ n`Ȓ` ?$ ā㿘p# ?   l2 `bX  bXbX 4 @8 @lbXn " b@ f4; 9R 2M n" Ē| q= ?"9 D@ ""x47@50D 2 n" Ē q ?  SD@8 ""xߒ㿘  l2 `bX ~ bXbX 4@8llf"X" b@ f4- +޳ 2=?B@@ٔ q) 2`#`D (@%ދ 2? q 2??D?@U㿘@  ? ? ? 3p@ u?   ?c(& ?@B? 㿘N -  @#@@#G ^@t׉ @ @hV @2> #@ 6@hJ#࢒ ) L@ &N ѐF @;@;  ΐ"@=@? N 2#֩@:D@/@1 @h @1@2 2 ` @F@C @G@( @ p "cpO@   4n   ??:㿘? . 1k* #А?  @/  . 1m* !@㿘 '"1o . $0,! ^)n "lА  > & 1" ' 0p( ln Д> & # !n @ @  "l$ !  ?  ? P@ߒ  㿘`?㿈  @  > l&> 㿈@ 耢? 쀢?  "ln "$:$:$㿈 (o!Ȁ2?2 ?2  "lp##!Ȑ  :" ??l@"  㿘[   "l  `@q ??  4n  ?? ;``a a a a a a a a a a a a a a a `a a a a a a a a a a a a a a a a a a a a a a a a a a `a a a a `a a a a a `a a a `㿐 `'@  2`  @  0 "b|㿘    ""| 㿐 6p  "@098@?Ñ* : `:W"*` q `q `q `   `  `  `q @ &#q *` ' @㿘    p0p3#㿘   @㿘   Ld "t@l  @i 0@f @c @`!0@]!h@Z! ' ᜀ 'C  0ᜰ  ԰@А  *`, @@*`ВБ:  @ !@. $@ ԑN@ ,`  T?* @?*`@   " "bpI"laؐ0@[ % l .0  a0@ 0@9 @9 .   "@@l 瀦 0@9 @9 "@@0@8@8 p "@@'( @( @5z"㿈 +   "N@00/N@ @  *"&*bN`   N` " @ 0 *"N` ` *" *" " b//'"H/@㿘p#    "X@ 0W @   "bt p耠4p(jhhhhhhhhhhhhhhhhhhhhhhjhhhjhhhhhhhhghhhhhhhhhhhh㿈 'D+oa耢"J@   2%a€ %a@JD@ a`"@%a%a  DJ ?`03'DY"X*` DJ@ +`? `}'D  D"b|@| +@ 'DJ@ + ` "' d"bh aDD z?'D @]? @ @< 2 '"'@ђQ '  "    5( D/ )%`? !@ J  D 'DJ  D@U 'DDJ uD@ "@€ DJ lD㿈@'H@ @'" ` @@' "2``!" `@ސ'#@[0ɐ `   HJ " `@  "{``  "&   o`L Ci`"_`"```" ` \` `?V"``?Q"@"H`?I`?E` ` "l      "l    ` @f`)"@4(`$#8"` ``H@Δ쀢 2 `` "` "@#h@˒ 09`  €H `  @  `  "`  `` * @'@`` p "cp` @  ` 㿘.1o!@4 !㿘@א    S@ 㿘@ː  ` 2`o耠@ 㿐'#@T㿘o!J㿘L@ 2&@ &@+*`: `$ "$ @ 2 N $". -  & &.  \ &@@yj@*N 㿐Y L -2    ?А  &%?`'#@o  А  * .  @*`: В@ Ѐ$&`2 㿘 J"`,"p# " L d2 pcؔ $ $ $ $ $ $ $ $  `"  "@ "  €  $L p H∔J@   `  x*`P  $J2J ? ?* 8-`? 㿘@@v*p#l    c "c"# #  Ԑ    L ??㿐@9㿘  L@顤@5F@5C  s @㿘6`.  .`@B2`* @ *`B2*@* @z d  @ d  d@k @e 㿘 ( >@  @P2 @2  @E d @> d @ Β 㿐q  p v"cp M >    0  + > Q         &  `1@Dڒ 2    q"  q"  q qqԸq" 㿘% o!@ "t    @wp "cp$㿘q` Y"`! #p!@ ##* $#㿘N*` : N x%  ' & ``/ @ `0?, @]  ` -?,@ @0!(x%  ' & ``/ @Ŗ `0?, @*  ` -?,@ @0L!0㿀% 6 '`2 /@&  0?,@qz ` -?,@ @0#!@㿀# a'Д [@3a @0 !Hx# a' B@3ha @/!X㿘N2 *`:  % (`N n   s dN2N@L`  *`:  L`   N@@@@`N 㿘@ p q Α   ?㿘q # bt`"   p"  Ip#Pbt`p"   0#@ p#8ңp#Xp "cp㿘r #"nq "`㿘! "t p" W@ "t p" f 0 ep#X p "cp@?p??   p( (p(2 8 * 㿘7p(  .8( ( (8p(   * @: 8p(   *??@;( 㿈#p%pc(@"!  ?@d@ c(??c(Q c($ $耢?쀢? *  :? `4!?p 8?#( 6?`*42 #( #(`?㿘p#( @ 4  * 2      p( ? *@@" @ ( ??: p( $ p(6?htt0h<Hhhd0`00000000000000000000000000000000 0000d000@```````````````````````````````4```````L``(`````` hhhhhhhhhhhhhhhhhhhhhhhhhhhh㿘!h!q$  !$ !$ "X "`" "`#! $ 㿘@0#ppb"@ "  @sb@$b*@㿐//x# a'p ؐa @-#x# a' a @,# 㿀# a' a @,#0㿘#8㿘? ? ? #p?   ?c(& ?' 㿘?. > `6p`"*` p"p! e@ Ð?P LpW#pX#t ."l@ْc@MpM#p# H ?2C /  $< 0:p8#? 0 4+ )`'% @   `p@ ҹ ?2   "l@  㿘?`6`"*` T? 0p+#0t  `p#( F?:{ B 8 `   |`zp#(?: F?@`ߐB 0 "l "l$6 ^͞G B 8 Q`O   H`FF?0g;Şސ& ? 20 * !    ̐  ^ 0'pp!@ J ? "J? 0&#H0  "l x  J:" ?." \ J2 02 0?㿘?* : ` &a *`  ?* : `2`#*` &@?&@? &@? &@p#&@&@?㿐#pa%p$N 2N1N#P`:&`?`%%`.2* 0 `\* Ñ: *  N%  N '( 2  N  ?'  N 2Na` @&a㿘   㿘p#ppcXpPq#8 "@ *"@  p"c㿘p#XpPp#8"@ "@  㿘N@= ` "l@   @ $ !* R  N@ ?"@N@ 2 @N`  `N@ "N``, `N@ @(,L? "?,p p2 p" 2 p2 p䀠" J l   J  p耈2  (,@ 㿘p#x 'po Ȁ0 $p#$ )pa&$#( ? #(  @  怒W#( ?$ȁ㿘 "x?"x`?Ep #$??"x:;"x"p#x +pc(* n?  c(e 4?2c(? 42 c(@( c(0̮c( ?㿘f p#X 0Ȑ  `?d"ȁ㿘b!   @F   # @e#x ?`( "$`(@Q$`(!  , @QĐp$ ,"b 㿘!  ( " @Qy $ (" ,㿈p"耊"   ,@  (@  @@u耠`? &@ & 㿘# ` "?@ ??pp:$`:؁p%p bxbx"p 2p pbx"; 1bxp+pȀ-  pȀ2'  "" 42 2" 4 2 ( 2 㿘  `@ 42 ` @   " `4 >`2`` 8>``>` ` @ 4 >`2`` 8>``>```@4 `` @8@d0&@#㿐!  S`   ` `>    2 J@ 2J@> J@ 5 2``'D J`  `'D 魐 J@ `D` D 'J '`J@D  J` ` 㿀'P>'T ;'PT  q PT "@@ 8 F :`@ F :`:`5T(N  PT  Pj ' `2@㿘p"䀢 p#p""h㿈7耢?쀢? Z? @? 㿘~p#p`""㿘 ` V ?P MsF p#  ` ? 9 p #` ! ?* '#pc( "? c( 0?? ? ?㿈\" q  ? 4 d d 2+:v4 Ĕ `D  D?? p #d 2:M#  @, $Qv# @ 2 `  "q  q`qp#Ȁ  `` 2: 㿀`N@ 'e 2p]#X" "@U#3pcȀ  \ cȀ  ppbȀ p"bp1""(!p#   pU?`""# p""#p""!p#Ȁ  ( p"""#Ȁ ??? ?+#c &??#\#`#d?  p#Ȁ   02pp#p#Ȁ    x#pb-p?耢 Ā ?? ꭔ ? Ѐ?@ @b b؀b`@ B!*  : 9Fb؀"pb2`(  !*  : Fp"Ѐ@"2p p !*` : !耢*   * @ :`@ f "؀ 4 (p(&:"Р#\#`#d ! p"؀"?"    p @?p:"p:؁J@+`H8 2 H "H`HK@2 `2"2" J@ @ q q q 㿘  ic@o ic@k ic0@g 0 @d  @a  @^  @[ 㿘q  Q ""  @N : ǨӐ  @C  @@ @e@ϒ ic@8 Ð tp "cp #p%pcXW(cX( p 2  : p ""p  bx p "bxp "cp"#ƒ x'''@.Z؀ ?؁㿘 @#q "` "`㿐q 5 ? ?O O   /q㿘@K``````````````````````p```h``<X```````````x```````````,P``(  !!q$  '`''@$@ X) ' ! % 5 / 9;7 Fj* @€!P  c @ $TT "`c @   =%!P$`!@맔 J@ 6`!cH@ @$`8~$`@ z$@` v$`!@눔 J@ 4`!c`@r @$`@_$``([$`!@m J@ 4`!cx@W @$`(D$`` @@$`!@R J@ 4`!c@< @$`<)$``@ $$`!@`@ $@`` $` `($` ` @$`  !P  c@ $T@ T "`c@   =%!P$` @@` $` 2&H(` $`@  $` %D@ !@@Ⱥ  2aL @ ` $`$`H$`L$`P$`T@@ `@$`!@Ē@Ȟ $`H@ `@$`!@Ӷ#@Ȑ $`L@ `@$`!@Өc@Ȃ $`P@ `@$`!@ә@s $`T{'!@ꍔ J@ q!`@w g" !@y J@ 4`!`(@c $`$ Q$`` M$`  $` H%D!@Z J@ 4`!`@@D $`, 2$`!@D J@ 4`!`X@. $`  $`!@. J@ 4`!`p@ $`0 $`&H@@ߔ?I? aX* & @ @`@*T@ `@0 @ 2@H `@>   L`-`@ܐ `Ȕ@ @1 h?'q @c [ Z`@ǐ @魒 @  @駒 : @C   *%q@В$  @A 2! @/ $@"  !P` ' ` Ԑ =$&`'   'ش q ;q' `'`07q -a+  `09 !L  o-` 5`   ؐ@,`   a@ 2v@ !Hq!H 2`''` 2  ܘ @   ''@ܠ  a@ 2L@!XG@u$ $''$'' #\@nn0 P  " a@؀` !T`wah@ "@u a@ 2ap@@   @ @$? #$! !@  ?@W$!@  ?a@ @2 @r1@ @ @ @3!!@`$!@@!^ < L `0`0 !@` @ " L@y @:! q 2  &`&`&` q&`D&` 㿘'HH@t$㿐@⯒ J @ "`E    >  &` `@㿔 6@` "1 `  ?+@㱒` &@p ! @@f `@"` `2  ` P`  P&@ 㿘 aȖ"@b@"@ 㿘@u  @g ;' n L  o  @ = 2*`"@# 2     @2   "*@ "!`2 b@  @B⠠ 2L@㿘@+㻐# a' @糔 ?2  @U$  ( $ " K  "l  J   2`K  "l    `@ @+a @"ȁ  :'  J  l `H 2J  l `   *  㿘 q @~$0 $@w@8 @& & @o 㿘!q$@_ @   @p &   &@& & @N 㿘   cE  @ 㿘   c@_ @ @ 㿘   @  @` c@ 㿘  c@ 0@A 0@ې ttttttttttŔ,PtƘȤƬȀ<L\|ǐǨ 0@PǨ`㿘 s# c@"@א 㿐`r#D #rr a"cDra 4@ @*``!r"4#L@J*`$#L@J? "r# .@L ^J`$`? ``?@)a rL*`" a L* !!&@" !!#\ @Gp`@`a !r#L*`" a #L* @a #L* @*a rT @ $a "T㿐a@c   a@}=  @ " J ``r "cD @a@}" @㿘%r  r # "r@r#, @F#@r#Ld, @@  r@#r@#r@#L㿐 s#J fr g e     rcX  "cXch "chrct "ct  0 `R$o#D*` `r? "l    r "! ! 33 ̀@ra@q r r*` * ?А" "! !@i !@"J@ 2 # Aa@L rr"! "!! !  rr"a "@@ !@"J@ 2 #ra@# r"! "arXr r"X"ct"hrhr r"h"ct"Xrtr r"t"ch"Xrc "c rrr"#"\"c0rcx "cxrc8 "c8rr, `",x" "aȔ @N @6 r k"cPr g"c>    $$ "S$  &   2@@  ?2< >   :>$ "   ? "l@   а ? _  "  @  "l   @ _ 0 W @@"@ ?2A  $  < ; >>$ "   ? "l@   2#  ? _"   "w  @  "l@   2 @ _2e   a$  ? * @$ 6 W @@k ?2B < >   :>$ "B   ? "l@   2$  ? _"   ""  @  "l@   2 @ _"     @* @&  (㿘@ b@vX 㿘@T b@vL  :? @ @ `.rp   x*P@"    * ?2`@ 8  @ @ 8+ *㿘r#d    @a r#l   `? "`` .`:  * "@c @W" r#P   `? "`` .`:  * "@B " @Vߠ   `? "`` .`:  * "@$3   @aa`?"`a * &a@ 㿘@5`Xpȝ㿘@> %r#,' `0'x!X*` €" r "cr"c ! $  4` b@ @a r "c@@@xb?ђ?X* @   @*    4` @" "@@   @:@ 2 `@ 㿐@ z  2 @t " ,`* * * % T@ǔ Z @M D @  T 2 >X !'@ܒ @\p x< @   @ݔФ  ")@##Ъ @˒  2! @Ĕ   @ 2 @  "@t 2@  b@V  !r@ @  ,@ @,@ :  @, :, @! r#`#8@U\r#`2f !r#@U> #P@tXY "@  2S O#@L ,  ? ?/7  @ ?X'T'X'hab'l'\ @T @t#X( @$ 'X'`'d'\ z#\P!  @ch   @ @  @#x㿐@ R   @s#7 @64  ``@ ` `D@  T2`@ެ T 2` `D@̔  @Ҡ! 㿘  4  c`?  #r@b    2c@ 㿘 N  nc@$  rN  orr "c "# %   @ , ` @~*  $4 @s@ $@ , `$@  @ , 2*@, $@㿘 r# "- @ "( @ɒ . " *#@ 2  @ " @۵ . "  *#@   # 㿘'HH@ג$㿘 c@"@ 㿘@㿘`@V/  scȢ @ݒ` `? ' %+  m@X5 2`0@ @Wʒ!@~@@vG(?倢 ?aX* @ @&@ `  `J`p   &``@`"!@  - @c2@@2@㿐`J c b `H@. `@݃ `@"J@ `h@ ` @r ` @"J@ `@  ?# * * 2 `@ ? 2`  ".`@ @@S72` @`@r$  㿘@  .!@@ 6 6`@@r8 Ȱ `@ 㿘  ! s s# "@4`0 # #`@-b#Ȑb@(a(@ 㿘@"㿘 ax@"@~ 㿈!{+{7z)z#% 5z-z'z%/` {#*` € !$ \ %`P &㼐 %# @Sa  "a @Ma "a@u0a?ؒ?X& XX* @& %  \`#$㰐   ''1z'#Ȗ @ ?a@qo   #Ȓa@R  ""$ \# @Ru"@Rq" @Rm"0 \@Ri"@ \@W  \%`P@Ob  \@IbX  %`Pb`@ @Q蠒 @~L  @ 㰒b@q" @ @~: @ Đ㼀`2"@b@А  @퀔 㰒b@q  "@R 2bb@p @:<@XX耢 b@p @  8  @bܒ` " ` " `  " `` `"@q 0@6 "@pޒ @裸 #@pԒ0HȚaB + cB + 3`  *`  @O  #@p01@Uz: Ȁ̀@p#00@ .{`P      ! !?   ?# ! ? ?#   F?2B  ?  ?# !  ?0@! *? ?c@  ̀@ ?@ ̐ ? ?c@ ! @  @!   #?9 ?  ?# !  ?/@! (? ?c@  ̀@ ?@ ̐ ? ?c@ ! @   @!  2 ? ?# !??? ?c@ ! @ ?#" @!  ?"  ?c@ ! @  @!  #? "? ?c@ ! @  "@! @#@" {    @   {{# T" X"``#@#h  #@o@{H@ 2 z {c" L @Po# P`"##@Pc#@P_ `L @PY&@ P@a &&  `  㿘. >@| 2@`H@o @T``@o 㽐@낒 b@o @  `x@n a F { `"" {a" `X * "`X{L `@ z#` @O `X @){'a, *  T"@ 㸀 @Oؐ`X @a㸀 @O̐ 04`Ȑ@   `@  `ؔ@a @SN a@n @큒 c@n @ 3rc! Q@z4 0 a @:  @Q+@== @Q$ * @=5   @Le@Q x `*  d 0!@, &@LU x{``*  0" 0 ; `@ C@疕8 { L @ {`@  Xz"@  !H@OD`(`(  `5{3 d,T*"@ 㸀 @O.`   `2 d㸀 `@O `>㸀 !`@O`X 0!Ē t-{+ d,T,"@ 㸀 @N` t `2 d㸀 `@N ``@  㿘@w4444$4444444444444444444444444444444                0  P P P P P P P P P 0 P P P P P P P P P P P P @  dtXXL|l\@P@0`phh<hxTh<xx 0\hh<<<<<<h<(P"p"p"p"p!"p"p","p"p"p"p"p"p"T""p"p"p"p L<HT`l|11<11<1<1<111<1<11<1<1<1<1<1<1<1<1<1<1<1<11;h<|<|<|;;P<|<|<|<|<|<|<|<|<|<|;8<|<|<|<|<;=x==p====㿘 1 b@@"b`@""@b@y~ 㿘  L! b@" b@"@֐"@~b@yf 㿐 'Ґ -+|)|'|#|%}!7 9|5|;/} * X@€ %c  %#h  $` $cd $X @o"??X* @ @N&@ZD'#(cd`&Xb@~ %T  @6 %TT 6@c@ @ ?`)*` €&X@'&X@ 0 @ž@0h@@xx|#X `   "`Lk#}bT @M B .`@J@ -)@ `?`#!*` €| ,"c| ("c| $"c|  "c| "c| "c| "c!@ `L# !b@#@ﺐ#@L0   ?''''  ܘ @  6 #8܀ |@w 2#P ܘ @  6#Xܨ|c`  @La#|c @#@LX`_ Z` " @  ,J|#` L ` 2C ` >}"X`2; , bT@R$ |#h`*`` @ #  @J @ @L @ `? @`@6 @L @K  `@v{ h Q(h  {W:* a 0  .*  ?** *`hX ! 4'  {"4"X@i! 2,"X"X@M . "X`@! ,"X  2 !{<`?`"*` €  ' ` `|#`Ē @,  @ . {bX@n` ",@ !{Đ@'!{!X@ϫ!h!X|#`  !  ???ؒ'@ u  /Ѐ/؀``ِ  ` ِ    耢  /'/ې !{#\!X! @ *` !X@Q!%!X@!@@躐@: !{(!X@֒!!X !{0!X@ɒ!!X @  8`  ! `'"t*` € | (!{#`$!{ 0?    ??   !{:@ 2:@` 2``2 @\  2` '@B̒#X@!h#X|#`  !  ???ؒ'@   /Ѐ/؀``ِ  ` ِ    耢  /'/ې !{#\#X! @K *` #X@P͔!%#X@!@`@@ !{(#X@!#X _!{H#X@!#X @  X㿐 `$'"Г*` €|# |# |# |# |#  |#  |# @|# |}\b\ "\} |c̐ "c 2"@$㿐|#X`` ('5  &Ls#@M@ g"?}bT@J ? #|)|/}7|`@J@ -|@ ``-*`#d €|    |   | |   |   *|    ,| |   ""c $c 7$} "`} "b\#Ȑ %#  !"(?2`@ @ ?2`@ @ ?2`@ܐ @  ?2`@Ӑ @ @ t??2`@ǐ @ @@f?2`@ @ @v ⌐ X%⌰?2`@ @;@N?2`@ @ D?@ #    @R6  @K0?@ ?h @@`h   p`x@H p $c  h 2$c@H @H $c@ @ ? 4 `#Ȁ 2 ⌀ 2   c "  )|#|# 2$M@L " M@`"M@` "`c`@ &LM@@ L 3߀ #M@ gh@t /L ! @HL` !@H` |#` |#@'@Hx!  @Hr!  "  7 "0 "0 !(!8!H@ʐ@HX!`@ |㘀   '  ? ( ?* ??* ? *  ? ???"`}"`(*``H 8 *@㿀 !  ' 2  2   2    2    2  h    ?? @   !h ap@ѐ | `@" a @v!xH|#`   #!"|c? "c x* €}"`|"}"|#l|#   |c,,!! ,`,@с ? "B,   0  0} "  } -,` *` €  ??  ??''''ܐh@|˖ h'ؐ@|Ö   "a@e@sM ` " ` "a@X@s@  " ` "a@M@s5  @I@? ? ? ?   $4 ؀ 2     !>`}!>2c *2 $c2 2 2 2 2 2 * #@@5B Ȱ 444Γ*`4Ѐ`4 4     !J!J }2 c2` 2` **`$c*`*`*`2`2`2` 2` 2`*`#@@6  ,,,,,, , , , , ,`,  @j@   2   ,@"@ J@ ""@ ,@㱒{ @  b @q ,,@j "&@ /   @@,@?   @Q`N ,@@? 2$}"` $'@Iݐ  7 @Ԑ? |#Ȁ`@r   ! Ŕ  @R '& `  ,`` @!0  "a@@r 㿘@|#  |#     "@a@q |c "c@  "a@@qՐ <`  ` @/ "@?}* " *" * " " " " " " " " $" (} *`*`"`& &  &  @T?#:,@`?| }   "  (*( }( 8     7 7 +` !77'7777( (   ,2 !|E"  X@!2> X !>@   "(!8@  2 "0 #d 8  #\#`@ ,2  X@ /!|` X@ؒ!2 X @"pp ? / / // 7  / / / / / / // ////2 2 2얓21|1Y"!@ꐒ!2R! !J@   ,` "(!D@t  2  ,`"01|#|$%!| #d  % #\#` @d"L"ؗ,``0"1| #|   K 0 *  2b@I ,b!b@?!2!x   ?''''  ܘ @ 6#8܀ &@n 2ސ#P ܘ @Κ 6ѐ"ܢ @*@o㷈 !}bX| "`')}@p, '"T@G(@ '@@D@"T㿘 } T"`L  @ "L a c  g  |#    5|  & *+#5||||}\ ̘ `$ ``" ` " `* `" `" $`" (` " ," 0" 4" 8" <" @" D" H*  " @ %|} "` ?   b`@ɔ|c`  @dc | " ?   b@``@Jc } " ?   b@``@0c | #l ?   cl@y``@c | # ?   c@_``@c | #, ?   c,@E``@c`% 5@}"X`28 }bT @I]  |#h`*?@̐#%?2# %|T@FƔ"L  `@T`(@T  @V L "@c8 @ϒ }?(@J@@"@ +"|8}`(b` " 4}a " (}? *} """b@  ? @@ *@b`"(㿘|#`ua `" @B!0l P* @Bv!  "   &O $ "/I  @Bd!    !!@BS!   !@P @] T07@BF"   !@ @P 0* "(@B8    "  @B-"@ @B)"H @B$"X@B!! 0 "`@B    !@j@㿘}>"`@B "      "@a0 "b@  "  @[  "@b0ߒ L -+ / 5739+;|  #" "  @" ` @  2 @ ` 2 @ ?` @` ܀  ,  ֐@A" !|# $#ʐ@A#$#     @A#  #8@A@A~P @ϐah@Aw` $`  L 4@Aoc $`  L 8@Agc $`   L <@A_c @#@B! $ @  L@ASc D#@B! $   L@AGc $`  L ,@A?c $`  L (@A7c 0`" $@/  0"@& 0 $   L 0@A&#c``" @0?H@A#  @jaa`?"`a * %a@d 㿘@A# $! # a@P!@@# !@Ia @ L㿘`.# @@# Ȑa@8a`?"`a * $a@2  %"@@ː ?  @ a`?"`a * $a@ @/a㿘`Y ?>@ 6  , < ?`&  @  * & @ !  ?`&  @  * & @Ӓ 4  8  ?`&  @ >* &@ >㿘 " " @8 2  x  !`'X*`!\ €@͐* @K $  @' 0  @! @  7 7 7 7 7@(t7 P@@"   / / / / / / / / / / /@(/ `@? @^!! @ p㿘@@ @     `А *`: ?А *`: ? *`: ?ɀ`2    !,  €* ,`  *  **".@?? ??,?$?<?<?<?<?<?<?<?<?<?,?<?<?<?<?<?<?<?<?<?<?<?<?4?AB0B0B0AB B0B0BB0B0B0B0B0B$B0B0B0B0B0B0BAx  %  `@J@ -`?`!Г*` €         @   ?''''  ܘ @ 6@!H@k  "@i 2@? !`@k  ܘ @ 6@Ȑ!p@k @@>!`@  L 2@ @i㿐a#\#`!ᰒ   @>њ 㿘 L|   @4" 2  @V $ @Q  L ?  M@ P  @D   @%a `?"`Ḓ * "@ 㿘?`"D*` €!!! " """ `@>n"(0"0@>i  p!' "@ |"J v    2   H@    ` bP +)"`` @bX@@;$@@8`{@۸w `q"h@kg `  `  `   `'"h@} : G@B@=_9 p  @㗐@$@@ z`'+)"@ㄐ@Ԑ$@@ѐ` bx@r@$@@` |"@=#`"@= ᜒ"@=  @,"h ! '瀣@" +    +@=_! @"㿘 @ *  *.`.@L p r h2*LN p"L rL h p h r .`2 ` .` L p h r p h뀢 pL ,r  L`N `,`%`* :  . :2 ^ @6`  .` А 20 .L ` `,* L A 6` L``* @8``6`L   ,V` "6`L 2V`!  `   L`,@L   V` 2 &6` J\2 J/7$ !*@J Є?Д (* 8А ?Ѕ*8* Ѐ4*@*@ 㿘@.㿘 !!@!@߅`  `! @x` ` !@ $   !a@a`6"! `"@-` 2  2  !`@Ja(?"a J  @!@  @!P   @S!` ""X"b㿘! "d %X4#t  `"$"d   ` "2  !X@[0!8J!8 @!@ @!P "$X$"d㿘  `"`U 㿘  Ȓ`"`K 㿘  `"`A 㿘!a@Ô?"a㿘!a@޶?"a㿘!a@ީ?"a㿘 'D'H  'D` &`D  D@5H D  DD@5{H D $ HH!@xb( ``@6` H?F"a`"H`""`H@J a  "P"X"`  #  @ }`H"`   H@  H"`H` `"` `@`H @eX !'H' 'DhD@5H HH!@bx?|"aH "##bP@U '@l  ̀ H """ H@5 ! ?JJ "l    "J ) *` !/K "l    " K  !* R +  *` +# @ ѐ  @ P  "P"X  !    @?!" H Ԁ 1! &!"@5b " $"&!H @4 2nLD  "l M" H@5_ # H@ v @   "P"XH  !  @ !" D Ԁ  1!&!"@5#b " $"p&!  ,@H, @# H 2 H@@Y "@&WD QL" DH@4 ># "@  @   "P"X@  !  @{ #b 2  Ԁ !! $!"@4b b $b$!  @&jD?@ "" ! @"㿘@ 㿘   `""Ȑ@ 㻐' ᜀ 'D''H   'D` &`D  D@3HH D  DD@3=H D $ HH!@:b ``@4` H?"a G ! B  J  "l    "`-   *` "/K  "l     +`:   !* R +  *` +H"   # H@  H"`   H@  H"`#H@>    H`@W"*@ :HH @4  H H` `"` ``#@>   :@@c> @#㿘@8Y !!?`" * " @ !@)"  Ԁ !## !c$!"@3r$c $!$c @ݒ $c%" @ג 㻈 !'H' 'DD@29H HH!@9c(?"aH "##bP@ '@藐 v p""" lH@3, g! 'N     "l       !* R  +K@`*# @   @@  @ !    #@n 3b  Ԁ 1! &!"@2̒c@ "&!b &b&! ̔ @1H 2N@ "" ! @)#H PX㿘!#`!#x!c`@{ !@# ̀ @% #  !c@c0!@#@%  ' J   "h@Hc! @@` ` `"@4b"d#|!"l `P@ # `@v h @`n! j!, `@#   `@p @7!   a(@ݖx @%!@#p<'#7!  aP@ǔ#, @پa$"`  !! @٭a%T  @!T   @ @٘bT `"!㿘  `? & `@cP   & `@cX  &! @@jb?" ! !b(@\㿘 |Ė0"a㿘 `@"a"㿘 X"a㿐  #p `?:"#p! @)bh`@cP 2` ("cp@cX 2`"#p@ #@J  ! `b@?"a " "p3cpV1! @bcp   !@ߒb! @)"cp"!㿘 dA"a㿘 5"a㿘 )"a㿘  "a㿘  ! @@؝c8?e"a   `?1"  `@)cP   $"` `@cX  " 2 `@F` "bh @T7 `!}"@!" "`"!  "J   ! @Och$  a J   hc@:  "!㿘 l"a㿘 h"a㿐 ! @'c+`@cP 2` $"ct@cX 2`"#t@ J ! `c@?!"a#t `?"#t1#t c c ?"c#t?!! #t@В`#t   "!㿘'H  'D 8D@.H HD  H! @װ`P?."aH `@r p`!!`"d H! @ xH `@[ ` `!"&`"  "`Ё㻐# a '    &`  ! @@k``@/ѐ` ?("a@T`  `@SH"?"a@$   !`@H `@S3 "!`a@^a  @ 㿘'H  'DD@.H HD  H! @a?"aH `@ې!㿐'H 'DD@-H HH!@c(?I"aH "##bP@A '@X -H !&""" "H@.  !@" H Ԁ 1!  &!"@.Ւa " $"&!H @- 2N@ ""㿘'H  'D (D@-H HD   8D@-H D  HH! @֊a@? "a `@M!` H `@F!h㿘   &`   !p&`   ! @@dax@ @4a   !!`! @(!p " `@.` 2`?1"a!p@ "``J |"`@.`  `@.G! 2`? "a`Ș @ɚ @!`@]@]Đ㿈'H  'DD@-H HD  D@,H  DH! @a! H*  ?ap''"?@ HJ |H@.I  @-! H?P"a "##bP@ '@4 "+  a w/H,`@ ! @U 3b  Ԁ 1! H&!@@-" b &b&!"` D?@Ҁ`@ ""耢@@]0 㻈' ᜒ '@А  @̐ @( W @   @  @  @ !  L@  "@:~ / " -/ @o# @b  +/#t  !!@!@( @!   #@Vx  @Vr  "@Q?"a@^ @쀢@i @f ? @P" "!"!  @"0@# a'H' 'D  8D@+HD?  H! @bH?V"aH `@"x 7 D  H @l"H"`D 'DH `@" # D H!! @"@! ` O@@?,H" D 'DH ` @o"  ! @"a  D 2 ?H ` @Y"?"ca  @"㿘!"d  $"d@D"Ȁ 2$"d!!2 $"d! @" @4#$"d㻐# a'@$   !c@Va @PB# a"a @Ր#(㿘'H  'D 0D@+1H HD  H! @.c@?"aH `@#` !!"d H! @c#hH `@ې#㿘'H  'D 0D@*H HD  H! @c@?"aH `@# !!"d H! @,#H `@#؁㿘'H 'D D@*ÒH H! @Òc?"aD!@#H㿘'H 'D D@*H  H! @Ӥc?"a D 0@H㻐# a'@$` @  $" @ @{    *@ .  "/@7 a@ a  @ 8㿘'H  'D @D@*GH HD   HD@*;H D  HH! @8`X?"a ` x@`㿘!"d  $"d    @`$"d㿘!"d  $"d    @`$"d㿘!"d  $"d    @`$"d㿘!#  @  @/ #  @ @[Ґ 㿘#c  @ !" "@h  ?"`$"$c""T㿘  ! @@Ò`? "a2 `@U! @"㿘@/  ̀ @ #  "aX"!X@ܐ ",@  㿐'H 'D D@)H  HH! @҅aOH@# ? '!! @Ɛ!0@!h"! !! @!H@!1J`  !! @!`@!$@ǐ", a@ @ J # 3!!@#@!@y @ ?)"a3 a@+ΐb  !"@"b"b@ՔDH? €`#  "aX"!X@N @b 㿘  u"a㿘 ,i"a㿘  !! !@5$##"! ""a`!@  * p` p@ `p J}&cJ!$J J@` J2`@  `p @* 2  * J *c㿘'H  'D!! !@$  C"!  D ؐD@(xH D   H! @ua?*"a1"a# @"`̀`  L " &#@Ғ ,##@4! L " #x@4# !   *``` NLC *`:  $ \2%J*J!: J 0$JKJ@J?ϕ+`   "@  K`J 2 " K@2 K 2 J 2 K J   K +`" Jcx1~ #.#cxJ [  \ $"J+2+J  +J $7 J "l    * J 02?L  @`+J@  l +` f @ "`  +@  W  *`G: :  \ $?27JJ "l    ")JJ 0?L & @`+J@  J+`  @ "J +@   J  + J  , ]*`J d  J2J 2J  ]`\J BKJ ,V ]":R "l    ")+J 02?L ! @`+J@  +`  @ "  +@   J  +N# #0! @"㿘"d  "  2"a㿘 &0"a㿘 @"a㿘 @ j"P``!!`"d " ! @ڐ"X @ T"` "`Ё㿐 ! @ǐ"0 `@ # J ! @"0 ! bД@[ : 㿘 @ #㿘!"T'H 'D! #  D PD@&3H D  H! @0c`! ! @t#x"T#*`H * `@? "T "p"@ ! @[#z"!" " `$"Tq"*` *  @* *  "@"T`* * ` @'%``? "`@; `  "`?̑. :  .@"T`*` *   @ƐN "Ė.@`p@ 3 a``? "`@ a`  &a` ?23 ?a``?  "`@  3 a`  ` &a`! #@?"a㿘'H  'D D@%|H HD  H! @y` ?"aH @' ?  H !`8@a"!㿐'H  'D D@%IH HD  H! @F` ?"aH @' ?'H@@ !`H@/ "!㿘   P  X@ `㿘Ȓ?  !```@`㿐'H  'D D@$H HD  H! @`  H @&Z   ?;"a@Ώ  J     `@߅?%  `@a  ')  <p"d$pH%"d # @a @Uh< H<$p%"d @U\5 'H' 'D   D@$H   H! c  1"T H`  @: 2 "T(H! c@v?"ab@$-,`* ` @ NN  "l    2  `k"*`:  $ \"Y XN    "l    .   ** :` ?а N  "l    , D?.?H,  &@ $Ȕ" @/H *:  i2D  H,&@ $Ȕ" @H@@.@`N 2 N @W.@#a0@  `! @ #S"!2N` !  #耢 #  !  @ ?;"a"d  !!@"!@ל a0!` €##| N`  !`?"``@* "@@̐ $@"@#a0'D@'H* `@2 2ND&-  @ 㽰 !?' ' h'@*'((?' '$   `' `p@א  (`@   ( (`@   ( `(`@   (  (`@Ȳ `@ /  L 2, 2  % Ф L  2u   '0@'  J  ` ^  ! @Hl ;`@'  aP@l  `@     `@       M  / !x@G֒> ,@. / "(L 2,(`@ '? !@G# @X8?2h??: @fa   &@˔!' 6 R!'!'@ cL@ː `Ȕ   ':c; @$?@R V'$ a@ @ B $: " '00 @.Ā`0#p 6# 2# +#2 @&! #`?"``@* "@@g # Ȓ :@ F @(@v!@+$ '0#p F# 2C0#`#2<0  (80 # :` #2 !?`"@  #* "@ #!?`" * " @ @&!0  @F"< @$J M [@/ג ] " J ``:2*  @/ɒ : , #t   !b8@ʐ @"  ! ''"x@\і4`"x` `  P@@\4  4@鏐  "h@Fv ?' M   #\! @f  bp@i!"d  !b@;  @ '? #" @*     #\  @eښ    L @? 'b  2 @4  "@E  @b`' "d  !b@   bȔ@0U"d  !b@۔@O : -@  c@[ @A % 2* c @     c(b@ɶ0    cP"@ɭ@QX0 c @{     cxb@ɚ0    c"@ɑ@ ?  @Ez#   0 @ '$0 $  $?'0*@0 "  J? "0 0#t  !`@^$$@Ғ ֠  `@    `@   ` @    (@EV @P$??:  0 @G '$0 $  $?'0*@0   J? "0 0 e#t  !`@ $ $`H@  $ `@,: #:## ,q   l,J h    $``@  "d$ `  !`p@Ҕ @[?@; @Pk@Pi(X$`T'@P_ Q @a  &@!' 6  @D! R!'!'@    @ߐ   c@ڐ `Ȕ   ':c; @" ?@P$$@O W'$ a@ @ B $: " '00 @+р`0#p 7# 4 # +#2 @&! #`?"``@* "@@s # Ȓ :@ F @(@!  $@s '0#p F# 2C0#`#2<0  (80 # :` #2 !?`"@  #* "@! #!?`" * " @ @1!0  @C G @!U ##?0 ## @ "d (! @ # "d ! @"@ '@C   @C}#   @Cw!   @C @  $?$@$`@O  @O@O( !  @!㿘@$( !! @! @!!@ϒ 㿘@$ !! @!8@!!@ h !'D''H'L '@ԟ  #  >  a@t ’a@p  @!P  M "  @Ƕ!`  M "} | Ԧ H* @@Ъ    ap@à  `@    `@    L?P0L`@  g Lp??0; /@? :@;@7 @ < :8`5`*  @,@% @  @ 2  @B 0` M@ L   H*` @B!0@"@`@ : ` , @ :`N@ ր`,@``L@  @+ /  * #t   !a#\#`@C#  V  s#'''   L "!'' !`"($"( @*#  $"(  @ 2  !@B+0( "l  ` L@  b@@  `M  b@s 2 ` L@   "'ؐ '' Ѐ J "I?M C?"d  ` "(a @Òb  0@b$ "8''܀ '` L! !"@'$! V $! " ''  !@#f d ԰ @M;Ԑ 'Ԁ D 6 Ԓ :H* @ x# ?   !  @"H㿘 F @Z@Lߐ    bX@A! N 5 N + (, %2%,@J "l   D ",J "l   D `@,`,`N Р $, * : l ` : l ` "ɐ? * (:8  l ` * : 8 l ` "??ɐ?Б* : 㿘 `@   `@   `@x   @Rb   8+ a'"`)  @>"  @9 !  ''''@V' ?- b/@a  b@[    В @% OВb@M  O В @ POЀ @V ? "@@u @ㅐ "@@l?"a `#@k!#@e!#3&b T?     #\! @_ @I! !b@  @  6  ,"@$|    L "  $`     #\! @_  b@! #@? @bc?  `6   @?ѐ# ?@X"w " @֐ @N'a'@  6  @?#(E   '  @z    @?#8 cX@ù!$! c`@ó!1 &"`2 @?#h!"d  !cx@Ñb@ΐ ! ""@" @?"a '?c!@6   #t  @?[#"@ې a  @#㿘@ , !!?`" * " @ @!  ` `"!@ 㿘#t! 'H'L'P'T'X 7$ 3a @t# H#@Ք    a@g#a#Ȓ@Ȕ  a a@Z#a@גa?`" * " @: @[a3b   @?#?"a& c@< b@ƱHb @+ @@b " @`@`? ƀ @ 㻐; a'a'D @O$9 @ #    "!  '@0~!`݀` `@0v!! "`  4!@0i!! "`  @…@"!D  @"d ! !@ @!!"a ` >"d`45 541"\ ,!X  ` ! !`h@A!`? "`` ,`:  @* "@@m  "l `     . .. pppgroup9spwd.db protocolsservicesXdisktab.shadow disktab fstab resolv.confH hosts .A .. installboot .A ..miscnTkeymapswheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: dialer:*:117: nogroup:*:32766: nobody:*:32767: ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs  (@haB   @@haB,C( @@=@@<@`dT U@haM@@4( (0pLl A@haB3B@haM6@haM6QA@haC@haH,@haH, A@haCX;@haC X@haC X iE,6h@haG @haG沀@haG沀 oY@haG߀@haGz9@haGz9(08@HPc`)@haGC@haGܓ@haGܓ ؒ@haGW@haGW@haGW 9B@haM U@haM0G@haM0GP"e@haM1xˀ@haM1xˀ@haM1xˀ/tmp/disktab.shadow)>@haM3B@haM3B@haM3B/tmp/fstab.shadow|@haM5 R@haM5 R@haM5 R/tmp/resolv.conf.shadow @haM6@haM6@haM6/tmp/hostsHu>z-ObJe~4"̕/w NoCWWBrj`&@k\܆9;D(I ë[hfpp^wC$kV##AQ"abae#K-*` * ?А"  !?    ! " d   "l `   2   d`  `) ! d--  d`("  `- "! "!,!@/!` `"d 4 !? 5"\ !!`?"``@* "@@@! $8$"@ !`"#ٴ 1,"  @Ԓ!!a @   #@`"?П@ ?a   @ p@籐  "a 㿘@& !!  ""@ @ޫ!!@ɒ  d'  :?p 'd   ?? 8;c'D'H'L'  LJ - !`@L` !`@ L ̀ DH@ L b"X  В ''|'x c`''l@]! /$  1  @P?& | |@' x x@   d@ d?"#C"c@ '|`@  ' H@`  H !`'`"c"0aJ@ |(  @ H'x cX@@'  # @<}|@ߐ x@ܐ @ِ c ""c#'07H@_cX' iH @<^ |@ @潐 "'@R  <  "H !@P`|@棐 @栐 @:@ |@摐 @掐 x ?x@懐 ?"d"c@͗! f1   `@P D@a   D@a DL"X ?` @r      @R  1 H @;    :d G"   !    > d 7"c 0  > 'lLD !8 .|@ @ xd`"# # |@ @ xd`"#x@  & @  l@ x' @!? @ bX'x`7`` " LS # >`B;#` R @" 4&@#p ;# # 3##p *p  t !t! #`?"``@* "@@}z # Ȓ :p B?p#@ܐ!R @ה$ #p M`# # C`#`#<`  8` # :` #2 !?`"@  #* "@}( #!?`" * " @} @8!` H@: 耦  L]#p3 ##p 8p  t /t! #`?"``@* "@@| #@!  :p#p B?p  # #  @; `?"``@* "@@| `B :`? "`` .`:  @* "@@|`B :@,'` #p B# # :##p p t t!?`"@  #* "@|Y #!?`" * " @|I @i! @ H@9  @   L  @9!@??:@} d`"#@@l |@. @+ x "x@$ #`#2O   K @, G |@ @ xd`"#x@  1 ?."a @?&  @'Ր ? "a "@#`#2     @  !  @!H㿘@B !!  ""@!X@!"T@  'H :''X'h'?'T?? 'D  :#  ;'L'P'Xa'@`?'܀ #"d  H X HJ - !`H@L` !`@L ̀  ܀ HD@ L0Q'!,'䀢 ' ܀@ '@f"T +-  !  @Y?$ 䀢 @0 耢 X@) X"cT?"h"b@ '`@ X'耢H @` lHJ |gH@  UH@!ϒ /  L   H @8 0m 2,H  H0! !@[   /,`H @8n 0O#   L  H@ ! H @8Z 0;#   L H@ 'HH 0*#  H@ 'HH ܀  "X   0b"X   L@˒ :@  @⁐ @~ ?s"a@ɓ"T ܀    `  ސ! _L  D !8Ӕ   0 ː#  0@ܐ#X' X 2XH @Ò` X !'5"`h`#HJ | @0 'H  @<4c`' H # @7`0c ""c#"`hH@P' i H@7 0"'h@hR   !$'! @1 Ā @CF@C &  @7!$ $ p<  c ""c" h@?"X "         R @ׇ  " L^  `ĔR @@2@   L  @ @$ Pc > #pB <;c# # 3##Ȁ *Ȁ  ̀ !! #`?"``@* "@@yS # Ȓ :Ȗ B?#@i!R `@ #p M # # C #`#<   8  # :` #2 !?`"@  #* "@y #!?`" * " @x @! @  L  @6!??:@?`  H@6 07H@6!03   @ @    @(U? "   @ڔ  H @6X XT"#"`h@q Ԑ 'l #p3 ##Ȁ 49Ȁ  ̀ 0! #`?"``@* "@@xo #@׏!  :#p B?Ȁ  # # cB@':c ؀   @< `?"``@* "@@x0 ? `? "`` . :  @* "@@x`B :@'?n Ԁ  !! @a !@~"#p B# # :##Ȁ Ȁ ̀ !?`"@  #* "@wɐ #!?`" * " @w @! @   L  @5Z!??: @ H@5N @ XT"c "h@@ߡ @ߞ  @ߗ @{ #`#܀ `  @  h si"@mL@ ?h'\@ '`\`H@'d?]@\@ !b@H@<XT"c "h@L  @I   ?"@? @< 03@1  ?`"!@P & 쀢   @ "@U#`#  @$ @  @  㽠 a  ''\ 'H ? ?@ ?@ @4"p 8! @Ջ  @c  "` @4o"T #  ?c \@3   @4\"b8   7 S"` ,#` ' "a@    !  @|"#t `$`! @|"耦! # "a@    !  @|f" #ݐ!"p   @}? "!m$"p! @|J# ! ` c@ʐ D b8  2! @  h ! @|*#h! l#\#` !cptx@| 8  @\sw*`* k@o*{*@  (8 @ 4 , )$ c@  ! @u 2  ! @{#e! "8  ?  !x|Xhl#\#`#d#h #l!`TPp@Țt PT ^P ZX V  @s w* *`k o*{ * *b8 6.&x|Xhl#\#`#d#h #l#p#t;x;;;;!`(TPp@zt ! @{t#! T  P X ! @{b#8!   @ݥ*(*+ s* w {*`, @k+`o@(+(@+ @ (8, @$ @6.&$Q$b@ ! !'h@  c ! @{"! #\ !`h`ab@l O`Oa@ Ob@Oc@! @z xl! "8b@ә n4   L  !"p  @2{#U!  !` "8@"8 "8  S   5'\)"8a@p +c 24 # `?" @  @<   $` @2J"H, *%cc "8 ?c \@   "8 @23  !   ! "  '\`  \@  !  @2 !  '\` ) \@  !  @2  !  "8@ "8  @2 ! #  ?c \@Ř    @1" 'L "8@L   @1#(! @˒  6c @1ؐ!c "8@  `    :"` 3 0 `"'    #\!@Qt   !|#t  "`! @y" @"8    9   ! #\*    !0#\#`#d #h #l#p #t #x #| # ## # # ##* c? %c'H(@ H` %c"8    '\   \@    @1)#8 ! @˩ H?$  "c    @ѯ!xh !% 'a`' ' # `@̠   @0!@{`?$` @u`р $` 'Ȑ  @  6` @0ސ#8`@  @o!㿘## `L`#2 $`L  ($`L@: $`L㿘@  ` "`㿘' a<$@   ̀  "̰"P ̀  ȢbP"#%&@"#  @!`. `!"$ @ю! a @ъ !! @ф!a @р&!<a<"&!@a@""&!DaDX#"&!HaH"X&!LaL "&!PaPc# &!TaT #c&!XaX!" &!\a\!" @q!`!a`@m ! p @h!q  p@daq!&!a!"$@Z!!a@V$!#x$@Q%e$@M#x @| $ 㿘@ !!?`" * " @rL @m!` "#""!@ 㿀'D'! 'H'L'@Ȓ!  !#  ! !'"  1  !( 2 1"X" Ԩ  # ! @x!0 #  "X! @x! ?"aԆ  !ra @!Ā ; c@ '! D!8`L @ ̐ 0@а ǐ !8`'LH  !   `$   @ǐ   !$ Hb@gL0@ٺ  "  D@4a   ̀   ! D@%a  ! ̀   ! 2! 2 ! !8H &0 "@  ̀g`? 2#! 2! !8H "!U  @Ӑ M !쀢 ?"a@Z 0B "@  ̀7`? !! R  '7@  6 @.Ӑ"!쀢 ?"a@/   ̀     !쀢 ?"a@ 㿐! R 7' @    b @.?@"a    㿘@Ò /  1,  ! !@[   /,`% @.n < !  @vÐ"(04$@@iؔؠ  .* `&   d,,:   9, 0@) ,:  02 ?L? . ? 1,?`,??`"ߨ 1#؁㻀% !"'  @.L"P!쀢 ?"a@[ $   @ɐ"R  @]  "" @."" bx@ @r"! R  ' 7V 7'   @ 4 6 @-"!쀢 ?"a@@    V @$ 4V  !"(    @V"HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH<HHHHHHHHHHHHPH H,HHH8HTHHH,x !  b'D "$#"x'H'@"  "bhJ   ""bh $3#%"`#bl ("h"d##&a$bp@$"a0 "b`"@" . sL * s b@ 2 &a$bpb@ 2 &a$bpb@ 2 $b@  $bp&a"@-0 s# @c 2  "` @#  "`J ! #0"`!    J 2  @- #8$  @#  L  c@  c@  @c 2   !`@T  "` "bd XR@"a z`y @ & s p"c`Bk!T*`   d"a  `"a""p["a W"ct `"N"tK""lH"!?D"cA""( ! c@V 9  "4"a "!-"p !("!$ !J "l     !@r!$"\ c@   "b "bd""d@ D@/H !XD* "@"#H  'D'H#`"@#!, @$K @,@% @<$ " @ ϐ ΒcP@f D HH:@  "cDH &<@8@k @8ߐ a@H ’a@D H' s#'ؐ '`''D@ 1"\ !#  ! "T@t#@"\# ""\@4 `?  ’a@ ’a@  @F 㿘@   @3 㿘' L@ | #c !" " ! R @  @("$"!  & $c@  @ ?$ $cɐ c  !" " $cR @  @ "$"$c"!X $L #㿘 !?`" * " @m {L dƀ`", ! @s !``? "`@ !`  &!`` v!`s@#c P1!0@r? ! @sr B2 L ! @si 89  #  !0! @s[ P+!0"c €c#| " L  ! `?"``@* "@@m+  Đ Ѐ@ Ԁ " j!@s(!@=!"1 $@!`  Ԓ @Ő n’a@ ’a@   - <   `"@%" P @ 2!( @. @*H#@@$H   @@%  P(@(  P@@$  PP@   P&  V 4M-  "  P O  $0M& `H@  -      "`@"bx P @Ґ P8& @@    -    "`@"Ēb P8@ P& @@@,@  4 8  - H @!   @  P@m     @& P @\a  @"`' ᜠ' b@d  P& b   &א#(b   '''Ф'@z'ܠ  "@Ā    "@" 'Ĕ@ "@!@ @j P  @#㿘@ &,  @`Ŕ 2&J =2& "&@X`2 @ƒ 2 &&@& #&&@!&&&&&&&@" @@@ݐ@a &,"@& 2& @!#@&@̐@ɐ@Ɛ @`x@k㿘& "&& &@c&"&  2&&& 2 H-2* _* H* 㿘!쀢  @ p̀   "@"b`  @!J#0@b @a@ @ @ @㿘# bX&@!   bX@!f#0@g`@ bX @!]#0 @ c@N@ې㿘 4.` 8@ @ @@}`"ϐ#.` @P   #@!0 @   #@!#     @! "J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿐   N .А ( N   N " @Tt "N 㿘1"% ` @  @= `  "l@J     @@2   @=`` " ' $ ` \2 ,@ \,@ `,@`` @* 4,@ @ x h1  "\l0H@| h(x8$x8D㿐5 P@7@$ (!"0 @>"@ " <$@" $@" "!"!,""$ $@#Р" $@$@ $@ $@ $@@ * $@  * $@  * $@ *$@ *$@  * $@  * P $@ @sW` @? @](@l@!h .  P 2& @Ґ& $ P @  P @ݔ&  P& 2`2 P%@0  @ גc(0@1 P"&  2 P!`?㿐! @o"T"T @s` @&? ! @ؒ @ @#㿐@>`I*`" @0@  * "@@  *  ~"@ x *  s"@ m *  h"b @ 0``@$`0Z  !@ga @#>0R!!@ "K&! @?!@0@b b  bbbb @$50+@#Mb && ` @2!8@0@F 0@B 0@ߒ0 @!X@"@{ ; @!p@"㿐@~ ! @d> .@ @$ ) @|`:@O`: 'a2 @C@-   !@)0 ! ! !@̰ @"㿐 @" !!?  ("    ,  @^ 2 !.@ !@ ,"ۤ ;  0 @"(0  @"H0"`@@"d 㿐@! !"x@; P 2& @e P& 2 L@m L ?$ L "b\@ƒ {  "@^@"50 @X"0@ܒ? } Pf @㿘!h  @ud 2  !|  @uX 2 @ d   "@@  d@ @o a|$"a|㿘@& & P #@(  P @& 㿘!@Ӑ"0 P"f  P& 2 P #0@  P"0&  @ה P& @<㿐@D { @ސ"@!0@(4 2  @#P @(4 0 * .`@$ 0'@L?a }@m@`2`P20^ ` ` PT"   P `  2 @  2`  P"`  ``P $`P/"  P&! 6  @\    P @_#h0  P " P@"`  P"㿐@>`:@*`# `0 ;&`0@! @7"x@!0+&`@!ǐ /0$`,@ 0(@!3%&`(@!/!&`$@#&`@#&` @#&`@`40 @#@ ߐ@d ; @"`@ Րh+ a'@T̠   !!?  @# ;"I @ E @(@   @#@̔ @nC@R .'ݒ@%̐@" !!?2  @ ;" @  !@˔ 2    #,'  @̤  ̀@2   8ؒ P@0@* : `2 ԓ*` $@"k@֒! @̔  $̐@ @ ؀ ؒܠ $@{@!"  @J ;" @  ̔ @!  @! ̔ @! є @! ̔ @!֖  @y !!?2  @  Ѐ ;"p @ߐl  @[`耢  @[` ̐ / @[`  @[ݒa  /@!ۀ ; L@ @5! 0"`L@` @`AK?@1L@`A ," ; @Đ!p0 @ x0  ` @@ @ *`@ "` * @  2  @Đ!H * @ @ * &@a  @r!p㿐@   2 @~!@U04 ,* ;@Ӓ!2 @ a@   @!@ @lђ$$&@@ؤ ; @J"`@!p% 'ؐ@ْ ( @   2 @R! @ b,@ &@ $@ ,؀ ; @"`@   @"@!@㿘@ג   "0@\㿘  @S"H0@㿘(8㿘%㿘ڐ 㿘 Ԓ  & 㿘ad  "ad   "h@㿘.   " "㿘 㿘. * * 㿘 㿘 P㿘 㿘 㿘$`㿘{ 㿘X "Xm$ܰ㿘f 㿘` 㿘f㿘`㿘$ WaX&"aX㿘M㿘G㿘A㿘;㿘5㿘/㿘)㿘#d" d㿘㿘㿘 㿘@- '@o  @"!h          2 !݀ 2!!h` @p` 2@`2  b d 2   "@ݒb` @k0 !h$`L$@$`X$`\$`T$!h    4`` ` ,` ,`  @ @`m2k @  @"a`H 2  @`  2 @" @j  @ @$`H$` 'Ȓ@Ȕ Ȓ @@D "7  $  @  `    #c0H @` `      #Xp@`  $`  $     #c0 @` 2R w'h`^ `L @ 2`H ?$`L`H``L 2``L  #@1` 2@h$h$a|$@6"a|@U `   @W' ` c@J  `@E#   (@X`      2  $ $   2 @ [@ 7 2`L!h` `0` @:@`2`0@o@ `  @ h㿘 b d1݀ &!x @Đ !x @ d!x ` @j   !x "` @ !x  @u !x   "`㿘!h  @ @  !x @  "b㿘!l   @4,  @y!က ! @ 4 1 "ဟ@ b$"b "@ @4*`" *  * ?)!l   逢#   \ 2   "@2`2`` 2  @6!(@f?  L # 2 @f;!@!!X@f4!!l `  #` 4`  `\`2€"  `""8+  !?a#'@ *  L@\i`  ah@`X`@?$`X   `T /a`X + @! $`\ @n"b@.@a1!t  '@ # @!ta  @_!H'  0ᜢ '  @[ @h0a@Ɛ   a@ 4 A A20  T 2,   (@; @hĐ0 a6@   L   a@ٔ & T` Đ  `     @!`# a'`  '`'ܒؔ @e@ "& 0  ( & 0 0a@   @ݐ"㿘a   "  2 2"a b  "b"@  2$  @" $ $ `$ `  $""  4$  2"$ "2  2  "က" ␁㿘@\   "H@!l$ "!l$ $ $㿘#al  "$al @h 㿘 bp a   @B!0 㿘  :  :2 @’㿘 2@ܒ u" 2" "@}0" ,  @ """@ 㿘 6 2@^*   &    @m'  2 @ 2 $& b0 2 㿘 ! 2@#~*  @ "  2  @ "  2  㿘   &% I$ɒ    e "  @ 2@$@ !T &@  !% 2 $ $aT`@  `@ 2@ $@ !T`3@㿘"㿘"`+ a`'+ ` "#@@ "@` '`@ @@ؒ @@6 `  @`2` a   @"Ȑ@p %'L a'D'P' !x$ @Z@> @fwL 8@O@3 "@!" $"b !"" 2x|$"xD @+L`8 @$#@@, @H @0 @#@@@ߐ 2,DȔ @@ @f @@א @f @@̐ @f  #@#8 @֐L  $@А@ 21DȔ @Ő@ @e @@ @eא @@ @e̐ @@ #P@h @ @@DD @ @@8 @~ @z@)&' ` k 2,DȔ @f@J @e @[@? @ex #@,**@ޒ   "'  @6a- @: @6#@@@m@+ L$ 0P$ ($ ,$ l $ p $ $ L L'$`L !$ @$   $,@R}', @# @@ @  $ ` @@ǐ#@@e ` $ $'  2" ⬒  \ ``@ `- V 0  @אLH8 @А#@@ @Ő @@q @L $@@ " 4`%@%$* @*`@ `*` &"`` d "`d@=    0   @ #P""# Ȓ @s 8@n#@@v$ @c@9 "Ȱ P  "" Ȓ @K  8@F#@@N $ @;@   Ȱ 8+ a $' @$`8 @#@@'`$ @@ 2 < @  8 @#@@ @@ѐ C <    < "  : "`<`     <  " @ : "  @ϐ@@c  @Ð@ #@   `@@#@  a  @8 P㿘%  s  `"$$@ & &$" ✝㿀  @@ 2 `  h   @r@V @8 x@h b$ $ "b$ ` d$ d@ 㿀`    2: 4! , $4 4 4" 4`4`"  4 8`8@ِ  4 2 4 t?`t @   u v@ƒ`v   @ @ @  ް  4  @a 4 @@ @  & <& 8& 4 t ? t`t @  v u@`v " t@}  " `(& (`4`"& 4`8 @@ & 4& <`@@ & 4`<& <&`4&`<@ `8& <`8 t& 8`h`t& h@ɔ `  ?@& `4 `@`"  `t " @$ `" p"@"``" p "` p`2 p "` p` `2,"` pB" `, $`" , `, 4 , $" p& &("  & "&!"` 6 , `",, & ,`,@6" p&& "  &" & " p" `,  & ,; 4@ # aX'@1 ! 'Д @  @"@ @L a  @ '  lX' L   &  @!@'  @@ސ @ //''   @o!(㿘 "㿘"㿘"㿘 4 8  " 4. 80` 2`"`㿘 4 8 ! 8": 4  4"8 & ` 2` "`& 㿘 v u  " u0` 2` "` 㿘 v u #b u ` `ub֒`v & ` 2`  "` & 㿘 d!8@H@͐ % #$b  $b   b  &@&&  @aK &@b0@㿘 ""㿘!  !H@ǒ@$`㿘"`"` "@ u   8  " Ԑ 2 @!h 2 u@`2`  @!㿀 @!"`"  `$@@ @ `8 @@ @!@`2 @ѐ!"` `@ɐ!` " `@A ` "@ @"@4`@` 㿘 !`1  1@" @ $1@d@a :,`"@ ,?1 "b@`z 1"X% '  @K@/ @ @H (Ж# b0 @  @"H@H ,b0 @  @"`@Hސ 0b0 @ ߐ @|"p u v t @t" h "  " @j"  @"ȁ㿈  @Z"   " @S    # @M  '@M^ @D@ @MV' @<P @MN' @4` @MF' @,p   #  ! @"#\  l@# #@ ,   ,` 8   ,`  4   @  #@``,`  #@ c@' ᜤ ' P ,/  @  @+ᜢ$@  *@  @6 ᜤ$@ؠ@   @ 㿘 % !,    @ { " ` @ m  2 ,X' ᜤ'    2@ɐ @v^   L `       0`Hh@ ז @ Ԑ ` Hbl@x     @ Ŕ  @~ 㿘!p 0 & 4   e   ! ! !  @  㿀 '& 0bq@w̔ 6 @ !    2 0 @ }!@ 0 bp@w䀢 6 0 @ r!x 0bf@w  @ g! @& < & 8  <@ \!"  & @& D @"D 0 ''bg@w耢 6 @ F!!p       ! ! ! " @  h\%  b@''@d$  '#\@Ԗ@a``Ԓ#\@`#`' 4 '''@tఒ  @ *"P  @"`㿀  @ D@2  D 0 8@ݿ < W$ @$ D D @"@  8@ @  @ D <$ @*`2 $ @37 $ @ 8@^ 6 @ @%   8" $ @  '@S  @  $ @"  ' 8@@  @$ @ $ @ " @   㿘  @6!x 4"@Ĕt㿐#b   @ a"p% $b@w` 2  @f ! $" @ O""?c' @w<   @ A""X"# a`'2  @ -#   ? ?  //'/77/77ƒ  @ O@ j7"  @  6  @J' @ ;#8 a`?  @#Ph' ᜒ  ''̔%ܒ @ti̔ / @ #h   '' @  @#tTt 㠝㿘  4@(  c@  " &  `@ !؀  `l@  ! `,@ @㿘@t@`n`@'@`@ ',!   X , $ X  #@ >  \ X   &  $ X@ 2# @ /# @ , 0L@ ) 8I&  8  4 `Pﺐ    ,  @ ڐ h@ . 4""@/  P 2   ,  @  @@@@@P$@.%@@ ` @ ` & X`' ᜠd'2ꀤ " ! @  * 2 \ !* @8 5 6 3 8++ +   + !` `! !,8!( Ā`  !,8!( @  !  ! @`! ?" y 2`@`#\#\#`@m #@ &`@f``T` *@ `N`z 4 *@ * **?"`@I` '@ `l@= / / $/ `l@* @?"'@ @`,?`l *@ * ?`l  @ 㻘\'H'P @$ i P ,`"_` 2[` %@ S``    , J t ` A  `<`    '@ 4% H ޖ-* ,@@@@* ,@@@  @@Ȧ`@Ph a;' ? c'   @J  , ` .  [ j  .   @+ @?* : `3=!*` +;  @ ` "l@J   &@  x t+?+` : *?ѐ t+ +?` ` `` @  ! @& ` .   J @  .   !H@ `` @  @ 쀥@@   .  & @!x@ֻ @}!  . @t& @ݐ!&  c @ʐ  ?* : `6*`   ; "- 7 `  "l@J    @@2   @{D  " ' $ ` \2 - \-  -  @* "c- "- ]-@ U'@F̒@Y@ R@ F @{h$A@ T* : @ D* 2  Ȑ@zU$.L Ȑ@z  Ȑ@z  А@zْ  ! !@YF,$0 J@!!@@$`@  : -  @<А - + c @" !p !  @u" X# `a ' @ "87a (8@k'''Ȓ@Δ 'D'Ā  " '  ڲ ,    Xb`  , a  @+"p㿘 b8  2& @\"&& 㿘 ^" " " "" " " 㿘 >" 2  @>"Ȑ &@& 㿘@b #  b b $ @$#@Xw$ $ $ $ 㿘! #( #( &  @ #8 & @8& 㿘 `>2@: + @ 2' `1 `#` 2` @#p`@```@``뺒#``뷒#`$``#`` $`Ð#` 2  @Ð# && & 㿘   4$  멐#Ȱ  && &  㿈 ' '', @*$ 쀢@ $  1 _#؀ '  ''@ "X# $$ $ 㿘 "  " / "!)!@@1̐& @k#1#㿘)!@r@v 2* ! "     !  !@A !@<  ! @6 H!@1 `!H < @ "  `,`@ 2` @ @# 굒` 2   ! <(& "&걒`&&   @,`@ @` @@!n&&@㿘" $@@Ґ & \`0`Lp㿘Һ 573݄`9&&&a "#"a*`*'!㿘 ? & @p  &cȀ 2)"cȀ` Ҕ#@ Ґ#`"a"Ґ ጒ "##*㴀Q a*?a*@㴐 "㴁 㿘<? "l    ݀ - "!"a@ے0O? "l     "!"a@0:Ҙ"!"a"*/+ ##  !  # ? "l    Ҁ # "@\ "!"a@\㿘cĠ#! !"!##!"!  #c{a"a #$㿘)#Ā  %'#$c!$#_%#c !"!$#$c$$# #&#ā㿘 ? 㿘  #* %%` @6 %Ґ#* `\`" Ҁ%2 @! %Ґ#"c*!㿘#,cР  ː x  "l   D  cВ@ Ґ "cȐc* %%2 @ %Ґ#"c*!㿘!,#Т! -_ "l     @͐ Ґ "cȀ "l   D "! #* %%2 @!%Ґ#*"c@㿘N8  !* R ?`!<*`   a8@Cr  !OaP@Cj  !FaX@Cb  !6a`@CZ  !=ah@CR  y!?@CJax sq!M  a@C@  g!@a@C8  _!7a@C0  W!9@C(a  O!"  a@C  E!a@C  =!a@C  5!*@Ca耢 /-!I  a@B  #!Cb@B  !8b@C   N   !: @Bߒb !b @B 2N  ! b0@Bɐ  ! @Bb@ !!  bP@B  ް!bX@B  ְ! @Bb` аΰ!4  bh@B  İ!bp@B  !@Bb !K  a@B  !b@B{  !%@Bsb !'  b@Bi  !b@Ba  !@BYb !H  b@BO  v!A@BGbЀ pn!1  @B>b ge!  b@B4  [!b@BF  2T  c@B#  J!;@Bc DB!<  c@B  8!Bc @B   0!c(@B  (!#@Ac8 " !N  c@@A  !@AcH !&  c`@Aݐ  !G@AՒch !  cp@Aː  !cx@AÐ  !+c@A  !,c@A  ڰ!.c@A  Ұ!2c@A  ʰ!3c@A  °!>@Ac !J  c@A  !Dc@A  ! a@Ay  !c@Aq  !c@Ai  !c@Aa  !c@AY  !`@AQ  x!/`@AI  p!)`@AA  h!0@A9` b`!E  `0@A/  V! `@@A'  N!-@A`H HF!$  `X@A/     ``@A   3!`h@A  +!(@@` %#!L`@@  ! @@` !5  @@`   !  @@ڒaȀ !㿘!'H'L'P'T'X!@$1Ԕ!$H@!"   `@g!! "` " @!!@G  `А @B   @S`"`  ! `@q"@d"@ 㿘!'H'L'P'T'X!@u$1Ԓ$H!@X!"   `@-! "`  @א!!@   `А @  㿘!'H'L'P'T'X!@K$1Ԓ$H!@.!"   `@! "`  @!!@  `А @ޔ  㿘!'H'L'P'T'X!@!$1Ԓ$H!@!"   `@ٔ! "`  @!!@ӹ  `А @Ӵ  㿘  L %`N m`@D Ȑ@s &@(. *` 2: .㿘%'H'L'P'T'XΒ$!#a! $@r!!H$@1" !   @|" 3a @v a P  a "  "  @ha "` $@@H !  Д @C @aa@=  Д @9 ! ``@2  a @- ݐ "a x# a'@' @@ a 'ؐ `  @ * ؖ @Д a  @T! p% '@'В@ ؖ ?` А8 @%  <     *  * ?@    @!('ؐ@  x# a@'  @'ؐ@r a 6  `  @ 2@*   'ؒ@Z a  @ސ!0 p!  ! ''ؒ `  @ *@* ؖ ؐؒ@@4 !  @!@㿘@2  @``?㿐   ! aP'@= ֐!@P, 1 !a`@P% 1ְ!     @ ?8" *@  ? @ (8"?(㿘@x<*@ * @`@'   \7///''777  7@ @   &"*`77ܕ277ސ  7ސ@ @  &㿘@Җ㿘!@ !в@ ` . $!Вw @1!Ԓ !Ѐ i&!@5 4i? !Ԑ!x!&!\$!@ ! &&!!`   $!1!䀢 ?&!@  4?? !!c!$!2&!"` !` ` (6`$  ;5֒؀  &؀ 1!ܒ &!@ڐ 4? !ܐ"(2&!&?@ 6x"%   ?? '/7'  @Ô    "P !?'ܐ# @h  6' "p'ܐ#"@h  # "# @h  6 "@a  6' {#'ܐ  @hi ?   L - j#8  @hY ?   L - Z#h  @hI ?   L - J#  @#ȁ㿘zap`& 4      "   #㿘 4 @% ?  P   L 3   (G`Xp! ! ' &' 4 @eԀ ! 1 x!  @ 㿐@ 㿐@  g( 3f+gf# g( 3f+gSf#㿐'@ 㿐'@ 3f g2`* *#3f g2`* *#㿈  @Д   @a   @Ĕ  @U (7@@  &㿈@@ @   .. 㿘 "X%$,, "` c"`  , `, , `" @  `   ݔ a"!,! 㿐  } {`|0 ; ` ` j0f?ޠ㿐] ;  "̐ 㿐M! "   @)@  2 "@ @MB㿐  # !!? !  "H @@   Đ#`@ @MS@@ . ."Ȧ@] 2 #0,@@$@@ɐ@s@q@ .,@ 2㿘 &@` . @i @ 㿐!$" !K! 0  0   .@ .@ .@?#X00'  : @@  &  @+ )#` `.`@u` `" @@ @u ; #㿐h! #ؐ0 @ 㿐  `  "@Ԓ & @:    #  ِ a !X@ Q`}`{" "  `;"p l Ӏa  a  8{V  @Q``: @@b    X@ @K8  )@^ & @B:  @  x@``: &$@`&`:`@R$ @P2㿘L@ -  `2-L@L@ 02( L`x !` "l     `  x"  p L@ `` ? @ /??Ѐ@L@` *  *   ' 0"  ! !(    !  !( !00  !  !( !`$  !   ! %.( 0! 00,  !   ! .2`00`!  ! ;" ]  @,H'ݒ!  v!Ѐ ;" J @,5Ā'l'ܐ8'ܐƒ /  _!耤 ;" 3 !  O" ;"԰ #а @,Đ?'ؐ /  ;"0 ;"  !  +"` ;"  @+'Ԑ!  " ;"  @+'Аl :  " ;" ِ \!  "Ȁ ;"z ɐv @+'̐I :  " ;"g c 9!  Ґ"Ȁ ;"W S @+'''$ ; "B ܰ. * *  ,ؑ: `  `?Ԁ`Ȓ !*`   ?. *  . "*  . "*   ?. *  . "*  . "* 㿘@7'''''''''''''''''''''''''''''''''''''&'''''''&'&'&'` ! sc'J'D -'H  @OVb耢         % ! 5 9 7 ; 1 3  2* `@€a   ` @  @D"@H??@M  `@<  b@dѐ  @s c@ - @  @<@ݨ  b @ " # #0@d    c @q " #@@X  cP#X@HƔh @ @ ?2  cp@Ő @N  @K c@Ē ?I?@?C ? ! @ѐ#? @ѐ#@?2# @ɐ##@` ?2  @㿐# @y @y@y  $@~6@ Ĕ`'Ē @r^   #X #c@c@ @a ?@f ?  L  @㏐c" @ @@  @,  ?@K ?  L  0@㘐c@r @: ?h  @d 㿘 s#  ` @gk"@S 㿘@ F㿘ސ#@z #` #`ސ  "cX  @"  =#`\ @K 6 @B  R 8' Ԕ  =% # `  $`" @ 2`@BՐ  @  P`? $`!  (  @  ( 3 @M / $Ԑ?$Ѐ $`!  (  @  ( @8 #\ @Q  #`@B   `@ Ű 0 >  B=#`+Ё㿘@^   @B  @  PH N 2 #& + x+cX '\ @K)  6\@Bg   8@!ޒ: <#`%cX\ @co !ޔ??:#`@BN   @ u @F0 #`<`@ $`#` <B<#` 㿘!@0!|&"`!|"& `"$!|㿘ޔ#@@  @@@ @  @@@ @@ @ 5 ?㿘 ` "ܐ  )"``̐ : ހA! "`"؀@#"7`#D "؀ /#"ܖ" "؀@#"%`:! " "؀@#"` #@ "b؀  #"ܖ  `@""`? #`1  (  @  ( "@/ "؁㿘! " " ` @G "@f"?  @e`ހ "c\?@|J@A" @  ? 㿘1#\ "@]Q   @Al" @   ?&#\@w"ޔ  :#`"cX 㿘#\ @]3 @c"@㿘 ߒ`Ȑ!`@є   ޒ#@"#@h"`*  $* ""h((  #"􀠠    * 6@6H6P6d6x666667h7h7h7h7h7h7h6777,7@7T7h7h7h7h7h7h7h7h7h7h7h7h7h7h7h7h7h7h7h7h7h7h7h7h7h7h6777,7@7T㿘  h"cD"@*h* * * * * * * @C @]_ ߢ p@]U2 ,@  㿘# ! cD#@@ߐ x@$cD$#@#@ cDߐ x `$cD?㿘# cD ! ߐ x@_ $#@$cD#@  cDߐ x*@`$cD ?㿘# cD  ! ߐ x @D$#@$cD#@  cDߐ x@:  ?㿈 ! '@oX!N @x  @G@  ?  a  @.!㿘  @8`L@ p?Ѐ6Q ć(K I `F?D `A?? `<?: `7?5 `2?0 `-?+ `(?& ` #?! ` ? ` ? ` ? ` ?  ` ? `? ?㾘N@ 0}N` x X25N@` N@@ '% *` : , ?$@   N@ @ *`  `,   "@` *  ` .  B  0AN` b B;` N@@ '% *` X: , ?$@ H8 N@ @ *` ? `,   ?"@` ,     *` . ,  $@ 㿘 ` #8     ` 2``$  . `$ @b"  !P㿘`0 !ߔ h   .``$` ?@cڔ  ڐ!` h, h ( (  (  ( ( ( %(ߔ "@[`p. !߄ h  .``$` ?@c  !`  @`㿈 !'  @ J  / / / / /  / ?//@cu  u!`ߘh   . $ h*h* * * * * * * @͐2  N   M!p?@ C! ? ? ;!?a  @\!؁㿘#`J   @!9?@E `J@`$`@!Z ߢ `؀# )F  Ā `    @ `?`@ݐ `ؤ@ 㿐  ` @IRb @ ? " "8@E?0 "@ ,/+ ߬`"!|  @/  !`#ߐ ?4 @'`@J?` 2 &?΀  @Ib {  @Ib0 cO@ ) #  = # ` $`% " @ܒ 2`@=  @"P`? $`!  (  @  ( C?@1 ??%#?$ $`!  (  @  ( "@ c@~ܔc"`L  @Q & @ ` &  |@     J`@ U 㿘`%   9#1  `& `@n,  2 @=K  @s"P ? & !  (  @  (  ?@Ð ?$?$` & !  (  @y  ( @  `* "  $㿘. 6%3߂;߈``. ` ``  ! ` !ߖ (     " (@  @ *``"㿘!  #ߒ``$ ""# @#` $`? $ !  (  @  ( @& 㿘N ! b`@? @[ @Cb` 2@< "h@. 6N'? ! @ᣐ    $@XK   @?%`?% $`!  (  @H  (  @}  2  *@ @ @:  @ "? / *@ߐ " *Ā` ` ?㿘N ! c@n @@A`2@: #@1 6N*? ! @Ґ    $@Vz   @: # @?0 $`  "" "@^Ք&  㿘s `  `'@&-+)ߦ U ̀@ ``Ā  *@ @ 6@?`@   " 㿘"  ! #    N@`  N@@ih` @:! @Jc@?  㿘 J "@ʒ  &?& c̀ >+ # `  $`"c@  2`@9  @"`? I$`!  (  @,  ( Ұ @a ΰ %̐?%cȀ $`!  (  @  ( @L c@{ cȐ @`* 5 ?@ `*?@ &   @ J @ŐX  ?%   $cȀ"" @夒 2@9  @"? $!  (  @Đ  ( j @ f %̐?%cȀ $!  (  @  ( "c@ cȔ@z`cȒ@ c̔  < # ` $`" c@W 2`@94  @\"`? $`!  (  @w  (  @  %̐?%cȀ $`!  (  @b  ( c@ c*&cȁ㿘) !`  3/? %@X!`  %!`X'Д >+!    `$ " @ 2 @8Ր  @" ? G$ 1  (  @  ( K?@M G?$А?%` $ 1  (  @  ( `@8 `,`*`ߐ "`Ā` 2a `&a*@`!` @ ? @8#p @#x %༐ ?6 ?6 +`*`%༁㿘  @# !  #'   !H`@ @ ! ! ^*`: \!`?"`` !@Ԑ !` \?"``!* $!@ \N`` #@@ !"@?M "`  !]* @ ^!2  0`"@  !* $! @ ! 82  0`"@  !* $! @q !  0`"@  !* $! @Z ``N?"`` !* $!@E J !`?"`! * $!@3  cfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXcfXfXfXehffXefXfXfXcfcehee e e e e e e e e e fXffXfXfXefXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXfXcthjTmow$xm gLhij0lPmnpqlr`s<tutvLxxzLm d(㿘 !@ J`g" `p` "0+`9*`0&`r 0$  $  $ @7ؔ  @@aP%!T%!T ?$aP !   !L`2 !!ؐ "!T J@   J` 2  !!  `L " !L@  !L? $!  (  @   ( а?@ ) ̰?@  @@ڏ!L  "a@%!L? $# `(  @ Ӑ `( @   #  aT@ YaP &? `aP aP ?$aPaP $aPaP  ?$aP% J@ n"P p l P`2 `P` ` ` "P$ `|@m g J`n" `p`l   2  $  $  $   J ` $  !A!  @# !LaP@ T) a|@5 /)# `؀ ( ` `؀` ! ̀@6%  ! $`ؔ J`n" `p`l   2  $  $  $   J ` $  !! `@@#ۀ  ` !ߐ!  J`n" `p`l   2  $  $  $   J ` $  !!@  J`q`Q2J $ ? J? bl   `  !!8@  ` %̀ " "`@  &? J`n" `p`l   2  $  $  $   J ` $  !^! J 8 8` L@ ! @2 L@  @L 8  !F!X 8W ! !""  ߐ `B 3̀/"  `+  $`'`q%#? ` !!  J`n" `p`l   2  $  $  $   J ` $  !!R "`!|ߐ "@`  ?ϐ   @5  @<#@   !̐  "!Dϰ?"!D J`n" `p`l   2  $  $  $   J ` $  !!   D`̐@&D@  ? J`n" `p`l   2  $  $  $   J ` $  !l! `   !@g"(0a ` !X! @S U J`n" `p`l   2  $  $  $   J ` $  !/!!  ! @.` @o  `$ " !@$"00!|ߐ "@` `ؔ @  ? !"8! !!?㿘 `" "` `؀ 4  !  ̀   ! ?㿘ߦ!|3?1?%)߀`̰  ?,̰ a|鐐脢  Ā ` X   @И  a|ڀ` !"H?㿐 J@ A "lJ@ `$`J?   ` `J`   ! p; $`J@ !`@r$` ' !  ! @q`c  !"X^[ ' \ 9% 1  "`& X@B 2 @+  !G"p ? & !  (  @b  ( 6 @ 2 $\?$X & !  (  @M  ( `@ `'J@    @aX`* '# J@  X*@@X  X㿐  `' !" ߢ `"`?  ad  =- %   $" `@̒ 2@*  !ѐ"p? $!  (  @  ( ܰ?@! ذ?%ad?%` $!  (  @א  ( `@  ` !*@J@ f / ! 75J@ !T %ad < !   `$ " @y  @*V p ? $ 1  (  @  ( ?@ϐ ?%ad?%` $ 1  (  @  (  @  ` *@ J \ % `*@' @ Iad =!    $ "`@%  @* +p ? 9$ !  (  @F  ( 6?@{ 2?%ad?%` $ !  (  @1  (  @f  `  *% ฀ 3J  2 !"ad <%!    $ " `@Ӓ  @) ِp ? $ !  (  @  ( ?@) ?%ad?%` $ !  (  @ߐ  ( @ Ԣ  @:h  @``*`Ԓ@@ [  J`8 `8@= @mad <'!    $ " `@w  @)T }p ? $ !  (  @  ( ?@͐ ?%ad?%` $ !  (  @  ( @ ?? ' @``*@??' `% J` )!x B3%   $" `@ 2 @(  !#"p? 1$!  (  @>  ( .?@s *? !!X ?0$%!x?&` $!  (  @$  ( `@Y `@j``" *@L@ ! % 㿘  !`"a| /-'   ?" ` ଐ J?`  ` ?5` u s?`N   J ` "༔" N .N  X   $!   ? $ 1  (  @  ( ??@ ;?!|T!|$ @ m  ? $ 1  (  @  ( ?@̐ ?ߐ? " $!  (  @~  ( {@ w㿘 ̴    @T%3 ! )`#8@ =/ %   h$" @ @' bp? }$!  (  @5  ( ?@j ?%#8?%h $!  (  @   ( "h@U h`@i`@@@ %8` =/ # `  $`" h@ʒ 2`@'  !ϐ"p`? 2$`!  (  @  ( c?@ _?$8?%h $`!  (  @Ր  (  !@   ! h* * @F ! <? ?`h#$a|$  a| @x   ? $ !  (  @  ( ?@א ?ߐ? " $ !  (  @  (  @  㿘 ߮`̔        `   "`  "a|S @  ̨   @ `? %`!  (  @<  ( N?@q J?ې Ԑѐ͐ʐ@!|$@" "@ $$$ؐ" " ``@隒`ߐ? " %`!  (  @  (  @(  㿘! 䎦  `ج "@ ` U"| S`& "@N` E1 ) `@$&   :|$ @  ? & !  (  @  ( )?@ %?  ?% & !  (  @  ( @̐  |1  ` 㿘%  $ @> )? $!  (  @h  ( 9?@ 5? ̒`@  ? `  ̔&@?$" $`ߔ % "|# `$!  (  @4  (  @i  㿘  ! $? ̲`@  @" #⯐ `$a| A &?@@ 㿘 bl`  ` ` !Ɛ"?߳* ` 2"`ܐ "`" 㿘? bl   ` ` ?ߒ`*S@  !"? ܀ ߖ    " ܆``$ 㿘@#     ":@%F  !n"p 㿘"  N \2 `?㿘' p 9) !  "`$ !l@@ 2 @%  !E"p ? $ !  (  @`  ( . @ * $p?%!l $ !  (  @K  (  @  lN`\  `* !l* !l㿘   `L   ?( * @"(@$`L㿘   `L   ?( * @"(@@$`L㾐 ! `,'  L  (? #`̑* * %"( !1 !"Ж " Д  !!t @h  !t @) !bؔ @&J`̒"  鴔 @ؐ 㿘  ,` @А ?( *@* "(!H@V;?㿐 (? **@! "( L`h @B  ` "!D` "!H$ L㿘  `" N !  !b@/] @, /   !V" 㿘J@   !2" `"J`   ! "؀ :" !8#5"@5  . "؀  !@`@/  @Ȑ   $"@#  !#0 0 "a@"ؒ@ " " @f!'"@װ $"؁㿘 L@! ` "`# !* :  [ \  L@p   _c@L Y L@ ` * `) $" =' # `  $`" @Ϲ 2`@#  !쾐#0`? 5$`!  (  ِ  ( 2  . %"?$܀ $`# `(  Đ `( ` `@d*@ Ā %` !#` ܒ # J^" J]! 2 J `.`:`=2  J ]   J]2J 2J J] [J] 㿘&@&#`J `"!5 @7 `0?J` @ (&` $`` @ϐ  @+ܔ  @<#@$&@ !#x&@ ?*:  g2 `$` & 㿘` "`J % J*: @`!!`%` !#!%``*J :` %y)ߦ!` 7 !   $ " @ν 2 @"  !# ? $ 1  ( { ݐ v (%!?$ $ 1  (  ΐ  (   * *:`$ༀ` `J `\'` **@: $ༀ ` `` !`!ߐ ?6 K "  J?` 2 &L `=J@ !!` # `  !$`" @' 2`@!  !,#`? $`!  (  G  ( ?| ?%a?%! $`!  (  2  ( g Ā $ ߡ !@b @Ȓ R$?a < # ` $`" !@ђ 2`@   !֐#`? $`!  (    ( ?& ?%a?%! $`!  (  ܐ  (  Ā  K !@aɔ$ L ?"a  < # ` $`" !@{ 2`@ X  !逐#`? 0$`!  (    ( C?А ??%a?%! $`!  (    (      $@2 Ā` !M#?Ā   !@ae! ! #@*@# @*`  㿘!a -+/ !M &A \` `" , %  a$" @  @ِ ?$%?%a $!  (    ( @M @ ሢ`*@!M M 0H 94G?Ѐ4C* @  "@@ + %  b$" a@˯  @ 赐?u$%?%a $!  (  ː  ( @ @< ሢ`*@3! )# `  $`"a@s `@P 8%?%a $`!  (    ( aȐ a  *@! a% & # ` $`" a@= `@  !#A`?$` 2'?!  (  [  ( ? ?%?%a $`!  (  F  ( a{ a*㿘% # ch! l  #dd*@  *`@$ch l$#d*` * "ɐl*#d@ *` "l*#d@ *` &  $l@  !#@˰ @ʰ#d$#d$ch㿈 p a| ̀?  ct?  "Ő ? cl  ߐ "`܉  ` #l "`H (#d@*`@  "   2 4.   `"  @ "`"  " @?" ?@" ?`" ?`"   "@  ?" #`?†#l2  : * #d(@2*`8:@ @('`'`*'  #@ #` #`# # #  `L#p?t%|%#p%`$t $1  (  F  (  {  㿘 cl ??!"cl) cl* @*`#d@ l@ ``@ lc@@ː@l??$l!|  $l "cp"#t㿘@/ "`@  "a'4   /0# ! + ' % "; 7 '0,8 *'* `@€ '4!  '4  '4   % $a$!a`@]R`$! $a $  "@@ ?ѐ? aX* & @ @      "`0@>    " `h4  "`h@=    2  @zk? "a@W~ * 2 a'a@Wx`. @ (@"s$#(  "`@=֐  @a?&  .  *(& ,` 0$ &@@b?  `L ? "`Ȕ@ <  0  ?@y?(   2 @  @ @5@@@=@<       a   @&@㿘@ / 2N  2  N /"?* N /2? 82@`(   @ - " ` `0``! "`@ Д@ ` "@  ;) T`6 2``"`$`` "" @'e` "`` J`$`/$"L? / /,  `($#  , "!@ ˰  @:T$, (@?`8  L$` 2`@<   !`" ``@@# 2 `  (`@@0 @2` "!(@H (`@<`  @a 0<    2 `@` "!P@+ (o `@< @   @N@A U`@;(@O` @L`?N  !`2` !`2 `` "@!@au <    (@Pa 3 "`Ȕ (@ <  (   " "L`Ȕ(@  !```@ @o`?  !` ` @B`? ` @/@ 2 @_ 2`8L  "a@b 8  " @8  `??8` @7 2`@` "@\! ` -  !``@!(`2G !`2B !`9  "a"@?M(  a``? "`@: a`  $a` ? !``? &`@:a`  $a`` 2` y Y(@Ur ($ ( &@7T?2 "!@('! ) "@@ @0@!!@( ` ` "@ې!   @UZ@UW 06!`@ 2#  ,  ! @ @9  "@ ! o*@ @6  "!@( @U*@U(  "!@( 㻐 ! ' @8#?`  "!, 3 @U`(  "! `(`(@  "!@t  a !` @ @a  "@Z"㿘` 3 @)`(  " ! @Sʐ`(  ""@J`(   !` @( 㿘` 3 @`(  " ! `(@   "" @'`(   !` @ 㿘 !   /6 $! !@#$  #$  $@ $` @} (   ""0@`( `  @    %  `( @v%   L` ""@@ޒ`(  <! @6 `  @6   " $L@x`(  ""@@ƒ`( $L` D@I- L0@w`(  L - " D  ""P@`( 㿘 !  @ (    L` ""`@ (  㿘! s# # "bp@=b# "b@=b@~ 㿘@Tڠވڠ < Tdx֌֬,ה״ s# ?a#x?' "b' J g   "' b  ""?#x!  "cH@#$" 2 "   $"""J@ u ?J` n?"` '$"?#x "@#ӒcP   "@#͒cX "` "ch@9 `@ !?# "#@='#x '@#|'' " `@4ƒ'  !"@ ?#x #,`"@ "c@9U !?#|  @4㈠#x' `??#@,`"``` `E4"`*`  ""`@Ô ? "@#{ "# !?#xa@!( J@ n " "ac@9   d"a b _"b a Z"a ""`@ R    " `b "#" E#b  A"b >"" !$@{#6  #`@8ߐ  ?."a?#x# a'J . ./' " a@]" a'  ` " " a  "a a "a@ @  " "8@ ?i? !X* @ ?# "  # &@&` b !"b  "a  J@ -2J`   # #    ""   !  #  `0@8a  !  @  " @   #`h@8O b? ""b @[ ;  @z ?` D 4"8*`  ! ) # @@]/ 0   %! # @  . 2  #$@>/#8  @@ 2   @<  2 , ! #@  @Ӑ @<   " ! ( ! " ! " # # ؔ  #ސ ! " /  "  @  #͐ /   #a@S$++ (+ " @$ +  !  #!(@1 #$@=# #!H@ o+ b - @+`?-   <   @ S   <  %  % 쀢  "   !耢     #"a`@:ʔ " 8#7"Ġ @@  0" 9b 6 @@k " .@e )쀢 & #!h@0! "  @Q   L 쀢   #!x@p0 #ax@D @ZҐ 2 8 !耢   @ @T?cp+ a'@2      !쀢 R #!@Cΰ "@2   " !쀢 ? #!@20:# !  @Vw   !쀢 ( #!@E0# " 2   " 2 @EB   #aȖ ? !쀢  #!@@P}@P{ #@ ? !쀢  #!@ܒ  2?6 ? !쀢  #!@͒ ?c€     !쀢  #!@ @P;     !쀢  #!@  !  ?@8    @  !쀢   #"@9aа  a !쀢 ?  @a  #@V !㿐@'    ""耢`"  @2     2  ?cp- '@1    !쀢 & #!@6? !  @U}  !쀢  # " +  !쀢  #"8@?@Oٰ?b    #bX     !쀢  #!@@O~ " ?&@1@ ? !쀢  #!@€  ?# ??@? !쀢  #!@’  2?6? !쀢   L " #@ "` # @ђ  L   ?c€     !쀢  #!@ b ??# " ' ' ' ' $%b! !  #a@\ 2$!? @N     !쀢  #!@b  2% !耢 ?#   ' @ !쀢 ?  @  #@Tѐ"p㿈! "  " "`#`@''` #`$@''@耢  #"@" " `@N> 8@ a, @N64 0* 6`` @q`    L "` #"@` 36``@  #"@`D` @q;  #"@ے㿘 "@T$T   #1 b@7ڐ?P`? "`@3( ?P  $?P ? y ``? "`@3 `  "``   y`?㿘 #Jb !bL@@ː  ' h  , h@l   ?,  , `L@ 2L@ 㿘֐  @$@  #b@H  # a r.  . b@= 2.? r. 㿀! !   !쀢 & !  #"@a #@Uo#!  t$! #a@ "  !쀢 $@ J *  0* #@#H@  @ d @C @)i @*ޒ  #,4 4@*Ӓ @ # B  @)O? @*Ē , 4` `4 @* @#` ##X?@#\ % ' @ АB ؔB@C ;<.< !쀢 )`'  # #x@a  ! aؒd@ @*D  # B@*x? ##'#\@㿐 "   # #@b0/ " 2 @*Rf $  B@*K?  #"cИ?@6~ @"D    #"@6ic㿘 s# $ `@6_"@G㿘 `"_ N@ r w  N`   7  "`LK  @\` L&P&  & 0& 4& 8& & & & && H @t T& @*`X:  w. $h ?@ @  L@Ɛ & &  " LN w &@ @   @ @  㿘  .? ,  XN w r?`@8 ``L`T&@ `P&` &` >` >` @LC@L?@t㿐?#@?* @ .`@2@ 6`@'@  ? 㿘 H ? 2   L"`L@M $  $ H ?$   ?$ @`$ 㿘ݐ ڐ * Ր * А* 㿘  Ɛ $`` @ r   g`e Ґ`P`L&  `&* `&`P  & ??`?`` c@.@`~`P  & `2.@``l`P  & `"  H][`P  &  H     O"`L?p $ ` `# ` a/'/ဦ`/// P666  ////'&//耦` ''@TȐ @&'܀`  @ ? ?a  $@QC p㿘`H$` Y$`W!` `@ `L"`L@P $`  $`H$``@  3 'T`@@Д" $@`@    `$   "`L,?P@ `$@   $`H@(  @ $@  !`H  T` 2` ! T`@@" `$@&㿘?#6  `RU `6& @@`@`@`@`@`@`@`@`@` @` @` @` @` @`@`@`β`` !?@@`!?@Ò#@#,   $    (``    00*` ``   㿘  1 !㿘` `  G8@  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * 6 @`"8@  * a@`6 @8  X x  h  L  h  ` l t | "? $`2"`?  : : " e("`D"@"`"` "` "`$"`0"`4"`d"`H 㿘 N 12:?@ 5?2 (1? $ E#$ ($ 0 , 2 (E#$ , ( 0  `?$ $"` >` "` 8 ,"`"`,?€ 0$ $㿘  $ &`  " P" D" L" H㿘 $ , 2   *@ (  0 $ ,<  2    * $ $ ($ $  &@@    ,@O"@  #$ ( (" @8 ,  @O"@@   ,@O"@ $ ( (  $ ($ ( $ @@$ $ 㿈  $`"̰?  "Ȱ? 2@  2?@ 2  $@   `0`4 @``>#*` `  $@"U&  @?*` * 4 @   3 &  / &4 `  '   $`& 8  $@ Ť "(&  @?*` ?c4 4*`  , $`& 8   $@`   & & & &$`4$`0L   $`& 8 $@`"& `  $4 $@"&  @?*` $`4        &4    !8&  $@4a $ 4 "&  @?*`?c4   &$`8   $@`8 88 @N`8%"$`8@&@-"&  @?*`  a$`X4  $`\4  $`T4ag򀢠d $@$`````T@0 "k&  @?*` `` &*! `h*  2$``4`T ``e( &*! * `h2@ $``e( $`D$`L$`d `h `d`L@b趒   &"!8 &!8&  $@ $@$`` "$&  @?*``L * ?`D * @@7`@7 񀤀  "&  @?* `$4``* `h2@  c$``   "&  @?*`` $4`` ?* `h @ 4/! `"&  @?*`` $4  4"&  @?*`` $4  4```X`\@ n??" `X```h* 2  ??$```X`\`` *o`Le( $`D$`L$`d`db`X `h`L@ i &`X `d*``h$`H$`P`\@  @`P X &  $@ "b&  @?*``L * ?`D * @@7`@7 * (7 7ꀥ ">&  @?*` *@ 2@  `D* @@7`7$ 4 $4$`8   $@ @ $@2 &  $`@$@`@` :`@ "&  @?* ``@ *@`8  $`84$  $@ "&  @?*``P * ?`H * @@7`@7 (7 7ꀥ "&  @?*` *@ 2@  `H* @@7`7$ 4 $4 @ & $`< $`@$@`@` :`@ "&  @?* ``@ *@`<  $`<4$`$`<"@i $@`u%`<"`( `,` $ ""@`88`8&8`8&@"$`8 @?.``8 2@ $@`H `;.$@޲` 68  ":&  @?*` %@B > `$``֒&$`& 8?c4 4 *` ,`  &!8&  $@   $@ ?M?& & && $`0$`4`  @ 8     $@3?  ' %  B@B > > ``` $` `"@$`& 8` `4@@ " & 4`"?㿘 ? $` ,2`,0 `" ,€ 0 ,  0€ $$ $㿘 "4? $ "0?  *? = :  ?   $? @ ,@Kk"@   $ $ , "@Kb$ $ $    0    ( @#㿐 N?`$ 2`0H 2 4 B?   4 0 " * %% 0% 4 3*  0  42`?% 0 % 4 % ` `@ ````@ @B "  %`%@=` ` ?` `  =`=`  % "? $ 2 ?  4`?㿘 `"U?`$`"Q?`("M?`, 2`0G?  2`,>?  ` * `( `0  `0`,€?0* @@J@J`D:ؐ" ?%($ D`H:ؐ" ?%($ H`d:ؐ" ?%($ d` *`,@J$ ,& $ P .ж6 @ Ѕ(`@`(@ 6  ?+ "? 8 m  ``.`"`*  .@( U(.MЄ&2?7  .@1  @(`@((6 14`@ (` & &    & &pᮒ}!,? (@    ?(` ?(`@&/7 /(/@7 `/7 ((&7(7@@0 ( 6 26  ? .`( 6 9 @@(@(@@"@ " (& @ (.   ( 4  (< @, (@(@'@80//7 #  @ /7(7@ (@06 26  ?޸ @*#@%  &#0    &p(㿘@vĒ @v@ 㿘@ɐ㿘@B       0   0  \ \                 4               4 (       4   4 4 4 4  4 4p &c8@  sc J  o`?#bJ  g`?"J  m`?#"J? f`?"''''ܪ    )F% ' &; 59 & 00*  T@€ +  (  %  "'ܒ 'ؔ ' X@X*?J`-XJXJ  $X@@Ҕ@?ǐ?X&*  @@܀  Ԁ`` &cP@' 2 `  3@' @?А   @)'`L`L` &c@ J`"' &c@' j @=>耢  &c@'  8Z'耢 2 @ ?А  '`L@ `L "'`L`L  &c@ː J`"' &c@' 3 @/ ' &c@'z '   @@Y :  @@S .  @@  @,'Ѐ @@ @@'В`@J$   @ * ? ;F*  @€܀ @L<  +0u  & @cД @ f  &  @ܲ @0X U RԀ O   @D "D @D "D @ D@c 61  4 @@/* 2 @  ؀`"   Ԁ  @zЀ  0 @c;Ѐ  ؀  @#ز @J 2s 8`L  &c@ @ 㿐L #?@< " @ ? `2? &cؔ@ΐ J` `? &c@& 㿐L ?@ " @Δ ? &cؔ@ J` '`@&d 㿘 " s "` s# ' P ' X  '"@)` 0 " sc '  ' @  '"@)``@ 㿘@ 㿘@ b "!@   "  (@*  :`@J "   2 㽐 L0!'"$ ' @W  " B 6+ B+ 3` @; 2* @ * < " `4@s@A   = b<9 $ @@ "(  @F3$(@  @>   @F ", - @ 2          '@E!㿘 "!4@s  @  a8  4  4  (/  6+ @}@ 2$  ` 'a @'X @" `@6 "@. . .  ,  ~B?< W$   4  Q   M I @ $   @ b !=< 9   3  /@/ *  ! # ""   <b$ `<   'a @& @`@ 6  ,`   "@"". `*41 2. 2 `)   `` ```  `J@/`  &J@J@`?㿘@㻈 !' '@4!8@t '@!@$@%` " 耦@  '!H@a@_@! <   ' '!`!h '!X@a '!H@a  '@D_!p㿘 @8.`T >`  " @ L 'a@ 0F!\   <  2 ' '!`!h !8 '@ː!@  ,`T :  '"@@! "`   "J `` 6 ` '@p!@ '@!`  '@g!` 2   '@!!؀  "@t4 㾈 ! ('@Ge , /`  `    " 67 4   $ " 쀢`4  "  , ,  ,  ,@D? a  '@CÐ!㿘 (   ,@M̔  "   `$ "  , ,  X !  ???????'@u<  `?`" ' '!`!h '@!@] "`   "J `      2  ' '@!"  " @! "a\ G @= ! Ra!8  ''/'@  '-$\@" 2  '@ ܐ"0 ! !< @  $\!8@Ґ     '@"8 \\@  $\ '@x!@\  'U"H@\< @@ 3 '@" '@ "  !< \@  $\ '(" !8@   '"@e# "_aa< /','`*`:`a<2@\ "!@\J  '"@d P@8\@j   " '#@S  '@"x<!<.  `?22 ! '\@8#0 #0\@I@\  @4 \ 'a<* #8`2 @4  '@#Pa<.`  2    '@!@   '@B#h`  ? J??Ȓc?/'Đ'''???@H'@P !' E " 耦A`?@=  J????ؖ⤔ ???/'''''@!`  B*2 @2 2* @ * @>`@Ò  $@#y@@  @ a  '@B #p㽐 " ` !' @G P ` 4Ӱ -` (@  ˦  @"ǰ @" 8 `+`$$ 0  ; B> `  0 h: @& h` P*@  :`   @  `0  e<eD `L @@> ` 2r.``"@B@/0` c.``@B"``0 % @@B  "`0`   ,`` .` `P*@ :`     `0  e<eD `L  @ ` 2.` `a@@A˔  '#@ " `" ' '@# @#  @,` .` $$  0  :`@ c > 0 h:` " & h@"{8 !  '@A!#㿘 @] " `"  !X!p&` &@@ "``4@ ( 3@Ao ``4@ # a@@Aa b`4 @  . @S4   3 " "!<  @2+ a@ @? @ː  @@a@" "  *a@J@   "!<.  ,2 !<@  2@ @  @4 㿘@ @2 @㿘 " 耤` @  ?$, @}ǐ 0?,@v  #,㿘! "!4 ?"@ΐ$!4 !@' 2&@&`$ <>` ('7 " e( :`֖ ` Ѐ`h h ɰ @`  (b> @ 0 "@"aX h @@`0p?  ;`; @@ @ [  5 '/ (2  t<@ :@L@ B 8T @ @ &`  8&`@`(N`0 23``&0`` @!@$@s@}  2"`@` 0@m<: >  (@*0 "@B"aX` &``@  N`@   8 &`  05 '*` * p:  @ :`c / (@  &`@6 "'N`0 2쀔` @ $@@#  L  `t @ە;  d Ъ` !  (@?m P㷈 !M`0'  H`@ 2` "`@`  ! "   0@` 0` : t@<`?   `t @; 8 2   `t@`  (b: @s`0 "@"aXr F@B@ `Y @**  `t6%* @@ "1 (   X`$@% @  " $- * "`@:59 ( `%`@` "M`0 2$` @  'c@A@K `f *  ?% !  (@> x㿘 "!Tm@j "  `@͒@l``@l, ` 5@l@l}, `@H " `B@lq``@ll, ` ( @~  @l` @lZ,  ` (   @lQ@ " ` @lG @lA,  ` ( @~   (` @~  㿘  " 耦   ( @s"$ ) "    `x 3# "  @@l  @ * @l   @{2@ x " ` a,*  ?"@@0$a,`x@В@k%b$  x@{a, * 㿘 "!l ` "!l " 耦 ) " (!@!| E ! "  % "t`@$t@k` `@!|* @k`@z!|@x` "* dt, @42!  " "!` "!|d!x "!|p %!| !c! "!h@.!h "" b  "b 㿘 "!8e< "`H `   " "4 """$"a|# ""t "x#!l@~$ap+ "@3%a "! "* "d $!` %a$!`"d! "!h  l@0ap $!h (@!@l e!l!l`㿘! "!h "$!h@A$!h㿘 " 0 ;  @ C@8 ` 8 `,` $ (@ 2 " (@\!h!@z> !c* `$"$ $ $ $ $  ,`$  ($  $ $ @=X $ " 3 "aa@ 1 "`d @,` 2&a (@/!&  * "  $㿘 "!@z !c*    (   2  (!@ 㿘 !c   "! "*`   @`?@@`$`$ ", * 㿘g <  2 ( (!Д! (!@@O 3 "`  (@! `  " (@|! "ܒ?" "` @<ː "a@  *㿘 (  2   ,@< 㿘 ( "  ,@  2   " 耢 8 &   㿐 (!@|y 8 " 耦 4 (@|l"@ p " ( (@|c" p@|^" (@|Z" "` "  @R (@|O"(  ( @|J"0 @' (`"@@|@`㿘 ("X@m (@|4"h "a@J@ "     "!@4  "  "0   *@*@!@ (J@"p㿐 "    "!@J@ "   "   "!@J`"  J@ 2耤 "  `@}`@i``@i. ` ` @`@"U@   Ԁ "  ("@  @x2 @"U@"\   @x  *@ , < @ ?@ $ (@ 0C@  0? "@ *  $ "@ *@ ` * @  $ (!@ #*4@w$ d $ $ $ ` "4 :< `4 ܑ: $ h`#  " ` " 6` `*`  _???Ȗ???? /''А " `@;\Y "!@ * "ܐ?"܁ Q Q8 Q8 Q8 Q8 Q8 Q8 Q8 Q8 Q8 Q8 Q$ Q8 Q8 Q8 Q8 Q8 Q8 Q8 Q8 P\ P P Q8 P Q8 Q8 Q8 Q8 Q8 Q8 P Q Q8 PL Q8 Q8 Q8 Q8 Q8 Q8 Q8 Q8 Q$㿐@c5+ " " *!8'% ; (9 ") "7 (5 / (# "! "K- ( +BS* 0@€` ?%` (#h,8 b@p  "" (@zܐp1,8 cc@b ('   $% ",8㰐 m@U p&< (@Ő#@z `, ؐ  ,` ,` ,  s# (#@ @%X?? !X*@  & @D  p@D ` p!@D p<@C    ?@@#`  @F ? "a  '@y㿐@ " )J  ) X@f㿘  )@K`p "    )@D`x 2   )@=` "    )@6` 2     x ! "` ' pbH@C  @# "`    )@` @O?v    p )@G m  !   ""*+ "`  )`@z @ " ) )@y  )@y @l "`    ) "J `" ) )@! )@yߐ!8@  )@yא!`@R  )@yϐ!@ Q  )@yǐ!@   )@y!@ ``! "`' "`Ķ`8@gg  )@!. `* (@z* `. ("2`*@ *:@z @/  )"@y` "` ܒ"@" `$ )@y~"@' ! / "3 "9 "P; "` # ",@g""  @4@ &@zNऒ 8@g&aTऒ"@" `& )@yP"X  )@yJ"p  % )# ) @yBb 2 @y<  )@y6"  % )# ) @y.b 2 @y($%  %0 "aP ` @  , ` &`L  # "  `,6 "% "@f```@f. ``d , @ `,& "aX 2.@N@!Ha@@'!H "a<@'a@ "aP " 9"a<  " )@xՐ" "aX  )N  )@xʐ#@ "! )#(@:H  H`@@  ) x#('''@U&؀     )@x#0@`װ    !  )@8D#P㿘 "!! ,@fF"0 )@O` " `, - :1  ``@f,``@f', `  @f`  @f,  @@ @ " ``:aH*$@ +@`@* ``,&` 4?@y* @@  " ``:aH*$@ +@`@*   Y??  /' " "?????"R"ܖV`,! &"  %0    @ `쀤 %0@` @   `,& o&"㿐 !'Ð@< 1 "`@`(@A 0  ) "`p`X@A   )@  )` `  )#@  )@#Ѐ   "B "`@7Ҕ  "!@ * "  "0` ;  B`B #aL "` ` " `v9 " )`#@w` p *`  < )@Ð#耢 2` 4  ;`a<`4@`0`? ;`@  E@;  `- " `?9 " )# @wV8 * 2`@@((n9 " " `=`` 7 862`h`;1`h , " ` ?d# !`(`c* @ " " *@ "  ` `  *, ` (` @w` @7%`("$`h e(`:` `` `9 "`h `B*2@  9 "    "!`t@d?   4`( " *, `  " *@vɐ P *  , 􀤠   "!`t@w   `X " *, `  " *@v h *  , @  " " a<"`. 3T``@+  2 ! *@   *@ǐ 2@>  * * @ `#""#"!@`` @!@  *@ " *@ " 5 * " `" `?" ܐ<c``$`p$`t4`e4`  "","b(&`` 4`$@c:` &`$`h 1 * @ u  * *@v, 0@k! "`$<" h *!@ Q!@  )*@W#Д !@*@ "`@6% "  *@5! 㿘     ' * a0 b(  "b(  *@ '!8 " ` * *@uݐ!P @  @  * * @ Ԓ` `$) "' + *- */ *5 *7 * ђ   r    "!H:`K *$:@ `2     % * @ +  Y`a, ` $, @ ֐h " ` *@ϐ` K @F @ @   2 " *@ !@` 9 @4 @ x!0`" " 0" "@ """@ 0@ `  "!0@@ 0`2@0@2 $`2 0 $  & $` 㿘 "!! ,@b"8 *@Ё`  Z?t "? 'Ą/ "????? Y`, #   "b4" +  `@6+ ) "쀤 %b8  !@'J@  5 ` @  `,&&"㿘  3 3   2 b4- ) "+ *  !0 a4 $ " $4!0!0 2 !0 4@ Ң` j8 k k k j k w x x x wH wH㿘  "@ *b<@W(㿘  "@ *b<@KH  "ᜠ!@' ?* : `l*`Z!\ € *@ "h *@"   @%  * *"@ gb !퀢 X!@ *@ ^" *@ " *@"؀  *   ֔!퀢 C!@ *@ I"@"耢 ;!@@  * *"@ =b *@ k" *@t"؀  *Ր   !퀢 "!@ *@ ("@c#  @ڐ  * *"@ b  o@ *2 !@ "!@ *J@ # !@ * "` !@ * "` *# "! "`^!@}r ! ` *\Z#  ?`h:?   "`$  *@Đ#Ȁ       :   @=&70  $  ?8 @3X ' '* Z!&∀K%@+ *) *# "1 */ *@  :%@  "7  2?0   #B$ @{c %# y  a<*` ?2  0@ic # a<*  3  a<* ?3    @$ *a& * @  `"   " ܐ $  $ " *o  !  +@2 x "    ( `'" $  " 耢  "   @ , $ 2 $ (! + @ 2#     + `  *$@# "  " `"e $  ` + `8  *T,  +휒`P "  `' // / @˔!  ?   *c@q  + `@2 $ 6,  +@ ( $ "7@2 *7@2{ $ "`& $ !<* ?2 @< *4@# "  $ 4$  " `' // /+ *c@o! $  ?   ` `@@v"@74 $ " & $ !<* ?2 @;4 c@ 2 U$  Q + `Ȓ  *,@5# "F E  +`@ؐ   *  + @?  * ٔ +@!?$  *$ ̔7@1ې *@# "  $ & $` "!<*` ?2  "  `( $L .2%!`2L   +엒aH *$@Ր# "   .2  +쇒aX *$@Ő# "  & $ "`耢   + >p " `!  2   "  2 "  +`   *$,@# " ` "!@ @ * : ` Z!t*` € $  + : +@r! $ a@J `2 " + ! `  "J `| +!  +@U!`r` "<!@ @ @  *  "!< *`2  ) $ , ؖ @$ @$ + +!В@ " ` + +@pԐ"4 @!`/` $  $ ! "  J @  +  뾔  *# @ , "  "!<*` ?2 * +"(@:``2$    +@0;"H@$$"@㿘  ""D +a@D㿘 "! "*` ^ !ؘ  V"- D %D H? ) "!@J `@!@J@ :?  J@ 2  "a@  (` `  !@J `ᰀ@$  <  " "!\a<*$ $  ?3   $  $ " !@  *靐D&" } | }( | }4 }\㿘  ""H +aL@˔` "L   _^ ?ᰘ#?   /'#b@????V? "!@ "bH' * : `?^#*` €` "!<,`R ` !5`#`0L2#`"  @## +cؔ L +c9  @ 2 + +c +c Ĕ `* +#(:`@L@ "$∁㿘  `B ' "+ "   4    "aH:  J* $:@`$   2  & @,$ `  :!H* $  * *+ `%``Ġ 4 ( ( ( 4㿘  "L +bP@?b " " ` ` " @' ?*#ࠒ @8Ր "?`#("຀5`X $ ! "  +@M# 2 %$ +@ F# "X%$  ",`"`X $   + #Ѐ   +#؀ $ %$P@\*  ณ, @,: ଢ@@\|@o , $:`0@@\s*`@o, , :`@! "  @! " +#@H%$  +@ # ?  , @ےP@\I*  ณ,@: ଢ@ @\:|@oo , $:`@*@\+`@o`, , :`@@L % "  "* "L? ".  ,?#4? T#0#"`"@"U%c?P#(?# :`?" ,?%Pa#$"![#%`Tഡ,  %`XP@[഑* %`\ฐ`,`: %``?ଐ#$$@"@[@o| , :`@%`d?$ "@ " %`h$ * @%`l@[|`@n* , `l:` %`d@`\"U`d?`T%`#,?"@ c0?#" @#4#@ "L@ܐ (?#8  @7 "?   "  , 0$? 8?#  ? #?$8 @  6, "   :aH*% +@ * , _""Pb   #b@ Y""L @[@"L "@[9/@  ࠒ @ Đ @"U@ " #Ԁ  , P@༒@["$@4 %` %`,?@2@#5`5`&%`$ $%`8@n= %`p%`%`$%`%`  (`@6%`(%`( ,`@6%`,%`,U` 0@6%`0%`0`@"U@%`4%`8%`<%`@%`D%`H%`L%`P`T`T@?#0 ?#,@6Д@ L2@"U%cฒ@Zǐ?c?`@c #@`@/`@"@ "@ @* : `)_"Г*` €` %`` ? %`  `@"U@:@`\@   ? % *@  *( ณ* , p:`@Дศ Ĭ`%@"U    ` :`b@`\@   ? %*@*`  ? %` @Ȩ @"U8 3 @"U " @ H:`J *`" : 28 `:`c@``@   ? "+@@* 8ז@8d ``%`@Z|@mF`@-T@`T@ `"|@Y@"@m.@Y@Y@"@"@Y@"P@Y@m* `-  @`X@ @YՒ*  4$`$>88@m &``l:`@8@l &` ?"@  *@ &,$`$ %`$ `:`c@``@  8 " %  : :@ `4@  8@@>$ 4 `l `p@`h @@  @  $4*   #  (  `p 瀋@ %?$4*  # %?`$  ' ` @ ' `   @ ' ` 'P@@5> 8 ,@ `   "`$@` $ `  $ `$$ * "` @+ "! ?4@5 ?`@"U@`T`T@ @"U@ T T?#0 @4 +?c8  , p@ ْ` "?c4@@@+M @"U@ T T`@"U@`T`T@?0 @+7 "  *` "J ` ?c$@@ F?@"U`"@`\@ " \ $ @"U  "3 ,- ."   \ : 2  @X@`Р   ?#$&`?c @@ 6F`@"U# `` @#@``@ $ @"U  "3 ,- ."   \ : 2  @X@@ʐ`   ?  €`@"U@b`\@@"U" \?, @4" $?c8  , 8@ a @ "U@" \`@"U@b`\@?#, @4 "` *`?c@,@@&L ?"?(%P!?##@3  #8 ,@ `  #=  "`=--Ґ *` !  ,@)!8     㿘 'H'L'P'T'X"@ݔH@ 㿘   !` ! ,@i!@A  !`  ,@iא! s#  ,@iА!@Ӑ 㿘'H'L'P'T'X ԔH㿘'H'L'P'T'X ȔH㿘 @`L ,!㿘 'H'L'P'T'XH@ 8@qܒ / @oݒ <   L` r`@, `@3O㿘@q / 1 $"X@, /, ,aȔ$@"X"X @$"X x "!! ,!@o  ! ,@iQ!0M8@o  @ ,!@iB>'< @@#L@! %!@ow؀  w ,@i%!!   ,@i"@ `wâ @ `2 㿘  ,b @ @  ,b @ِ 㿘` ,b0@ϐ @ϐ   ,@ ,b0@ 㿘@Ő  ,b@@   "! "Ja8 "?* " '@o (  0 @(`L ,@h# <    -  -@ "  @ !  "c @`L -@h 0  "`   - H@h "J 䀢` ഐ@ޒ   &`ഐ?`&` - P -@hs `ഀ # " -@hl p# " "! " ""a\"!Pa? $`$ , $ ,`$`@$ @  $``c -P x@Ȑ "" ( " ""aD"@U  H " "` A ഀ 2> c@ 6 -@l 1 @D@UՒ@UВ,@  ,$@* "`@ - - - - - - -#\ `ؔ !H@gah  -!9  " `  -J@g!А  `рഀ  -" -" -!? 2 -"  " $1 " ,5 ""aT @U|  0 "*@ *` t  :` :"  @<` @ E   ` -ݐ"@ -@"h`2 " ,   <`c -ː"x -@Ԑ"h  "`<, ` `$ - @ -"ഠ ` "` -@gu"ഀ 2  -@"h 2* ,`   @  -*@ -"  " -@gR"ഀ    -@"h 2 * ,  `0`H  - {# `0ഐ "`H -@g/"ഀ    -@j#( 2 * ,  `4`L  - X#0 `4ഐ "`L -@g "ഀ    -@G#( 2 * ,  , $H0204"0 -4-#X `:%0 -@f"ഀ    -@#( 2 * ,  %(`< -#ഐ < `"( -@fĐ"ഀ    -@#( 2 * ,   H8%8: @ %< "!%< -#  H8  ഑:;%8 -@f"ഀ    -@Ԑ#( 2 * ,   L8%@: @ %D "! %D -#  L8  ഑:;%@ -@fn"ഀ    -@#(   * ,   & 8  ::8 L8  ::@&  2 e,.ഀ 2  . .@ (  "H }  "ଚ` "଒ ",` <:%0` "(`H8  ; 88` L8: ;%@*`+` ] eLYഀ 2  . .@P x  " I H "  " "L  "P #\"eT %`"X P@S*  , @,: @@S @f | , %$:`@ *@S  ` |@f*@ , :`@ L%@  $ * (L`  " `  `@%`h`@  @/?  "cP cP 2` .`@e 0 4 3 ./ -5 .7 , ``0"4cP`8@S; ``dc@ܕ* 2 `@  @. r  0  ժ` "!T` &`:   ? @. " "aH . @eR0X  @.  " "a@  . !   @.ؐ  " "`  .!H@e8`0>  @.ʐ  "  "a<  .`!p@e)*`0/ "  " # ""a" @.$a! "$ a@.   !`"#􀢠a .!@e *`0@ Ӏ` " *` "*  @   !  .@$!㿘- "  " "!D :` @P  "  !c @4 2 ! % % \F!T@ .xa, 4 .pa` .ia@Ri ఀ  `,`@R`?` &`h .Vb! " .Ob(!D@RN`d`4 @e-@ $!D@e|`B% ,% "@R;  ,  @R2*@  @ h@@  2-  @  $ " `+ . .@dg"H  h ?' . ` $ @dV:`  b@   "*  㿘  " `"  .< .@d9" ."k㿘 @?" J ? (J? bl   `  .H" @L? bl   ` "L`* :@ `` !ԓ*`  ,# . #e %h@-  &4 &8 &&$`0&`,&`8&@es`(&|``4@ej8? @ee @Qx8?&`&?<``* &@"* &|?@d8?@d@QW&@QQ@d&$@d?@d&,`&d <`` &d`( " "!D㿘e! !`e@"X 6"X    @`L .#H .#`o` 2v `  2q ` 2l ` 2g ` 2b ` 2] `, ,2X `0 02S `4 42N `8 82I `H H2D `L L2? `P P2: `T T25 `` `20 `d d2+ `h h2& `t t2! `x x2 ` 2 ` 2 ` 2  ` 2 e\%\  㿘< @@"%  (@" 4 0@" 0 @ " @ "   `"  .@bÐ# 㿘 " ` . .# .c@줐 /`?@b   " "J 䀢` / " `  " /@b  !U*cJ ؀`2  /    "J 䀢`  /@b D !+ /) @b`0@"`$@  $ !``  ` "`   !   ``? "`@ː 2 y Y n NΒ@bL y€ Y !*# 㿘 " ` "0 ""a4@", 2` /8 @ "  "?" " " * a $ "a  0@c($  / / ?@`$ $ $" $ $ , $ @6! @ @`0   `! " 㿘 "! !  % " "!`d.  " 2 a ` a   2 a  /ِ `@a   $" "$ a $a "`$a   $ 㿘 "!`d .@  "`@ " !`" @& & & 㿘N` A`  "!D@b` 2 / /   /` x``.`` @]&` " 쀦@# `  ' "`#P@@O' 8   0"@ d * @>` 0  㿘 " `2 / /@aS  /  .#  /K Ё㿘 "   !@c0 " ` "J `') "`!D :`:  @ "@ " `2 /[ 耢  !D: @ $ ,k! "g   @7 ! "!  + "`) "5 "@" S`@`@   @"%!4 /"@!  %a,`  `р " ` / /!   !@ " `` * *` ! "!# "*` *  a@a*  /!!X@`a@9@7㿘 "!D >:`@ @̖ 6 /!x0  /@dR /W #!@ 6 /!x @* /@`j! : ) "9 // / @d, * <` D @ :C  @ D `@M @a/D@a+@`;! @a#@`4Ȱ  @@Ͳ@ /@`+ 㿘 _ "!D >:`@# @P 6 /!x  /@fY / " <"aP!А@5 6 / /!x /@_!ؤ $ /' "+ /D@f6D @ < D @ :C  @ !D@`@_Аa!D@ /@_Ȑ 㿘 "   " `8 4  "aT "   ``8   " ! "-@  !H: * J& : 2` 6` @ : * H" : @6`e`@`e@M)``@M$, ` ` U " `Ԁ  /"`@ .# "U% " ` `:H*"@ +@ * `; c` ` ` ? #@+*@*`` 8@ $`?$$"$$` `8"o `T 8 "@ &^` `?r`  b /b(b    "!@  ``  /b0@%0L  ?? $b/'?????# .#'̠R̐!d''Ȑ 'Q' "@!ؐ&@@ْ / @ .@ȀR! /b8'''3 R$b ?.@|@" 㿘 " `N @ 㻐# a' /@$@H@!@dΐ  " "a @' a  /@"x㿘@  @'ِ  @'֒ 㿘 '   ! /#N 0  /P  "" " `  / /@^D" & "   & &8"p "   `L ''$ ! /"@x   "'@!* 'Ԑ  /b'''@!!' /` '' @g@!$L  /@"㿘 8 /  +-.` / /0T  '; ) @@2  8&/@/ 8 /`/  8܀ 㿘 8> /0#   /@ `?>@ *  @ *  *@  `?>@ *` @ `?"㿘 8 >   /0  /.@>@ *` @ *` * * .@ >@+ * .@#㿘 8 >   /0  / .@>@ * @ * * @ .@ >@+  .@#㿘 8 ">   /0  /@`?>@*` @*` *   `?>@>   b# 㿘@X@9#  @f   0"@ ax@ @] "  0  0"@a@ ! @Y @m 6 0 0@А! 0@!Ȁ  0 0@ǐ! 0 s  0s"T  "c\  "cX!@ 0@5逤f !X"s 0@"s \ @P   s#\#`#d     @C w   h  @; w#| @6      #\#l;p#x #`'#d#h#|    @B  @%   ?''' @&  @&  @ @ @  @#\@^ 㿀  ?''L'P'T'X'H'`L?`' '' @%  ?`? #####`   L ( ("#㿘 'H'L'P'T'X@H@@M 㿘'H'L'P'T'X @pH@x 0b$ 'H'L'P'T'X@  @H㿘 #` `"#`@㿘@\e 0ܐ"@@ @C㿈   ?'  @E ?   L@,? 0"X㿐'DD  ?   D@' ?  @ L 0D"㿘㿘  @   0b@b 㿘@h@Đ @ݒ ? 0"a@C @? 0"W@C 㷀) !'% 0$@ߠ' 0$@ߚ  @Q ' 0Ɛ#' @$  0 0'' c0@#(@?# 0cp=''@5cp4@m @CW %  0+#? @  ?As$\ ' ?@ ?@?   L  0%#〢   1 @Ғ ?\ #\ 2!    1 1ݐ (@$ @C  Hs"T  t"#X!  1@w xp@Q 4?  ?ؐ ''' @$b  @$^  0-# #X1 1 1  '耢' 1  '' @# ! 0@# 1 #~ @B ? 1 0 1 Ȓc? @Z  ?@Ð [1s@P ?@Y?  L  1 0 1 caB1s׀  1 0 1! cR@2 ?Ր?Ԑ     #\w#@@?'@ k0 1 0 1͐!H: 21s  1 1 0"X!a@1v "T㿘1 "!Ā "  @  @ф L 1!    @䗘 &!    L@q  1!㿈 " D!Ĕ '''' 'D   D@U L 1 !؁㿐 " !Ĕ ''    @> L 1 ѐ!㿀 "D!Ĕ '' 'D  @є 㿘@Ő 2  @G* # 1@a $   a@ . $  㿘@Y   " @S@Q   @K@I @G㿘 ) /  +@  , @# , &@{&  @ 1 1@& @ `  & ( ""!& $& $$`(㿘` @@`@O`@L@ @ϐ$`` 1@@y`  $`` 1"`@ %$`` ! ` @@` $` 1"8 W  $` ` 1"P`@Ű $` 㿘% "    " (X (W 2 $  1s"T`` 2@_] @a1w 㿐@O?  1 ʐ"p0' @"  @i 6  1" @}@  1@" @@א 㿈@٢ ` `? @Ґ?w?@N? ` 1"k? g@@\N  @ ?0Z@ O 1`  R$`  O$` ")`@` @Ĕ!?  L   2  1c@^ @@@~  1c @^ @@ڐ@ ` $ 4 ` 1`4#(@{ ` h@s ' @!z `@}.@` 1@#` `@@O 㿘# "a 4Q /   @ . $  $` ("`($a (` $"`$g0P?2$ w! "c\@ $  x   w  "w  w@  \ \㿘! $#\  "   "!@ظ &  ( "1   2 (?2& w!$#\ 1  @}u ?"#\#\ ? #\㿘' "ἀ D  ?&  ( 2 0;  ( 2 @m` 2 (  &  1 #c& "     ?&   1 O"   @},& 0Ғ@] @_y "! "1w `2 (`&  @}  ( 2 1w  " w  (2 w  "  㿀 "!       @|$  ( 2  1# 1 0!@ݒc1 1 @ ?"> @MD?8 )  ? ''' @   @   0^# @ - ! 0 1 ` c@{@# 1#В# c@> @| 䀊   :  2 1   1#,  @|??# "  L "$a@ ؐ ? @| ?"aa   L ?  L    $ 1 1#@1s"T㿘 "!`  1`  "` `(`2`  1 1 0!c@R  2 .  @|N??! "  L ""1s$!@  ? @|7 ?"!A!   L ?  L   $ 2 1D#1s"T㿘@ (   @*`2 㿘@  @u 1' 2 n L  o  @ݭ = 2*`"@ː 2   2 @2    &*@&`8@  @0 2L@  , \ L | < x H x  < h  ! s 2ȴ'@\` ?'$    " ""a"x"l@٧  2 @> "cl  2! 2! ?#? `c"0@"@?Xc' ''@@"@X''?' ^c'''(@! 9 % "7 / "- "; 3#@@wՔ?B? ;:y* H@€  "3"x  "/#c@! " )"c` 2!@X$`! #"@! #ad 2!@אp`@!/'!T 2!@̐ `@! " #c 2!@d $d@! "h 2!@a`@! " "c 2!@〤`@! &P 2!@؀`@|! #ap 2!@0̀`@p! "t 2!@bP`@d! " "c 2!@wp`@X! "L 2!@kb`@L! " "ct 2!@_`@@! "X c` 2!@Pb`@1! "al 2!@D` "l    !`\u` 2!@wc  2   "a`g"\!@k  2  #a\\"!`@cY`@! R"D 2!@PM`  H#a@! " B"c 2!@p=`@! 7%| 2!@2`@! " +#cp 2!@&`! 2@' 2 `@! % 2!@Ԑc`@!  "aH 2!@Ȑ`@` !X`*`@ &  "l& ?@?c@@@J2    "?#8 @T?0 "cl 3@ @ӣ + 2@֐ & " 3$@% 3 30 $&@@xҐ 3 8$@@xȐ 3`H@r  "l % 3`X@ݨ   @b! $ " @. ''77''/7?''''7@[ג / 2 " " 3`$`h@Mc? "c@Y?  " " 3㨔p$@;`h "c "cx K?@ʒ   , @L 3x@,@̒   `h @`L 3 @`h@    % " r,`h @  ,  @,   3`@&  , 3,`T@ؒ,!', "l  #㰀 "@Io  # 3c@ {@l  '$ @w`L 3x@?c@@@$  H @f`L 3x@H<    "cl 2 @ s#Ȕ 3@R @@q ?" 3J?``?@ $$ l `@ `  $ 3@@m $@+M@  bl `@ `  `M@* :@ 2 `  3@! @NM@ ` | 3@!H@EM@| |@%||@   " "cl   3M@!x@0@ "   "H "." "p  0 "p 3@@!   ", % 3@@ ! "c`   ( #c` 3@@! aL? "L"aLt  PJ "t "tP  !T` &P((*(&P!T  ` @?`  '!TP*  4 '!T d   "!T@S@? &  #ad "c  P* "cX   \  a`?aD  3b@  3b@@   #a\ aD? @"aDD  #H@#cB"H "#p@? H8"  "  "# b 3 3 3bh@" " 2@!T2 "@ "'` "'`'` `'!"#ch@R" """`@R #%@R ##c "c@R ""|@R%|@@S7$$@"!`&a:`  """`@?= #%c@?8 # ""c@?2 ""|@?-%|@@?)$@ "c@R\|`$  "   @ 4  "" " 3#c@QY"$@P "#ha b@R9"@>@ $@`&a@@R:` $@ "cx   "@  @Ò "x @ @ $ "l`@Gi?  3 2`@o @Q 3c@ђ$0K#$@˖' 3# 3) 3% 3@q `@# `@oݐ X@ ?` Z@  ? 2@ؒ ?@| @v ?c(@o ( @:  @|А @7`#0@n @l @a@ O @ M @ K  3@Ȑ#X a?'`' '' "# "`'@>X| '  2``@-  @|`L@| 㿘 " e`e@Ȁ 6!3 #c   "`@F"  3c@' 0  3@o#h !@!ȁ㿘 "#`6(6 e`g@퇔  3@oh#x 3#@㿘'H'L'P'T'XH @'    scȔ @| @| @|@o{@|? 㿘 "cl    s#!  4b@H"  s#!  4b@?" 4c @:b aa % 4l "  " b@(8  l@|   !'D''H@  $ '"`D@@  $ "`@@@  #  "c@@}  $ "`T 4c@@nĐ @ڐ "cl   " "`! "@=|#\   @??$# 4cH@n  "#` "@=q|#@  "# $ $"`H" L`D?"e,"e(`D  <"%("%, "| " 4cP@H  "#| "``D@ 9? " "p`D"`"` 4ch@4 `D   4c@+   !p`Dt"d"d 4c@ `D$  4c@  T `D!P " 4" 0 4c @ `D 4  5` @ `D " 4` 6 0 5`P@ `D 0`D 5` @`D 4 0 `D 5`@ސ `D0 P4?  ;`; 8 8 H L88 8@ > "`P`D 4 " T > "`T`D0"`T:  "8  > "```D`8 `D`0 `4;  5`@ `D " 0 #`2l2 4$%P$ t@O$ x$ | $ d > "`d  x`Da|4?@O8?@O@* "``D@`D* "`D  0 *` * ?: ;%0 `t:`@慕<  e0@B:  "cX"cX`D "`@< ``x6`?@O@<`0*` @O6?@O2@;cX @O*x?@O% @;x`D x `@O:   |@;ߐ  @;ڒ8  @O  @O@;Β d$ `$  4 $%$`D  %P@;*   ,`@,:  @;`D@N | , %$:` 0 *@;  ` |@Nӓ*@ , :`@?V#? "# "cp 22 : :` " ""1"p?=#@j "`D`0 * "`0>cX-* "cX@N@;_`D"``D8`*` "``"8`D 0 4@ `D 5a0@? `D`8``:`4?`|** "`|"`8"``"`4`D %P@;7*   ,`@,: @ @;*`D@N_ | , :`%$ 0 *@;  ` |@NN*@ , :`@8`D "#`@; @; "@N9"`D?`x @N2@:$`7 5 `8  @:`D"`0= @N* `D?`x@N`D@:x@N  5 x@MX`D ` 0 8::$ `$ 0$ 8@M@:`D$ P@:,``D*  @`,`: @@:`D@M | , %$:` 0@ *@:  ` |@Mϓ*@ , :`@`D @`D`D`0* ""`0`@: "@M"`x?@M@:u$``D `0@M,`x?@M@:gr 7`D 0@M* `D?`x@M`D@:Tx@:O`D"`0 @M* `D?`x@M{`D@:@x@Mu  5@L!``  " 5@L|! 5!@Lx` `D 5@Lq" 5!@Lm ! $` " D  0aT  5 5" @L\b@ D  4aP  5 5"`@LQb@xT #`D @" ! # "cd " 5 5"ؒ" 5"@L6`D ?@M@9cd $  " `D`@9֤ "@M "`x?@M@9˒$`0 @L* x?@L@9 "" @9$@L"x?@L@9 $`D %P@9*   ,`@,:  @9`D@L | , %$:` 0 *@9  ` |@L*@ , :`@`D "`D "# "p 22 : :`## p`D "eP㔀C`D`" @9R$`@L"`x?@L@9H$` `@9B*  `, @,: @`@95`D@Lj | , %$:` 0Ф *@9%  ` |@LY*@ , :`8``D  @9 |@LG$ @9  `@,  5c@ `D   " 5c(@ 3`D#d`. "c)`  ` 5c`@ڐ `  5@K)# `D`" 5 5@K!#`D@K#`D 5@K#cd``D@w `DP@8*  , @,: @@8`D@K | , %$:`@ *@8  ` |@Kٓ*@ , :`@`DL@  $ "|d|<$$@8@K@8$ఠ@8$ఖ '`D  " 6`@f  "`D #tD !LehL # @ # L  h XX@8WP`D* #X @8Q | `@K* %P  eh``D#\%`$%X$%T`D%``"%X"%T  6`D|`਑* *  6`D #\  6  6 6 6`P 8@Jk `D"cXD LX "h * D %P  - #\? DL?, TP@7* 2`D%P `DcXܠ`D@78 ~`D`D|@7ޒ@K@7א@n@K @7@7̐@c@a@7@\P@7@J`,L?> - #\ T@7* T?`DeL?2eX`@@*,eL?2eX`@@@`DL?,- #\ TP@7 *  ",@`DL?2T- #\P@7q * 4`D`8`D`D@J@$, $,`D x ` @J:  @ $  ,8 ? 4  @7F`D``@7@. `` @79$&(`,@72@7,.  @7%@JZ8$8@JU 6@Id`D 6!  6@I]X@u` ?@7 `$`"@ c  @7``@6, `D@6 $O`D`D8* @|@6  6ap@ِ `D`'@6ݐ``@6ؒ, ` @6Ґ`8$@J@J 6@I`D@6| 6@I `D ,$ , @O  `D"@$ `@6``D@I|`D "$`$`d`$* ##| `D "cl 2 ,`D "|`d`|@6:@6?$` 6"@@Hѐ"0`D ,# p%D*  0  L2  # #  # l  > "`p`D @L $ # P 6bh@g  !h " !XF !dT "# <`D$%\$ @$ <$ X@I$ \ a\, $ D`D$ $"$ $ $ $ * `D *``D@" "l`D`/"|@61$`D 6` 6#\``"H@Hqx`D 64#H 6$"#`' '"H$ H#\',?@HS ᄀ  6@HL"@ `D , 8 1 65 63 6/ @ a 2&`DD`@5D@5- D``d ,  d@#(@H0 @Hc8@`D `,  2 " 6@H#0 "#x` "l @t @`  "#``D$ @H$%\ |@`DF`!T "e\`D`T`>``0"`d *  $P @u`D 0  `D`D `, "D@5u```@5p- `  | `d@T,D`,D "`@H !|@G`DD ( `D 4  ;( `D 0  6@:#@㿘 $ D @5: $4@51D.@5)@༴ @5#@5@@ &%@4?@HJ @ $ P! $.@ࠒ  @@D@ @"U$ $ $ ,?2@4 4 D&@4 $ $`@H!8$ pD @$T`,  $XeP@4`* $\``,`: $`e$``@4`D@H| , `:` '$d@4`D@G | , `:`@ ?$h`h` $`h%$ * @$`l @4 D`|@Gۓ*@ , :`$`d@Dd`"  6cP@成 %@D ` '" @"U  @: ` "`\@@  ? $+@*@ ?"  ') $ 0' #  @㸓, D "l0 2   D@4N```@4I. ` `d`0,@. D 8  D x ` @Go: Ԁ D@"UD@Ga`8@`"``cؒ@@D%$`@   l;  +  $  * * @`D`$`@4 |@G8 * `"`T`T@@ `"D |@3 @ @G @3 @3@y@w@3 @r@3%P@G  @* " X@3̐@G* @  @@3D@F @3%P* @@@ 4@D`8DD`("`(@D (" 8 @9$ ( 1$@*`4  "  8@ %@'D@"U ``@: ` "``@@ `` ? %@+@*@`$@ "$D`8@"UD@F`8@`"``cؒ@@ҔD%$`@   l;  +  $  * * @`D`$`@39 |@Fo * `"`T`T@@ `"D |@3% @ @FW@3 @3@@@3 @@3%P@FD @* " X@3@F8* @  @@2D@F, @2%P* @@@ 4@ D`86/D@'*`4 @ U"     @: ` "``@@   ? %(@* @ $  "$D%$`9 @ l  p  h  `!     D%$4+    "  ( @ `@`p怊  DD%$4+   " D@` $`$`̐ $``Đ $` `Ȕ$`'@'` '`$'` @2]```@2X. `  `d`0@>,㿘 # "#l c"` "`"`#!4c "#c `4      "@$c: < ! $ Dc@D4 D$(`Le@ :`B *2   $$h`T`d`4@* @T 㿘 $  T "  `` `6` @_`?$ @ a, @*` `2` @M"㿘 $ D ! $d* @@ @@`"U 6-#p` 2` 6&# ! 6 `@` Dc``@D8@DD@ɒ  D`@ 8` &` 6#@C 0 D@``U`@@ >`@ߔ D%$``@   l: * $  * +* `@ $`  D?#` P# @ ? "` #` `#  " D@1^ |@D `@* @"U@"TT " D |@1G @ݒ @Dy@1? @1;@Ғ@В@15 @ː@10%P@Df `@* @"U@" X@1#@DX* `@  @@1 D@DL @1%P* @@@?4@ D`0E`4@D<  DP`8 "@ " `8`̘#`@@ #`$4 "$`8"@*`   `8 ' D@"U , @: `"``@@   ?" +@@* D 8  D d*@`@?c@F! $ $`D & l d*@p @ @@ bU 6c )@▖`@6` ?@" "\ `  * @*D d`@@s*D $ P"?",@0y@ D 7` @gD @DW@0i @DP * @0a  @@ @?@DD x `?*  dc @,@  0@D@?x*  @D0@-㿘 "#l`  " "#`@03 "@@0` ; @y>   $`H@ 7`8@aH "㿘 "#l`  "#`@0  "c@m0 "#x` "` ; @L>   $`L@ f 7`X@a $㿘 8>># 8 2 8@  `?>@ *  @ *  *@ `?@ *` @ `?  7"@`x 㿘 8 >    7  .@>@ *` @ *` * *.@ >@+ * .@ 7 8"@`㿘 8 >    7   .@>@ * @ * * @.@ >@+  .@ 7 8"@侒`㿐`h @?    7@V Ѐ  @ " P㿘@1 7D 7d 7P 7d 7d 7d 7d 7X 7d 7d 7d 7d 7d 7d 7d 7d 7d 7d 7d 7d 7 7d 7$ 7d 7d 74 7d 7d 7d 7d 7d 7d 7d 7d 7P 9p 9 9 8 9 9 8 9 9 9 㿘 7`@C  $ "`l +) $# $! $' $% 75 7 $9 $ "* a@€ % \ $`X$ d $ d $`X  %l  $h@@c?ߐ?X* & @ `X @@@  @f &`@0@@m p㿘 $ X`   $ d`  $ ` @    $ h`2 @b 1  @_Ò ?` K"*` €X ``z`! 7 @6 @_m $`! 7`@+ @b  2X ``\`! 7 @ @_ڒO $X M``@`@ F@G  @$` `  X 2 `8``@`@ 2`8     $ l $  l@` @` ``@ @@C` X "` L  ` 7@_d  $ "`p@ɐ 2u`8 L  7`@_/ 8 m 9 $7 $5 3 7% $ +<; 7/-8@L   h 8!7FX " @ @_T`E$p  X $ \`X 7!@_C4$p  ' $ @ "( @k  $@`  l`@@?Ɛ "X L "@^`$p  㽈 !'`  @  $`<  `  7`! @^ @ ? $@,H?P*$@j@  7aX@^  @ K`02@    @Eْv@ <d <`耤@C h $  @ @` $ @ `02@    @EH@ <d <`耤@B : $  @ @2 $ @`02@    @E}@ <d <`耤@B   $@  $@iܐ $ `"`p@iӐ 7 @^  7@ ... ... . ..termcap dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :am:km:ms:\ :co#80:li#34:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:IC=\E[%d@:\ :K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ic=\E[@:im=:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kD=\177:kN=\E[222z:kP=\E[216z:kb=^H:kd=\E[B:kh=\E[214z:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:me=\E[m:mr=\E[7m:nd=\E[C:\ :rs=\E[s:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;m:\ :se=\E[m:sf=^J:so=\E[7m:ta=^I:u8=\E[1t:u9=\E[11t:up=\E[A:  (@haB   @@haB,C( @@=@@<@`dT U@ham@@<0(0pLl DA@haB6@haB6@haC0C@haC@haC@haC 4A@haCX;@haM98p@haM98p s5 @haM98p@ham,@ham, LOQ75"Pm"eTqw%\B^jAu&B k%QRe ]FQU$`C .H9\TxpZqf鯴 ca`^eL&oPAzGiif?kuHDƼgS)FřZ!`x $ d a '!  7ap@ "0, $ ``Y< ( S@͒  "O @ @O @P O逢  7  7!!  7#\a@ݐ"@@"  a``? "`@' !`  &!` `  !` ? $ @!`  &!`` 2 `y `Ya a  7@1!㿘 @ % $# 7@F ? (J /"*@F / J .2 J  .2 J 2    @]a $p `&   &  㿘 s# 7 a@T"@j< 㿘@P@@Fo / $`" `@" 7@bx  7  "a4   @א" 7  7"% ! 7) ' - / @@`x"? f!X4*@`&  @ `  `@~ `? `@v`@q@h : $0@b :,@0@x` 4@iː 4 @0 '@Ҳ`% 7`@\ @ 2    "0 @ @ 6   L`  !0` 7"@\ @i  40 @`7 @. ' J` 0 7@b@  '0  W@  0'  a@ڂ 0 7bؔ@\9  @@0a@l  7b@\& @ 0 @@i; 㿘 R!8!8T`" 7V@2 V  7 @=$#@V  7 @,#`  7V @'#h `? "`Ḓ * "V@= # 0@d   7 #p  @< $ 7 4#  ( ,@< 0㿘  N   7 7#@< 7#@<u`sN o  a`?"``! <* H$!@# <EN * @:`!` ,?"``!* $!@ ,* : %  ! :?`&  @  !* $! @* : 4 NN 4N`!`?"``! >* $!@ɐ >㿘 !4`  $  7 "@yc0  7 "@rc@hZ 㿘@h @f! $ $ |@$ |c@ @ $ x86 㿘 8@[i @$` 㿘 8`@ؐ 㿐 !\`'  8 8 (@`0 %!\ 8`8@Ő @?@T $` 8`X@ۺ  $`| @Ý @  |,@A 2 @h $|`!\ 8`| @ h@  $ ?"`x@g ,'%?#<'$  x`@ٸ   x?c@٭ $' x  @٥ 㿘N #  8*`: bl @ `  2  _ - x@Zڒ   N  㾐# a' 8!@T  "aX@Ra  8@* 㿘! !X  8 8 @=`$!X㿘 !X`  8 8`@/  %  `@{`,`7  㾐 !'  ? 8!@  8 @ a  8@ Ё㿘@M $x@A@E@p !'@E OЀ E F AА@;$ 8 @ZBOЀ F? "!X@@J@ "*@ 8 @Z+@Ѱa  8@! 㿐 $`x @> OO㿘`* :`` ,, `  8!0@Y, 8@Y!X㿘@㿘 8ap@< @ 8 !  % ' 8- ) 8 p @> 2 8a@? @>!@eX@@]x?• mX* @@`2@@@,` -6 @@B @?` @`J /"*` 4`@@!4  4`@@  !( @@>?2@@YT! @ @fE8 8!+ 8- 8@j@6L `?,@@s  `L  `..`2 @Z L  /@Ya?<    /@v @Y8? /`, 㿘 s# 8 a@"@e 㿘@ Z [ Y` Z Z Uh ^ _` ^ \ `@ a` q q( q q q q q q q q q q q q q q q q q q( q q q q q q qx㿘! )@#X"#X@ @# ) )#|*` @ *  )$ct`*`@ ! )$#x㿐 + %`@(  ', 8b@ ɐ 0'`J@   "lJ@?   `   'J   (J@  J #"ϐ` ̐`@ ] &`* * $`J 8"8@ v @ J  @$` ' ) J@   "lJ@?   `   'J   (J@J ,2M$` 'J   "lJ@?   `   'J   (J@@  @$`  #'J   "lJ?   ` `'J`  J$`$`) J` 8bH@   @,`M""J@" L  L`"LJ@2 L 2   8Jb`@    8Jbx @ `  ` X*` € 'J   "lJ@?   `   'J   (J@` 2  * * @$`' `J   "lJ@?   `   'J   (J@$@J```  $` 8b@z " 'J   "lJ@?   `   'J   (J@J`;`~` 8L`b@K w` 'J   "lJ@?   `   'J   (J@J`\ 8L`b@   'J   "lJ@?   `   'J   (J@J` 8L`c@ @ $` ' ! 8% )J   "lJ@?   `   'J   (J@J`#h 8cP@Ȑ #h@u l`$` ?$`& @!?$` @`L 8cx@ ِ`'  8J   "lJ@?   `   'J   (J@@7 $`  'J   "lJ@?   `   'J   (J@J  8$`  8c@ 2$` '  8J   "lJ@?   `   'J   (J@@@$`  8c@) @aJ@ ;P``Y'`'J`  \ 8c@ @ѐ $`@@` ' 8c@ ?'@k`'@` 'J@   "lJ@?   `   'J   (J@J@ ;`,`` @|' 'J@   "lJ@?   `   'J   (J@J`;` '֐` 9`@ А`㿘'D @. `:  h'D \  9`@@  DD] D 9`h@ DJ Q . : ! 9J [ @JD @D @o ;D \2 JJ [2J.@# \2 JJ2J 'D \2 JJ n2 J .@D``'D \ J \2J.@'D`J".@D @`.@'D`DJ    *@J`^ *@`J] *@`J@ ]=*@ J[(\J . : = \ `*@J` ]*@ "J& `(8]*@ 2J 2Jn*@J` ]*@J]2 "` 㷈 ! '%  @ &@@x  &@@j " @@@ 9`@ @ )` *"a  9@ ȁ㿘   l ,@`$@ @X c&` )#``&`&`@? N =/ : 7 95 9/ 9*`:  \$ N@ː؀ "N,@N``   @X`&&` & \2 ,@ ` 2 @C ,@N` $@%h '- @ ' Ȑ@y( 2N 9a8@% 㷈 !'D' ?&@&` &`&` # 9D`DJ@   "lJ@?   `  D 'DJ   (J@DJ g  p 9 ; 1  D{ 9Dw 9 w$Dq 9  @Ӓah m&@ j&` @ɒahDD@H #?@  9a@ &@'D ! )J   "lJ@?   `  D 'DJ   (J@DJ*'DJ  2 * 9a@ @>#l`&`& @ϥ!? &`  @`L 8cx@k  DJa@e D N'D  9@Ӑ" !'N  \ 9b@G  2? 94bPc? 2N 9*bx  ? "l*`: ?   `  ? N  (*`?#@@ 9b@   @Ɛ  +@  (+@?O#`  +@J &@  9@`"Ё㷈! ! '@ A O耢   "lJ?   ` " JJ  ?J `\2 J " J "  *J  " $@(,`@Z@(  ,@^  9@"*㿐N 9 \ 06  $ / 9c 9 ` 2&@ 9b@e &@ &@ &@@. &`c@T  㿘$ N< 9;8  "l+ : ?   `  N& #;2+  N ". "l+ : ?   `  N 2+ .  9c0@ &`&@@ 㿘. ?* : `# *` € )c| "c| & @I &  9 cH@Ր @]l  2 㿘    `,` ` )*` @ @' 9 2  @n 2  @` 2 @` $$ $ $ $㿘 ` ,`  `,` ` ) ̓*` "   2  @9 2 $ 2  㿘 ) ̒ *` `' 9  x @X @\`2 `*` t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t tܝ㿘 +) )# )! ' )% 9/ 5 )7 9 #; : /8 * c@€ %#l !@$ch! @    $p  9"@ܒc@]Đ @T8Ѐ?ڐ?Xch* ` @ @`@ `@  @@`@ 0@| @1X@ @;Ḁ @ L`8@ @] 㿘% 耢 K! )  g )0#"# )b`2`  )"#`! )5"` :@i`H )  "b `L@b : `P@ b )  "d$`! ) :X"@    ) :"``@ b"  ) ) "cd""$"А@  )c`  "c`N #2Q N  nM  )"#pI  )b"@"b$c`   )"J`# J  n ) "cp *c` )"ԘJ  " @ )"$`s@#"*c` #c`**"c`` #"#c``*#"Ք㿐 )"`?) )' )@u`$ ";  ! )  :``h )"#d$ : `H@$#d  $#d `L! :@ P@Ԑ `? "`@ @  "@@&f #\  & a %#\^  Z%#\@5 `@  L " @ )cd :`P@ @n )` ` :` h"`# )+ )3 :1 :' @c` $c`! )$%cd $#d@O`H  $#d@L @o P`? "`@Ω @  "@@&  㿘@  " " ""@"㿘@   " "@" "㿘@Z   @x`L :`@4 㿘  @Z   @b`L :`@ 㿘# )c  :@Z :@S ͠ @J$cc㿘 'L :'P'T'X`L@"     ) )#` :#d`@Ր"@֡" :"@͒`؀ @[  | d  ~ ~ 4 l  T t $ p , t ~ ԝ㿀 )"#`' )3 )/ )cX@ "@ `?Ƒ* : `C!T*` €`% )! )#|H  + )*@ ct=*`#|%ct*`$#|H*`ct * $  " " ``O )#L`^ :K`   \"`   Xp  @   J$   ?% " @$ >cX )# #  @ 5@! )# #  :a( @ #  @ #@       ) @# @ :` @.ڐ! @@  @p   `  ` @Χ @    @Z " @   2@ )#p`  `  ` @΅ @Z  ` 2@`  @x @   2@   @a   ?%$     @\  2$ @ )#p`  )c  c  @H @@Zi % ) )|H  + )**@ ct"|U*`%ctH *`ct * $` $ @_` H$ `{$H@ )P@t"P )cP "p@`m"cP  `2h@`? ` & @Ʌ!? $` @`L :` a0K   `@4g   J @`L :` a0: A@% )   :a( @   `'`'` '`''  $  $  "` "`"`$ "` $ $ $  ` 2@` ? ` @- @ :#`@-ː!8@`lp   `  ` @͚ @    2R$ 㿀  )`#  )#T     )"` :a@ Ő   @  )۰ #4"   @  c- )P? - )  @e = xx@x   x#4 @`  `@͒x@`` `   @ #4@H x#4 @B x ` $@-#4@3 (#4xx`  $ @  @ ?2xx #4 $@ @  #4`@x#4  $ @ @ #4    ' " $   '' #4%#4 $  $ " $ " % "  ''`  @Ē  `"0   2, ` ?  & @0! ? "`  `L@9  : a0   `  @3      @&`L : a0  ?c ! )cH  '7' ?#/ )- :, t* @  #cH@  @jcH@`@`  @\Ḡ @! @cHґ,  `@   L " @ :ah ! )"cP%cH :@!x㿐 # :@ ! @$`h @a  < 2$ <$N p!  :!&N :@,$! N`' "l `@ J` ` `*: \!`?"`` !* $!@Y 8! :?a \"& !* $!@C \N@u !"@?M " `  !* $! @(  :@+Ő! N !`?"``! $* $!@  $!`?"`! * $!@ ! `@   L " @ :ah 㿘,` w@: & \ ?N? bl   ` "?N?Ѐ $) ),`:  \2  N \ &2      $ P &  & &,  3& #x* ?2 (?2 ?"!  $@    $ $ &  & &#x@ @ @& ,`    $  &  & &,㿘    $ && & "&  @ @& * 㿘?' :% ?N  w"!  { s" /"* + ?" @W    @.L 0 " ?"& @D "&  @L ג0& 2N 㿘  )`"#L  2 y  `"]  2  "( @  ` )   `@l  2 _   ) )#`` "  U #\`"Q  * $  &#L@  ` )   `@F  2 9   ) )#`` "  / #\`"+  @2   )#`` * &#L $    )   `@    ) )#`@ `?#\ 2  `?㿘   )#T`  :a4  "#T J?` "? )x    ;; #T )#`cx@  "  0  #T :a 㿘@_ 㿘 "&@T  &㿘@TX  2@ :a@H @& & "&@ 㿘 ??`@T    :a@G  "&$ `2$@ 㿘 ?`? "` &@ `"@@T@ \ p x h l 8 8  ( 8 @ P X h p x 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  0 0 0 ,㿀 /aXJ   ! /# :"   P ?! !@iRb? L!XJ`*  :l" :@"8 :@"@` :@"H@ `(@ 2[ / :S"P  2  :bx@m L /@Ɛ `(@ C  :<" 8 : /aJ   :0"@  :'" @k"@@h ᴤ@@c@ / `@^ @@Yᴐ@@@@S /"@FQs  /!$' 'k$' ' :@s"@m/ /' `ᴒ@jݘ@@kd@   :"@F;  @c`L :#@F1 @8` J@ @ J@ /  @kȐ 쀤   @k@ `@k (쀦` :  #@Fw 㿘 /J!m# /% :"   P ?a a@hN? La* ` :@E"-  /!J` @k} @u  &  : @j(   : `L@  :@E#0@F'# 㿀 J`e3     /L - L    L  n e  E`2L  k   f L -b L   \  :#86% /`63"(*` €` :#@) '`%  @F䨒   :@E5#H  ` L`  @FW䨒 6  :#P@E @g?ƒ?  `*    :@ڒbx   ?$ /*  '  ' '' {`h ?" @bn`Z \2Y*L f0  r a"O  b 0".  \ A \B*A \>* c \8*"7  t n \/* v \)*( ( $ "     А  *`: ?Д  А  *`. : @Р? \*L    * 2` *` /*!| ` "`@A7  /!< 쀣 "@|`쀦  `' @,x 6&`L@|L 2 @{` @| ` @| 㿘 J@  w`?   :#` :#h! /"  v ? V !    !@f?耢 p! *  `2 ?`2ͮ ̀   ` ! /!@y @yw  ` ! / @x@yi  " @59  :  ` :#p@DH ?`#*` €| :@D9#xx  :`# :#  (@D(  :#@D @f ]Z :@D#  :@D#  :@D # 2  ; :@D# ` :@C# ;@C :7@ ; 8  ( ;@C *  ;@C H   :  :#  ( ;@CҐ P : @Cΐ#p  ;@CȐ h  ; x@C’  @C 822`/ 㿘㿐 ;J`      r7 / s e  /! t  / ! ;   ; $  /!  `"  5`9' # *` €! %! % %! %@ ! " %  $ % ! ` +,- -!@e3?Ȓ?`'@bt " `'@bk " ! ``!* `J`-`+ `J  ` $! ?#@ ;@Bu s !* `, ,P @  - "*!* `C `"!* `64`"%@@@wi@3< ` ! "*" /h  ;  ;   @@~S  `@ "=`@ Ѐ` `8  @x>@ "`- /+ ;1 ;) :-- (`ؔ    @~ @@Bz#@ `Lװ 0 ;@A֐ ԰  ϰ @x@ Ģ`"  `` @ "`    "@0"+- :5 ;  " U`R` ;@B+!" ;@B%!   ;@B!($ ;@B!0  ;@B!8@  @B @ @ ; @B!H@@ ;@A!P@ ;@A!X@ ;@A!`@ ;@A!h :#@A ? 07 " ; ;!x! ;@AӐ!p  ; !@Aɒ -p@AĒ -  " @S ;@A! "@Ap @d @A 8 "@  2i@ BL5 㿈 /`  / "` ' ''   # ;  - +`9 *` € /!  '   /!̐ ' @cVa2  * ` " /J`-`+2  /J   /   /!̐`?` ;  ;@A<! @c  ;@ސ!ڰ 8@vϐ`/`; ;9 / =5 @ 2"쀢 ' /b@k `@k+ `2 @ka =0$ * $ @c` @@8`ڤ "5 /) /9 ;7 / =@ɐ $@@]Δ`@ux`<`2:`27@uܒ ) ; $쀢 ' /"@kl @kh+ `2`@k =0$` =*@`$`@c  @@ 8P  ;"@@ H'@u֒`  `$ `" `2(`$ 2"`` $ D!L`  / t @2  `" @]N!L$ `$ ?$+ $8 @@`$`  2l㿐 / Ȩ  ! /% ;" / t ? a! !  ! /!F !@b$(?〢 d!* ` % /@t@u( 2  `" $ ӒL ?$  2@u   / $aL ?$@u} 2㿐    ;@?R"00  `? @5}   㿘   % /' ;"  p ? l  z   ?% @a@?• n* `2 @FQ 2 @FI 2   㿘 ;@ȒbH / aXJ` `? # / ;@>"P(  (@aka ?a * `  ;@Dؒ ` "h@DΒ  XJ `" 㿐  X`+    ;  p#\#`@jh0   ; #` #\@j[㿈  1 L -.# /  /"* 2 *: ? bl   `  @uK  2  ;"$  ;@>b ) ' # /% ;"  s ?a" a@u(  2 a  ;"@>Mް a@`Δ?ဢ la   /,`    / ;b@i 4 @>. (    *  \ ' :% ;@]  '?  *`" @>  @>    /J!n`   \`( ' % ;,`@>``0 @>| 8u  ' `'@     X  ' ? @@4'@@4 ?  /  |  @aj >   6+ ;' ;L % @CN 2& %`@]L쀢 @=c  ?  @BՒ   `@E< 6 ` `L@Ȱ @=uP`,` 2L㿘  /J!n`  ! /@_!!$!" 㿐! / (@_ܒ! ?! * `  ;I#X  ;B#xL  @2J` / ;#@=1 !`L`2 ;c@=Z u  2``?@&  ' /*`2@    *`@@ @ ;#@< 0M$ @_  `? `   +// /` ?///`?" ! ;@}# {b&# " @u  `@ 0@~g @|@~b  /JaX`?    @Z ` 㿘   ! /# ;"  m ? ! + !@_c?쀢 l!* `2  @۔ @ = "*@`@Ζ 2   2 < L L L L L L L L L L L L L L ( L L L L L L L 4 L L L L  L  HHf`?㿐 /!# /` (@^Ēa ?") a*  @2g   6  <@<&!h   +   "   @ " $ $  <@<!x x ! '! /# < S" !@^a? ?!*  2;@ * 2 @, < <!a8  =  , *.  .   < " . .  <.?!@<]  <!@: @TB 1@13@,2 @'  $ 00@*  ,@*}    r$`-#0*` €0, d`?0, ^@ 0,@Y W 0 ,̀@0,@M K 0,@F D @7 > @18 X@44 @%8 , @ X@  @  @ 8 8@<  `?  =  㿘@8@ݏ  /!0``@  <   I ?㿘@  2  €  2  =    `?㿘@ 2   €     㿘@ "   €     @ 㿘   €  `?@㿘 2m  €   2_  €  2X  =P  €    2   =</   2   =+ €    2   =(  2     @ =@? 㿘   ``? `#  =  #\*` @}`?   $  `  ="㿘#㿘 .`   ` & =@2v#0 =#@2q 㿀 )J##`    / / H-c S* = a*`  * * f"  a ?' H" " @Tc?퀢 S =##` "L2   >aP@2T  *  @ 4 >   >!`@2  0 > @ْax 2!#?@(4  䀢  /"*` 2  >@1! @z : 5c vc#- >+ >' > 2 @ 耍  2@2_2 2@2Wa : @Ԑ @2LḤ 2G  *@  2?耍 2? @P   L  >!@ܰ  >@1!0! 2 #2 2 >@2 !  : @  >@2! 㿘? .### """ " "#ؒcp@iܔ !  `Xc "c ) @ "c@s ) *c )  㴝㿐 )㴀 4 /! /aT." `x@4`h %    "`L >!   @t "@s   >!   @t @s㿘 )#`@r  /aXJ` J` @ J` @yŒ?@Y 㿐 !`  @N @h\ @J   @U)   L` /?㿘 /@YZ 4㿘 / 4`2@[ 0"* "㿘N  / 4   ?*:  @[ N$  *@`$  N H  ) a' w" 0``# .'`(c`! )'` '`'`'`'` '`$'' c' ' ' ' ''`` Ӗ w$c #'՚ & & & Ԕ & x& '///@n/L#c 2 ?$cL#  L#?& L# L#?& L#  L#?& L#  L#?& L#  ?& @ۭ  " @   `x  0@n`  >@х!J   J 2JJ- + 8`(8  J            `?J `2"@ 㿘@ג / 2  E >"b ,`,  @;  @M 0``,`2JD #    " J# * `J `? 񀠠"'   J "  &J ?  #J 2 * *  #*  "㿈g @ a  @@-  @ ,`@  @$$`@M,`` % /@  J?`/2 `B*`'' @' $< , B, @''',`@@"`@' $< , ', @'''" ') ' @$F /!*`( @21 / N@   5 /N@ \@ 2.@  .@   N@  \.@  !|@B1`"" &!|@;w !&!| >b@.Ґ U  漒` ''' /a$ @ $< , 滔, @'''"@`'"@ 櫔    . `2  @3 @ J`2@( 梒` "&&㿘 @@`@  `"@㿈`ذ @# /@P az`a E` ''' /@0 /Ȓ@+ /@&a    @ L   / t@C >@n)"0@o#  (@5">   &a4` Aa. * `    $@@ $`2 @n "$`$`` ?d@   a,  &@  a`*\@O?  @]  .&@a֒` ,`@.. &@ @' a$< , 塔, @'''"@`'a"@ 呔&㿘 /&' " \ / *`*:  ' " ` = :24J /"! : \2  &  *` *:  ' " `倢 = 4$ N ? bl   ` 2  N  >@]"8 ` `N / N /2`?'&㿐\`o '    #!4@  `$  $@$'@㿘` A  /!`@J .N '% >L \2LL  "L `*`[`?`$"LL  (2L@@  L /"  L  \L  N ~ *`.@*`㿘 $ @D@ @*` @`@K@J    K@ K @" @*`㿘 # /, @ " at` , al`㿘`@" (NN / ?N /"?N /2?N /2& *&㿐@a @K @` a`$< ,  , @&`&`&@a@I6`@"@`&@@aސ # /㿀@Щ  /a  ''̐' '耦r@ : @@Џ@ `-" @I @ 2 @,  @`,@   /,  " @H@f $@< ": 6%,",'@ @ʔ䀢 6@䀢 a@,  $@: @@㐒`?`,&M@`㿘 > @k"H@lT  ) > ' > ƀh ƀ &@? @`N@"P N@{ ƀ 〦`?`ƀ㿐 ) ) ) ) ) )""c"#c##"#.1 /!  L% / *   *! * * * * "` # )Ē(# #` $c$ c Ĕ"  )"@ * ) ) )"##c## @@/ ! * ` /!| /!aP#" :  *@#?$  / >!Xbp 1 *@  6MI  ؖ %  ؀ * *`@  @  `* @*`@`   >` 6 ) )"#"c* *  ؤ"p* @& ؀ "  0 0 `".`0"@ax Ɛ @F8 㿐 2/@ x 0/1 )#?? &#@C#&# 㿘 *܀  *@ _ 0`>  *  *` "J ""܁ 㿘# )c )#В@ ! )#԰ "@չ#Ԓ@յ#cؒ@$#$c@ 0 ?㿘 )#' )@֐  *?@ " 1 )c )# `?"@ϐ耤  #@LcԀ8? %# 㿘  㿘 )# )c̒! )@   # 4$## @B"#@ 㿘 ) )Ԓ@ )@Ӑ 0 4"@  㿘 _ *  % )Ԁ @ "" " ` )@ )cز?"Ԧ "cآ  ) )L@M@ ؒ"@@U%# )# )`" `4@   *@|  * "`@ j%#Ԡ ?@LԀ?㿘@  㿘@ 㿘@d  )c@㿘@[  㿘 ) )#Ԁ  @@ 0I )??B# "l   :  _ $ -J?   ` *"lcJ?   ` 2 *:  _ $  ??#@W 㿘 ) )#Ԁ  @ 0G )??B# "l   :  _ $ -J?   ` *"lcJ?   ` 2 *:  _ $  ??#㿘 )#܀  )c  ) )@U"#0cԀ  #Ԑ$#@J#Ԁ #0  #J@`@Z$##Ԁ#ԁ㿘@??@p ??㿘N  * @ : N`   l    㿘 )#@ 6N` )c   @: N  c耤*㿘 ? @@U!0 bl   `  ` @ ^  ? @@ @ 㿘 )# )c̖ )@   c 4"cc S"㿘 ) )cؖ  )@    4" =@㿘 )# )cئ @*# )c??$c% ) ؀ @   c@ c@ 0??$c  㿘 )@# )#??## ) )̐ c؀2J@ 0 # ??## 㿘@ @}   )#ؔ *@`"#؁ 㿘 /aP@6 㿘 /a@/ 㿘 )c ** @%"@ 㿘 )c ** @@ 㿘 )#` /@aP0  /!| )c /!*@ * @"@ 㿘 /!P  /!耦 ! )@, 0" *#"` )# )#@ "# )@"c# *@ )"#$c@ "c؀@m 0@㿘 / / *!| *a `" :"@ `x 㿘 )# )c̀  )#`w0 㾈 !'?/@ )1  "J??..?# %耦*.@ #` `.! )#@n  #̔&O`^ B?` @*@{ `` @@ː!@ɐ@q   *   `@?  @@Ґ! 㿘 * `? /aP  % )@# @a )̐@L@`^ D?0 aP?:@M  /!?$㿘J@ ^`@@x   ?@x ?"㿘% )# )*c' )ؐ $ c̨@$c ) ) * ""$##+@ *" @ 㿘 )cg 㿘 )c` 㿘@? 㿘 )?"#@ 0@ % ) )# )c̀   * ! /!Ē @;" ! $ )  "@ ) *"@") )c̀@2 c )##  c쀦 8/ ) )##@  ܐ"& / )@  c?@#@  c̀@  > *c̀@8 <@?" #@ ??# LԀ8? &c㿘1 ) )##Ԁ  )@p 03#؀  /J!_`" J#J#6J#3J# ? ?*?#*J#'J@#$J# ?*?#*#J@#   *? ؁  *  ؁  *  ؁ 㿘 ) )# )c )#̄ " #@  ) )#@ @ "##@ <̰ o E  㿘 )c% )@BOȠ1 *  *`* @ "  В * $@ @ & Ё㿘 * Ѐ * * "`"  *  *?`* @  #  )# *"`  0 @@!֐? 㿘 *  0  1 * *  **`@  `  *  @& @!?" @q  )cԠ"ޒ  Ԁ ?& & ԑ* ` Ԕ*` d  ) * ) ) ) ) " "c""##( 㿘@z  㿘P )# ) ) ) ) * ""###c *@n?  㿘 /!@A`N *:  ^2*@ N>  ?`  +*@`?` N *@  )  l     ^*@` `@ ?(*@`*@㿘   ` @@$p!  ` @@$g!ː @@$a! *`.  ` *` > "p *  @@$P"0  *`.  .`  @@$F"㿘 * `  @@#"Ȱ # @ >"p  *` *   `2 @$!b :   ,  @     2   5,  @     ` 2N@iq . % >"t  : . *  "@ 2 ; .  >bp*    @"(@# G  )@@cȨ , @ 1 *` . @  )]c@* @ "@@  * ` :`*"  *@* +  *@  :   ?"  *@ +  㿘! )# *?"`## *  "` ! * *    *  + `@* `    @   * ` *  ` @ G* `Ð,$  +   `*" +  @   @@Xb@  @@RbH  / *a] **    8("8 *( 㿘`     ` ܔ  ` ֔  ` Д  ` ʔ $ ) *  㿘 * `@c 0 )#Ԁ@"@"   $`  㿘 *  )#԰  " 0@C  㿘# )% )' )) )+ )c#@+cc! J d" %c$c$@$%#/1@$$$c%#%c@ސ?! @  㿘 @j  㿘 @d  㿘 @^  㿘 @X  㿘 @R  㿘 @L  㿘 @F  㿀 ) )#! )#Ԑ#̘#\#`" "  Ԛ袒 #@͐ 0* (@ "'% . @@~ZH    0 @ 0@d 㿀 ) )#' )#Ԑ̘#\#`" " 谒  @ 0H`  "0;"    ͐@ @H@# ` J /` * 0 ` ̤ O 㿘 )# )2`@ )# ):`#"   )##耢 "c"c ) *c1"3  㿘 `?"  *܀` `J@"J``"" 4 㿘  ! ) )"# )##쀢  "# #   # )? $# )#䀢` #`c?@㿘N )`#*` : N c耤*`㿘   % ) # )* ? ? bl   ` `,    $c$k$$c 㿐1 )#% )# )آ" А '"@ # ) ) $* #̐#ct##܀    b  㿘 /!@` )V 0#`:@?@(L@(N "? "? ""? '"? , :    " '2?, :    " ' 0K ) N )   " '!N    " '2  N  "  "  ""  '" ?`"NN     " '2 , < .. 㿘@ U㿘@  L㿘@ C㿘 )# )c؀! ) 0#??$#  # bl:  _ $#ؘ  #K?   ` *#؀0 LK bl `@ `  ` *: ` ! bl `@ `  ` *: `  !x*`@ R`+ #؀J    )K bl `@ `  ` U*:  _ $3# U*: bl `@ `  *:  x* : bl `@ `   *:  ሑ*  R +ؘ 2K#??e$#m  㿘 * `' ) )c )#ؤ   )#  Nذ  c$ %  I J J J J J J J J I J I I J J J J J J J J J J J J J, J J J J I J J J J J J J J J J J J J J J J J J J J J J J J J J J I J I J J J J J J J J J J J J J J J J J J J J J J J J J J J J J I J I JD ?x ? ? ? @p ? ? A CX D D D ?P E$ ED EL E E㿘' /# / a|@1Ò`$ $$a|@+ !" @bP@c `$a| /a@L㿈 C! /! ?``'''@ a E '''" '`"  @g  a$< , &, @'''"@`'a"@  㿈! /! ` '''@7":    (!`㿈! /! ܒ` '''@" :   0  (@ƒ!`(  ' @b`@Ð   /@b  / !XJ`2J 2J 2@! /!  ''Ց  '' (@  ' ''Ԧ?$@@:ΐ#X. €N  ΐ#(-  €ڨ Nװ N Ӱ   ڸ ظ   $,@` (,@N ``?$@@: ,@N `4 )@A2@y  ' #  $,@` (,@`,@N``?$@@:{ ,@N ` ),@`,@`" ?/  @@B  @]L n?$@@:N  ,@L `\  @# ؒ@K  @Z   @ @p,@Xڐ  @,@f"x2D    /! Ԭ`" " $4$@ 444 $` ` %"  = #    ?  ,@` ,@ `b"( @Y ,@T T    %"  = #  H ?"0TB,@` ),@,` T@]T T@' T@@ / `7@w@] @]9'؀`2@@ @ @_ @" @"@ N '   '~ | 'z ) 쀤@~| J  l'd   J  b'؀ W䀢 2  '܀`N'  H  W䀢 V FW䀢 D  A   ?% `'`  ?"` `  "`@F  뀥  ? @F) ?'? @C'W䀢` @  /"b 2耥  2,`  / "*`   / "*` q 2,@l ,@`u$@`@$@ @ @ @ B(`@:(@``  /`a$< , M, @&`&`&@@" &@`  /`a$< , 7, @&`&`&@@ @[@"@`&@(@  ' /  ''  ''쀥 w| / "*` s q  R,?߀`]Oΐ!*` €G [`@ ,@?`< ,@`@6`@3 {`@0 ,@`*`( % '  " ('@0  @ 2  ? ,@`@' 2,@,@``,@` 㿈N@ $`N@ #cNN` _ } `@ [ % *O  * @ *O  ] *@aӐ@Zn  @2 ' /$+ / 2 2aX @  /!`+ /@ZL@[F' / `( @@ + /aXJ `   2& @"@В &@7U @7f`$$@    N :  / N   N / * b@  @2?N  J  2&?&'N@ * @'  %%=# /!`` 2 `  ($@ @ + /  @`$`` ``?$@$`4`  @ [ t O  * @n O  ]j  %%=#! /! ѝ` '''@a @Y  + /  $< , ї, @'''@Z"@`'2" :    ($@O `@   ѓ`6" , l ,   '''" '$`@ `$`$@O  @`?4` = @"* @ B? ?@YB@Z;$`$@ + /". @2 "@@J`  (@ += -?aXJ aX aXJ ` @ (@". @2 @ + @"@㿐 /!! /`@,R !|"`@L"@ $!|Q V@ -``(``#`   "  @ @T  @@p"Ē   @? 0 2$6  @"@b@ @?  @k  " 2 @R @ 2@ @x@ 6 &  㿘@ݒ %2#0Q@0L@8J.@81 A. (;*7.@8 ..?:(*$@8  2 /?!&@5@ @7 2 / 㿘@`"@@. < @`  /`a$< , /, @&`&`&@@ @S@"@` &@`, @"@:` "@@9\㿀@`$< ! /!' '!' ''쀠`  @ `@&> &@N@2|  2   2Z @  "  @  L / '< %@(@ @8  ? @   2. @ (*L /%< @ (@2   @8  ? @ @<  2 /,@`,@ % /$< , }, @&&& $@@4"@`&@ /,@`N /?$@@4,@N /`@ /  ,@ @7* 2,@$ @" @4"@`@@&@;P @ @#@D D  9@ ` . L 1 .2LL +L .N .#@6  @ @"@@4E@@&@ @ 2J`@͐2,㿘@   :$@=@L`- &@)% @ (2  L  `@ 2  .@  "&@.@`&@: .@` L  &@ ݀.@@|u㿈  /!' 'l ' 'L@?"@$ `@3Ȑ ``*@L@` 2 *@L` /"耢 :*@ @   @'p N "&@?$@3 2,  ,N  &㿘N  + @@V%# @W2 NN  2 N @@V#(@W - N   @@V #0@W@   (" 㿘@J /!@K 2 @ې 2    /@3!aL$ `$ 㿘  @  +N {2( N   `N { }   ,?2 "N  逢` $ c$0f   / a$< , ͚, @& & &&"@`L& 0B> "& 4 N { },  ,? ,% 2# `& /!`I@@@@,f  2 dL dl d e g g h` h| h h k| k$ j\ j\ k$ m, lh g l l l f$ u u u u u u u u D T L ԝ㿘 @ X'D'H'D   H H DR` H?D@ {@0  /!`@L< DR`VD /D"bD / `  *`#`:`'H$ /Dݭ /J!z`1`, @@T#@@U! /I  @c8@@6 4@  / @ 4#H% #   ` 0`8@@ @  /@= 4` @H ;'HD` 2 ! /DR`"! /DR` ! /! @k`! @"` @Ԓ D `%D `# / %' @\ 6 '`U$`x` Q@M@( D@?* : `?ؐ `*` €DH@R'01DH`H  'HH 'H@! /!  2!  @R @͐ !` 2DR`!! /@ @ DH@` @ @H 'HD`'DDR@ ! /! ` @R! ` 2 HD@~`@H`ߠH "'0DR`DHȒ aD`'DDR@ HD a /a,@  /a 2 @   / @ @/@/j!4 `    @@D#P@:  @R ! /!  2@K !` 2@y耢  @. @3 /a4$  쀢`$   @  @a &a4@  $ `$ $  @g  /H a ?2'HD /H8@b0WDH %`D!F'D `D R@  `? DH H!'H04D!)`?D '`"ch'''''H0 'D` " /D !`  /!' 2@!`?  @/@. /a @   /'DR` 2* `D@R` '@TLDH˒ a'`0'D@R`@T9 DH a'@o '0 /! 2!`?  @.@.b /a @   /'0DH a'D!DR@@  `? 0D `D!s DE D Hg a0;D cD`'DD`bDR`]D '` J @1  '@ D 'DD 9DR`02DH a%D`D@!HDڡ 0D @W^@'@J@.DD`@ `L D@ @k) @#p@' /@. "`xH @-  H!  /J!^`@- @H 㿈 /'H!XJ` 'P ' J`    2  @( #x"@U= ?@S6 HL  /^""@ 'HH A @#@UH b   J`P 'P*H `, < /!@3  3 @ @3c p?+   /J!p`Ц = /!*`   @Ē 'HH `H ``H c(  `'H` " H Ha /@P`H H ` Hh    /JX 2  @ "NX# / + @) @  M"`( 2  @Q"#@@R `4@<c8  @ H``4  0  8  @<  ` @9i`4  @Tm  2  `  @Ta  ` ` /"'0aH  /J!p` @z /  @ c@N @'HH    0?뀢 0:H@05H`J /H `H `  AH@i` @ c@X ~ `@R H  @*͔  H@i`L  A `(@= @Ey@L @  H A `X @' 'H /'Hh"&" /! `" `  # /a?H`"`( /``  "`  `"( ", "0 "4 "8 "< Ҕ"@ /!XK " 'H H2 + " "'Ha"2@   H P  a /"`x / /H*zH" }H@ #@ &$?H` HH@H ?"@ @N H"?`ؐ *` € / x'0`@+@+@+ A`x@א 0TH` /H `  AH@h` A `@{? ~ `@u9  @ @oc3 !XL `  @ (#x"@S H @Q P @P  L    @H)   @H% H * `2`"  P""@?'P  /" x@+0 㿘 A@Or @Pl  AL  / t @ؖ   AL 2  A   "?& " @@ @hh`L A  @㿘@D= /@D!  A`@8 @㿘 /!`    @D  L @D& && 㿘 @Dה  2 " ?$$, ` $ @M `2 @DА`?@K`$ $V``$ 㿘 # / N = *! +@C@DYa  " "" 㿘@C /J!s /@w   q`  /!@D ` @2 /`_    A@N @O `(  & &  @ &   ` @2  ` 2 % `0 !  /!̒@C #`   @     / &aaL ?&  `  T P`N `    * /!̔@C &  *! &  &  / / t!   @  *! / @+>aL& &  &` A@M @N `(   @_  *a & "a& 㿐 /a@C  / J`/  / aL $ ?$@C 28@  '?@L `  L <   I  ?    "&㿈2&@vƒ / Ő 2X 0V}"@Q@8   /!' '\ ' '耦`:@v : @@$" @*@ /, "@@*@y N@ ɲ`Dz  J㿘' /@% /# /$$` @4  ! / /!@/`$! @@5v`$!$$ ?      - /XJ #`    ' ' ' ''''XJ`"!' @@Lې#@@Mb  A  @Hܖ A @ `Sؐ ؓ*` €L J" XJ `E&  @B`@ <  6`3.1"   @’ `*L@ -  L` 2 #     @ | 6 A @H  @|cp@ 5 ?" `XJ ` " @c@ " ?@m!! /2|?  A A!!  A!( @ef`L Aa@  b?! *`R   ?@  !` *2 "@g? <@    A @H$  @e/`L Aa0@ ǐ +?@G'?`@A` ` "@   @ @@ _  /4 @3f  㿈?''D 'H Aa`@  ?1 /!  @@  ' '쀢`  `@̒ '  /쀢  A A! ! @d`L`  Aax@ c쀢 R?@34!| '@'! @   H /@'"!|@3?@˞܀  /!1 /`@ِ D" "&!|@ ! Aa@ z  /a&!|f @6w @6tD@'s@3l?0@? @dx`L`  A@ a㿘 + @ ) A' A% A , `2 # A` @K?a@L9J`@8@K5!@L/@ c8 t  @K$a@LJ@ ۲ @RY 4 * ?  (㿘.`@ A `@6㿈   @@&     @큒   /' 4 ''@.a 㿘.` @8@6U㿘   @@&    / 4`@.9 㿈 !  ' `A`?J@ `J@ "`J@`? * J@   : + ``+J@   * `+Ԯ`    G#T.`  @v`? a  $ a  A@!㿘`   "`1   (耢 3 / 㿘ԗ㿘 A &b@ '    ( 8  ( 8 d H     x"'ؒ'@&@x'ܐ 'D'L'''@%' /a @ِ  􀢠 *@"@%  L  1 @ j (@%@ ` (2ܐ '@"`"@l @ܒ ("D  @ "@L 0@J L@KD@% 㿐`C .` €  ''&"  *( )"  * @Jz  B   @//@  A*`"(@ B` B `0 B `H B`x B`@  0 B`@  @%  㿘 `Y ߀ ```#@ @x`! 86& `"` `?.& 2- (& `@b ϐ`$ Bz  @R@  @E d `:@ @602  ) A,`@"(*`  @`@  @ݒ  ` ` ` s@耢 ``    $  B  ` ԓ*` € @  @1  @   @  "@  *@  :@  @    @    @    @     ~`?   x@   t @  p@  l@ 2  $ @} `  @ `U   "  $ ْ@c `  "   8  ?3$  @   $   ?$  % B^ @8   $   ?$ "  `$ @"@J8@I2&   ,`(* `@㿘 "l`L?   ` `2 &` ( / b* @ 4  [ L * `2 [2 ` @Nڐ 2 B `  ! /@&`@@ "`!$@$Ŕ@Gx!&``Y & 6 _' /  _  * "@2L #"L $@$@&` }"`" `"` `@I  a`% '&` A"( J  2  @Y  M ` 2&` )&`&`㿘@@K` ` & "@I^ @HĐ"& 㿘N 2@@2 .` A* ( F $ .` A* ( ; 㿘! /! `!""" " " * 㿘N`  @@" @b @I  @ "$ `  @@ @G&@ @ *@&@$            @ @ @ @ @  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ x @ @ @ @ @ @ @ @ @ 8 p P X ` h  (        ' /<7 B`C9"*` €  Ba @q͐ )@ /a @#l Ba(@ha `   B@1!0 `u B@(S* K   2  B`2 B" BX!P` J@ `@o =   /!@#`$@  , `  ` 2 `6 B 2 B  @ה @& `'@h7  B` !x ` 2 `2`2   B!8@Z   B! @ @  @   ` @ @ ݀`@ @̐  `?=` B! B!@ ,) /@)7 *5 /3 B+ B@ ":@0# @$ @0a@ng 2  @0a"`@ @@@-~   /a @ @ɐ `   `L@^   B`@̐!0@ @! B@@0o!"`@ @(@@,?  B `L@]  B@!0d @E|"`@FC # /a| B"@ $a|R`  @+ 2 ` B@"(D @;   *!@'`$ ' '' "  $" @!"@@.h &  $@,,@(n$@ @] ` B@F"H@,|㿘@ #+ /) *' B @m  !@, L " !@   @# @Ḁ ,? a|@%a|㿈` /!@!|`0V@@   /!' '!  ''$@"  @!y@@ݔ@Vq  〦$  B@ϐ"h @ "@$@!P@$u㿐@#d /  *!@ /` "* @ /*@  /!P `+ B@K/!耦 `! B@)%"   B"L ?    /1 /a!P " : ?@p ' B"@f !P* @㿘 /!P /a耢  2 耢   B@N" ?㿘 / /aP!耢 B@=" 㿘! / /!aP # *a@%   " /|aLa@!`?$!$ *0 *4 / /P`": @*` * * 0 4 * *"!4 0 㿘 /! /aP "`< ? @ aPaP. @@ #耦@!?- @@U  aP aP@@Uf aP&@ > aP@@ 耦@怦?㿘 ) /!쀦' /% /P"@< . "@@[P /ޔL,  %!$$P㿘 *!<`"! *!8 "1 *@ne 1 *!( # *@ *!8 /",aL&!( /!P /a@"$!8" @Sa@㿘! /!P   / " /aL"? /"a$!P㿘 / aL@ΐ@kϒ 2* *!(`@3 / /1 /a!P* a  aLa!P* ?:""!P*` ?*"&㿐 /J!a` * *  B"< "@@BN"@CH *s"!8 / @}aL$88" @G! g@ ! * @$!(!(  @   *` "!,@( G(@,B (#\   @ ?"a, ?   ?a,@@@88a,` @) /a쀢 a,a,@I a,@w8a,@@p8a,!@@a,@(@G (  @ $a, " * "        2   (  /!a''@C %@ /2 !# *a8 Bؒ$@-@ ! &# @  @  *@@ a(@ @@a8@,2   B@"@?  0  2? "  2?@" "@  㿘   H@` * €@ 6`4 @`* / @`* ) @`* # @` @ ` / /aP ?  @`& a `  㿘 /! /aP$ : &@@@ "@*  1 /!L@!L$㿈! *!(@: !(  @  * !,@ )D"@ !(#\   @H ?9a,  @00! *!@   h# !@"@ %a,>  > > //!(///@苔 @O !(@腒!(  @k %a,!(@ 0@㿘! *!(@ @!($!(㿘 `@g  @ 㿘  / /"`x"N'H'L'P'T'X  3 /@q H@, `4`4@+  @(`4@ 㿘'L'P'T'X@_! /L@+ 4 @* 4@( 4㿘  / /"`x"N'H'L'P'T'X 3 /@B  /!" Bb@+`4`4@+ҔH @*Ғ`4@({`4 /a  / /J!n` /"!@ 㿘'L'P'T'X@ ! / Bb@+r 4L@+ 4 4@* @(T 4 @ 㿘 ! / /!|  !  "  /@kt!  ! /J B- b 4@+Fb ! /!|    $  / Bc@+2 4!|"`㿘 *!H'H'L'P'T` 'X! / 4@+\H@( 4㿘 /!'H'L'P'T`'X Bc   / @+EH8@   <   ` `㿘 / @&  /4 @&  . @&  * "aH㿘@r    L`  B#8㿘  @<  `  L`  B ?ڐ#8@w"㿘 ` .#@' ``@f0 @^㿘@| 6 B#XÒ &  & 㿘@G@E 㿘N? bl   ` "+NN  2'NN ?А@ߔ `+ B(#x(  %` `  2 B B## p N  @G B#&?? /!4"!4   㿘! /!4`  @@!4?$!4㿘 /a4   a4` @?$ 㿘 /!4 `  @?$   /4 /< ` B"@?㿘  1 /!4 `!4 6!4!4 !4@?&!4  !4@?$   @?& 㿘 /!` B#@ ,*  B$ $$@)@  @%U $ /!$$&                                                H H H H H H H H H H      ㌝㿘 * P /"ahܔ "@ΐ  /", "ؒa@6 ) ' /XJ`  *`   @$ XJ  *"apJ X  X C` d .  * $ @5 ?. XJ` "J` @l @< 㿘 *!P ' /) /<% / 24  2.  2 !XJ` "%J` 2!T2   @ ђ  @}  2  @ ’ @n  2 `@9 @T@2!X!   `x@4  @ڐ !XJ` @*` 㿘 / aXJ` "J` @;   x `' * 0  @ $t@ޒ *  "ax @V*`L C`pÐ $tt   "@5T ! *@ @A x &/ !x@2  C  d`X ,   *  @5;?, t 7 / * aTx . @y  x @U`L C` $t`L! C@U | $t@!T  ax @U`L C`m $t " !T$axt  x C`_  x 5 0@;`01 *`"!t C  d`X ,   *  @4?, !X  X C` d , *`` 2` `@4̔ ?, !XJ `@;R㿐` XaH /a,@Y @R$@$`$``$` ! *!T   * /! CaL  *aL!T"#"aL@` `2$$ $ /! *d$ $ $$$ $"d$$($0 * *"!T"aL@g  CH` 0@8* ) /`@,@     L`# /!`  @l C@aP @  C!``?"$` @z /"a$` !XJ ``   `  $@~`  *at  ` `x@ `@`jb@ebP  @ @`!XJ `` 2J  C  d`X ,   *  @3?, !XJ ``@z& `! C!XJ ` C   @3ܐ    @3ה b C C!x@x " C  @ C@va * * /"t!X"a`* @:K* @3&a`T C _a@ @A `7 @ub  /!4 $0 " `" `" C@ !XJ `  / Ca@& 4(` % C`  4@&@`2`  @% 4@# 4 @]  @ 㿐 /a,@  *aT `@-" @ 㿐 /a, @ *aT``  ` C Ca  a  @   } C@  @ה 㿐 /a, @ϔ  &@ *!P /!  !@2 2' C @   /!   @ "? @ ` C *`  C"c? C@ɐ  @   &@㿐 /a,@w @   @m  C *`   C"504 `2 @˒ (  `L@Su  C"!  2  ``2  @b  @_    `L@SY  C" @/ 㿐 /a,@' @^   @  C *`  CƐ"`  ` @   Cې"(а "`( C`k"@`(  + C) C'   2$ $  bH  "P(T  2  M 8 /@"N 2$` @# `"` @J` 2>` *!t` `  `x @8E`4!t , `h x```@  `  0 x`@8-  @ `h x``` `L@R  C"Xh0]` *X  ?@ $`"X` =``@  7`  L&` *t $``   `x  0@7`!t ! # * x@dax  @RL C xbax  @V @Ru C"  0  *!t` C` 7$`@~  @: 㿘 *!P'  /! /aT / " XJ` "J` 2  2  2 " 2   C" C"  C C#"  C# C" CI"  㿐 /a, @􀦠    @ ` @֐  C *`  C"B  *!P``    ! *% / !`  @ @֔ ?   "$  * 2  *!P  3 C "@c 2  @  㿐 /a, @ *aP ' / /!XL` "    @ @4 ? 8 "$  2L` P  % C "@c`2 @ 4 @O 㿐 /a, @G *aX`"` "` @;  *a\㿘 *!X  !!2  C @3c   2 , Cc(' 0B *  *a` h * "!\ 7$aX) *+ C% C!P X "! " @6   aX a!` !`cH  &!`@h!`h@!P㿘   (& ` * 2l & , /a"l@S 㿘```$``$` /!XJ `"`` @! /a  "` ? @.$``$``"` @. 2[`` " /`  /` `z$` $`XJ` 21  *!t`. x` +`  ! *@ x $```($`! * x@j!x 6 `  @P`L C!xcp x `   x``4 x @5$` x&'`,`  0` 2` `$  @5``,  ?Q$``  0 `  x`@5 ` `2`,` ;$``,XJ ` ` 2`$     X * "`$@.  `$ /`  /``"h"`dXJ `! /` "X @% 4@i 4`  XJ ``@p * !P`L   /! *   2  2U"l 2 @ƐF@!P  (`" `  @`2`  2 (  '''$' $" @# $ " @# '''' ` $`   `    $`@  ?@   %`L㿘 2 ( Cc} 0`  `  4@`2` ,&  ``" &  &   &  ? # /a4 2 0 $  0`"  @2   ? $ a4  / @aX& L : 8aX 2L @r L  -aX   ' /!! *  `"R``2 2 !p@ !p@0 @t!p ` aX  Cc@aXJ `   *!X   C *`?& & `"`@c8 !' `' 2 C ,   C@!Gc    ?` '  C# C#' *!P2 +" - ( З*';      `0>" `09 Cc  *`  `"./   D Cc@[t @#` @@!  `  2 `2  `2     2  / *` @[R @`` (  D D `@ ՗; `` @ ϐ`` D `(@ ǐ`2O $` ' D 8`( D`0@   '   D X`(` D 8`( D`H@    ; 7  3 ) D'  X(/ D- + D``` 0 #\#\@ y2 `x   X(@ l     ڀ` 27  @ V`8 !  D@& 㿘  /"* &*@< *aP  , "  2 ,P |`   z 2 p`:  %`m k&@L`?F ԓ*` € *!P *!P V` R`0T@; *aP I  J 2 @` *!P 7  ( "  @FŒ  `"`2.&@-    2 (`@ *!P    (`@F 2`` 2 (`` &@ 㿘 *a| "a| /aL d  *P`" & ` 2@`"& 㿘 *a "a /aL @㿘 *!P!P`@2 @ D` 0* *" ( *`  * *တ @"`" !  /! @ !| *a`?"a`!|aT& #!|#aTX" X *PP2`"`P0P""PP"" """㿘 (   "@ &? 2  ` l `   p \ \  t   $ $      T ` 7 // *3 *- /?x'x'p'|'t @'h 'l= Hh '`'d%ᄀ&aH   , @% , 7  |J@  \ᄀ `"@ ~ | " #a &aa|J@  \ᄀ `"@ ` 퀦 a?&a@ -|`  ?"`  /Jan "''`  ` / "*` `?$@3`` #P-` € [> *`; *,d@7  @\ # ,,\L  `?$@`, , L \`|| @$|\" 8" " "P%| @ + ? ! '|J` `\ᄀ " @ ( ,Q,@ '"  \ "+ \098 \|J@  \ᄀ `"@ = ,,a`&a t@p %*  , t@Ґp %  \ | ` $9 ,/ ,J@  \ᄀ `"@l $͐  \ "` ? `` ?$@S`  , \,,J@  \ᄀ `"@; (: {|J@  \ᄀ `"@( (t  @bp %  % d $ % @ t2 @Mp %  % % | U / ,,@`|J@   \ᄀ `"@ : # ,,|J@   \ᄀ `"@ # %@ t @p %L @ t @p %=  b* @ 0  , X,`?$@`,|J@   \ᄀ `"@ * `2`, ," X `?$@i` , X,,, ,, , $,@'|t  @p %  ,%  /J!n`Φp @ @ 2% @ |``~ ' p?2@np ,a&a " \p?2@Zp   ?#<* € ("  ) " 'a.  \  (  $%  ? % %  %  % `&a%  " \% 2    %  '2 a% ?&a  2',$p ( )  % 2, ? % |J` `\ᄀ " @ )p?2@p,"@cd   $ @ , (,  % %%  } *p?2@pϐ  } |p?2@p Հ (0׀ ` \,2,|J@  \ᄀ `"@B $", \ " 0  ` ,  2,  \, ) (  ?Z% |J` `\ᄀ " @ )y @C 'A '  =%  \ '|J@  \ᄀ `"@  P, "t  @%p %  ,a`h&a8  % , _ " \ , %U % |J@  \ᄀ `"@ $  \ " `  , \, ,,+ ) | ,?p@ݐp ( , * , , t@p % |J@  \ᄀ `"@` ``?$@ S``  D@" " <d >` L@ } ` /b* @u ’` L`?$ >`?$|J` `\ᄀ " @ <- & >* &  >  $ 28$|J` `\ᄀ " @ - $@$ > <  $$   > $ | @$@$$ $d!l /"!2h,`2e,d|l )"ذ ) ; &| ( 206 /0 ||J` `\ᄀ " @ | ; | &!,!!!& &$!@? J!q`|J` `\ᄀ " @_ (~!@-0zdl$ / o"a@ /` `@@ /J@  ` @,@`@ `J@ ` @0$ 2,?L? J? H!@" /!@#'   !  } В`- ) / Ȓ@# #! |!8 " | @$ |""" "8%|`*?!㿘 / /!ؠ`آ   @ aؠ  $a؁㿀 Z  '` / *a "a /!!' 'F! ''+ /- *  $ ` a| L@!?$@ , a|J` `\ " @`ڀL  `` 6@E% *' D@<?$@ _, a|J` `\ " @M` ߀`?$@ @, , ߒ$ `&  *a?"a㿘 /!|'H'L'P'T'X`?  H `8`? (`8"||!  ("Ґ  /@j 4K㿘 <  (?$`$ $ $ $ $ $ $ 8 $ $!$ 0$ 4! 0$ , $ ($ ($ ,$ 0$ 4㿘 /a| @J  $@``t$@#*` € s (@h@`   $`$` $`^$@` `   8$`$@S$` 0 $`$`M$@`  `8 $|@ U" `  J`"`8@U J?? bl   ` "`8`8` $| 9$` `  `$| "  `` ,`,`| $` $`$`8$@$$||$@``@ /!` /``8$|@`2 `   ($`$`$@  ! /@ 4@_ 4@J  s$@㿘 /!XJ  ` ,  `?   @  (<$@ . (,&` &  / p  "`D@ `XJ`  J` J`  |$ & ,F+ / "  /a@ ? & ?#+ /% / ( @"@  `$  ` `"@"ؐ  ("  J "   ,$ (" $٠?@ː (Ҡ? `@ ` %a| / p` " D@1  , && @@$ ,    2)&@m %&# /!`2J /J"` * J  *`  2J    &   @ 㿐 / "! V D0Y D@+ @,'@*   B@ٖ J`$1 DJ`!  'J@ ! `J'@  `  @dJ`@! /!'`'@͐ ! @|ː   /  / "aV @ /"a@͞@*Ð @+! /$!ā㿘! / 4@@ 4㿐 ' /|J  \  *!`" @`k#.` €, :  # /^  / b* @ V  S  P N  / "*` G`, :  [A @U 2. D  L # /?&@  .L  aq`|J  \  *!`" @  / "*` ` `2, .: @\ 0 ?&@}.p 㿈   /!' ' (' / '') *|J@  @ \! `" @U?$@K,`: , [  ]":`  |, ْ$&`?㿘 *a ?"a /!| `( `!|@` "@`$ * * !| " " 8"$!|!|㿘 *!`  /!|@J  7"@ *a   /!| $aJ  '"#$a! /!|@J  "@ \!|J` "  !| $a㿘 /!`K!" !$ $ 㿘` /~&``k& !t8@K  *! "#!! *a" 9 *! #!  D@)-!    *! %%<#   "$ @ 2$  2$ ̀@   @$  2  * 8 *!` ! /!L` !L !L!L@"$` $`@֒  <  $` " 㿘# *@>a /aL@$a 4 /!X@Q : , @Q % N? \ @p ?@$  L  @Qݒ ? . @ "$㿘 % / # / LaL 8 /aLg $ $$ @e 2 $ <  2$ $ 㿘 D @)! @)Ɣ    D! ے  D蝐!@,ے  H | H | T   | ! ! !@ ! !@ ! ! !@ $ $ $ $ % $ $؝(@   P @ /! /"!!L  ????????'7 / @'M"a薶@'' /@) /@89 /L5 / /!̒!L@  / Ȓ!L@   /!!L@ @; D /!!L@ @' <#` 1 /`   2 ;#`     2  E $   @by   L @bn$  E@' p @) a!X *@m*a?@ E@SB`؀ a D@S<b` a E@S6`  !X *`  @  #8!X *`    #`  @*   `@ /"a'!T D    @*ݐ!8 D !@ E@'d @(^L /@PP  E @J  P@2 T@ @ J@ @ H J@   (@( @ E@'+ P@( E@'& @Iΐ @!T@@( D@'!` J``@( al`alʐ`    @ /Ā &!0 E! E!"@ E@&!   /!0  @'@P% #  / Ĕ @(M@!X!0   @c@ե   ,!X,  @* 6L @v   `. @ $@$`  EP!. @ P%aL %!XL  ! `. @  $`  @  0   $`  `L / @?"x E`%!0`&%a `,Ԑ  Ea8$`   @  $` @| @w   , ,#` `  $` `"$`@e <   !X!XJ `"L @  !XL  @ k, L . `?a@%""&@ L , L , J@ 2 !XL  Ea@ސ !XL  E !p @W L `2 !X E Ǟ!  @K !XJ `  E! @A 0 E@&!@&Lj J@    @0 @@ 2   E@% x@&@   E֚!!X *`!X *`!XJ`  v@I*`@  㿈'D'H'L'P'  @  0 'y?L   /!`''0''@  /a @w  4L @ ` @   /!" "?` 0*` € /A {P` / x`7 @) EaȔn L 3 / /!"`H" a `'Da" @` "@"@ P` @R a" " 㿘 /! `"`"@@ 㿈'D'HD /`  Ja ''` H@  /!|' '@ 쀢  / /"!a @w  :?`.*` P €쀢  2 / K 8 /J!``D `  D "`D D`(""  /@"!|@ /@"a| EaؔԐ  /!X % E /!`@ D 8`L  D`  D` ?"` 쀢  $kD D@] BV .  L  ?'`D"  3 /aȀ  I  D&a"`H '@.   L   D ` [ /"`x V  쀢  /aȀ 2"a@ /@Z / /"a|x㿘   /!XJ `   X  d`   XXJ `  ! /  X@ ! /!R` p*` € /a@v  !` 2`@!㿘# /a D`44  a`$ $ $ $ @$a㿘 /!` " `  `@"` @#R`  ` , R@`" 䫐  $` ` R ` /4 @ T @c` 'T@ ! / /J!a`H-`  / x  2  /  X, @ @ @1  /@X`x$Ò`㿘 /!䀤  "    ,`R@ `@~`$  $   2 " 㿘 /!䀤 @ @  㿘! /!@`@!`I"`@㿘  ! / !@2@  2 㿘@> / 2@L r   D@5b`@ 㿘 E b9 Ґ (` /"    0 "3"J  /( 2J  㿘 / – @  2@ ` /"  @  2@ ` E`2"Ò  E"(  E"8  E"@  E"H  E"P @ E"X!㿘 *!? E"p,@i @?,@ 㿘   @ @H 㿘` `@a`* 㿘 @    $  &@ $$ 㿘 E" . @ " @N$   #. ?㿘 .`@ /!XJ `  F!0 F!8 F(@ p "+ F F!@ EШ"'Ф  ؑ,` "`@$?$Р @'Т``#,` /  \ @ 0♐!` / E!Xb ! FN " `,``"`∐!h``#(N ⁐ 8h ! Eb /!X '` J@  @K@ " *  #` /!*`5!  F@G!p㿘 /!XJ  *`6 5 1    &aX* * * !* ` @! /@$!0@H!0@^@ @^@2  aX*      / /aTaX* #x *J!!`   + Fa '@G|@Q! * Fa )@Gs!@H!! Eb J`  ``  ,@`" *  #`,@*` * /J!X`-   @O / ",` J  -2,`  ,` !@  / E!XbS7 F`A2  `o`?`0* `0'? ? ΐ8  O.  , R @.#i E`s" " `  # $J`@2`R`@ $P F@I耊 !`ؑ*  `J`-`+`J  ``-  /!XJ `2* * "ؐ '؀`   耊 2  ؑ* `"'@ '@ M  @%{J` F!y,?aਐ &?ؑ, `2 *`\$ @q ؐ*@( ؑ*`" ؔ*`2'؁㿐 @IْN J`2   <#$&@  㿘  F!%P !' `, @ @ @@+ 2$  @ /!$`b@Kɐ `?@p  F@o!㿘   U + F M  * ? [D  ]`2@       !"   23   ]". -  `'20 #  a@I  `  | )`02 `  2 *  ``?㿘 0   @퀦   ?" ` [ * kπ # 4 Ȑ_`"̰ @̐ €Ű ?    @ "   ? 2 @ "  2  } 2|  @֐@Д "m   ?a 2` @ N  F 2E  @N@ E?B  @# @ 2     ި   @* `?     !`?2        " (2 `[: 8  - 2  ]      2  " 4 @4    ]2   㿘% # F   ) |?? |2  2 ` `@Gqa 2  * 㿘.` @㿘&@2 :  :  [* @@ƀ ?@$@$`$@ƀ $$@2 @$ $$$@$̢`ݦ2$&@:`: @?@$$@$㿘@IV "" * " " " 㿘`" @@* ?J@ ; @ @+ ` @ &`-*J` - `J`  ``  &`&@`:-" J`` +2&`J`  `&`?@-`  &@&```&``,  :` `?&``: `; `, `#"N@F 2J N :2` `&`O.`  F"` F" F" F 5a`:`;:`,@+`?`J N  `&`3&@`;2N.&` :2` `&`.`L :  F"` F" F" F b ܼ<``  ɐ (1 ? `#@* ?`@ &`%&`2$<`@+`?`K   /"*`  &`   /b* @`&`&@&`<`㿘L   /"*` !2 L L  *`a" L  F"@0/L '  F"I% F1 /`'`$  P   ?L@J   " *@`" L  ` Fߐ"P㿘 /! 'L`b `L @ " @@` ` @$@L@" $  @, /  `/ F- F+ @@ L X@`@`( @@&ڠ  /!=`㿘`' @~  `@L@ "` @~& "$@r@ $,㿘 @6@}.㿘 @O   # `L # @  $$`L 㿘 @   ?  @  ?  㿘   /!$`$@`   /@Y /a !`㿘  `   (N@ / .'m 2N` .``*`:  / 2   LJ@  :2`J@"@  `&  L /"" "N "@"@@|@J / /,  $'" v@|ߔJ / /,  @ΐ "@]@|Ɣ "&Ja/`? 2   . /J@/"`J@ .2K((G(/J`"`/"`.%J`/  "((((`ЖΒ` (J@H/2J@"J@(J@ @/"J@(`J@ @/2(0㿘      (@I  /a # /"aa /L~$aa@|>   ( /!`㿈@( /a ' 'M @ ''@  @2*@ /*@`*@`G"@㻐 !'&@ c^N /"N Y@Cf / $@@~  N .F 2 N .2 N .  @ (:N@ /@ 3  /&@.@` @" S@{@.@ @X# 6 .  L`" O / @ " 2N  F@{"h f h h h h f h h h h h g` g h h h h f h h g ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht ht h` f ht ht ht ht f ht ht ht ht ht f f ht ht h8 ht f ht ht f e ep ep e ep ep ep ep ep ep e8 e ep eX e, ep e ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep ep eh ep ep ep e`㿘"! /!0`!`0 "$`,$`$@$`(@V   4`  @@t*  , 0` 2@Z㿘`"`` @   "`  `0`0```  Fbxد    ! /!`&  d & ! /!0` 0& b!䀎`  & ,& & & & & & & & & (`&& $l㿘`"`` @e   "`  `0`0```  FbZ    F  b (6  FbK  & & & & & `& & & ` &&& $ 㿘  Fbؐ (1 /! 0`!䀤   &,B B `$ @?& &&&&(&&& &&&$㿘   @_@s2 &?"$  ,0 , 㿘  @C@s &? ?& & & & 㿘   ` &  @} & * & " ,㿘  @"$ ,0 , 㿘! 2 0? 6 Fb׊ h  $" L ?@  *@ &  ;    @xX  & & @ @ 㿘!   6 FcU h  $" Lr?@ `j * &a ` d@$@2Z?  ,*`3   &  " "@      @  + & & & & <& @5  "@ $%  @  6$L   (&& $@ &  @s @& @ 4 `  * && &     & &  &㿘!2I  6 Fc ΐ @h  $ " L@ ^ ?2,?  && !      &  L 2  "  4 6   L& $ h&& &  & 㿘    "`LW?h  $" LO?@  ?2D?@*2&  6   `" :  2  8   : 2  (   "@& &  & & * & @w  6   `L(&& $? 㿘 Fc8" ` FcP ` 4@wٔ @"&& &@`@ '?@ @$@( ?㿘 Fch `4 `0 ?(  @!,@@xK " $  4@w&@ @"&& Ң@,@㿘2  Fcբ   Ð? ?  $ @`$ 㿘@2@ FcՄ @('?"7?``@` 2.? ?"%?``@2@`@&`@` "` ?*  &` &@ &`*&@&`*`  &` 㿐@? Fc= ?">?@ "*`` / Fc. @( `$" L*?6`   L`@ "` (&`$&@` @  퀢 0 2 ` ?" ?``?&`*@`&`㿘 " ?@y@㿘 Fc `6 Fc ޔ `@@`4 @v$@@"&&`9^ ?23?@ #`@l&@ &@%  @ 6$L`  (&&$&? 4 ` @vW@"&&㿘'L'P'T'X@6Lh'P'T 'X`  G` lȒ4 P@hȖ'H'L'P'T'X  B H@H ! '`  @, `:  %"N@ `2  & * &  `   U`* : `L##ԓ*` €CA?"<@;N@7 261N@ -+ ) / "*` &,@: , ?Ѐ`  ,@-,* :`@  ?Ѐ` "N@` & , 5 ۦ ۑ* : `S"*` € Ϧ쀌 * : `Y`"0*` €   ,` @- 0,@@ܒ 2 =  u< -7 +20 -`   04  ,@" 0"! G 0 G H`   4  ,@  x X,@ 0,@'@$@` G `@x ` // `@@d`%@ @"@@ L@`+ @`-` `0  )?"*3 0  ? 0Ȓ &   @*@`& `  @` x 0  ?*`:  `&   @*@`& ` @  0`', `2 < `& * & `,   `  ?L@w &   @*@`&  ``$@, `2 < ^& * & `4 @, Z(? !  G@sِ p㿘 /!|! *` `?@}$"$"$ *  "b $"$   *"b( *"(` ` b ` @ $b`@ 㿘@ * # *% *@   @ 2   @J  @C $ b$ ($b$ |ʐ |$(ސ $b$㿘ϐ "# *% *Ȑ  !@P   @ b$ ($b$ޥ $(!瀤! $b$㿘  ) *+ *"$`b(%"$ފ %b(  ` /@a| `瀦 0`* &! ; &   @ؖ 2 2  @Ȗ  @ $ %"$㿘 *"$`  $"$@ *! "b( # / *"(a# /& a$"$ ! `  @?`?@ b a /& J` /  &  /!@ ` G䥐 "@"& 㿘 *$  *"(@ "$0  *"b(@ 㿐@X  @ @T P! /! 0` ! @*` @'''! @"` @'''ز  *"$` *"(%b$ݾ , * "b(aaa sЀa!a `{ a`(!  ,! na  00"  aaa! %b$~̀a! %b$`! `!`0 @{%b$ /a| /!X$ T耠` "@ :` @`! $b$ ( %b$Z%(a"a`(c! G0i` Gې ,% צ%b$ؐ" :  " :  2  /@W "4" :   /N # / /a@  !$< , w, @'''a" ' !$< , `, @'''a" '!n`" : ؐ" :   ؐ" :  " )@o  %b$ %b$  (є )ؤ {̔ }Ӥ@Ð  /a|$%b$ !$< , , @'''! G`@ + "@`'!  !$< , , @''' /!"@`'@  !!""p `Ȓ'%b$'''''! G" @l @X! /a@ے   !䀤a  G G Ȓ  G  /` $@;@A@$0$@2a   @? @$ $@6 !"  /!$@! @$@@#  @$$!  @,! G  @   @s    @i    ! /a @~! G$,{ % ,!^` $ %!,7$ T  ;! !$< , %, @'''"@`'!"@ $ !$< ,  , @'''"@`'!"@  $`!`㿘 *b$  *"("b$}  *"b(! {! }@  ֐ ` 㿘 Z!@h ǐ  & @ @& 㿘 *b$   *"(&"$J , *"b(!!  &"$  @֐ @=  & &  㿘 *b$   *"($$!  * "b(! {!  }@     @`2$`& $ ($$ $( 㿈! /! @@` @'''@  *"$` *"($b$ڐ  * "b(( $b$% /!Ò  $< , (, @'''" 'b$`"($b$ڰ %"(|ݐ! $b$ $< , , @'''"@`'"@ &   ) b$` & $b$ځ %"(0"(!k 㿘@ @L # / /" G *a`؀=`J 2 @[  /!|`& 6 `&  {?  * "b$a ` ^2` /& @@ a& `  a"`   ` :"  @* `* `* `"aj`  "`  "@ "  a` ?2`㿈! /! @T` @''' *b$   *"($b$  * "b(;: 8$b$% / !$< , >, @'''"@`'b$ ($b$Ɛ $(߀ ;@W " :  ! 3`  , !  ,   '''"@`'!"@ 㿘@" " " 㿘 / /aL!@  G `  T` "`@@ѐ@k" `"T`" `@ 2T`㿐  * G" * *"("b$ * / G / G"a""" |"  Gϐ" G  a G @ @ "@R` 2`@   G//  G"ߢ *" /" |" " *   㿘 /! I`22 " " " " " " 㿘 / * /` /"!|""#  *"㿘 /J!n`* :   a)    Gc@7ɐ "  e r Gc@7  r t Gc@7  t2  G@7c(   2 8   "  "  㿘 *"$` $"$` @ A؇  *"b( *"(   /J @ ``H`D `A /a G9\`7(3) (` /!` `  G#p G#x /! @̒` /Ԓ  / !  /a Gch@7,`? .`,$"$2 ` /! GT.` @``@`*`` /a$< , q`, "``"`@"``@" "@㿘 *"$`  $"$ @ *"b( *"(!"$"$$  @`* ` /a$< , = , "` " @"`  /a" "1  ( 㿘` &  *` *@ " !"( ?#b$ .`  /"DJ@  @`*J@(8 @ ( * "* * 㿘"" 2 `2 @㿘.` V  @*``@$.`6 @j 6 5&  @6/*``%`@ "`V  * ` 2V *  " ?6 Ð@ב*`㿘T  ?%  * @ @N N@@2   @6 2   2T *  2N  㿘T ? T?* @`@L`N@@2 `@5 .2T* `2L`T TX*`T@n # $@$`$`$`$`@k`4$"R`"`"      㿘 @5`㿘 /T`  `* T``  "@ 2`T` &"@< #H뮒, &㿘!  X _ (`  * * 2 *"J 2"@` b0#b0 X  Tb8 t#$!a 4"`#"`"` b8 @$ T$ t$!$ 4$" $@ @ @ ` @! @ܔ 㿘  X!#"!Ԑ!cd@ϔ )㿘%  D  L@_D  / $D"a$L@_:$L㿐  /b* @ڒ D A 4@ 1 *  X;  X % H  /`@ ,@m # @  2 @  @4ǒ @m  @  2  @4  ΰ  㿘  X. @ "  /`L "!`@ /"!b"  2 /"! /"a`"$`L@$`L㿘 /!`@4"@ X  "  @    X  " " H2 @  㿘 D   H b]"DY "D /"! @ /"!" /"!  X      "  2@ 㿘  & 2L " @ /" x$ ) /" x  " ! / & ~&  a! / x$ x  ! /laL &  & 㿘 /"! /"a / "!`X  $  "   J@ 㿘  X  2 ` 0 @i< 㿘 ! /,!L!LB & a` & N@ $!    "@& 2 $!  /J!a` π&   &  &  @( 㿘 ! `    @   `  @    @  㿘  ! @ 㿈< ";      *b,@r 耢 `` & &      /J!a` @ "&  $& !  '& ''@rŔ  㿘  2   Hc c  ` π` & ` `  0 `  &  &  P  8 H h h T <  4 x  h @ P h  $ , 4 4 x   0 H H $ $ ` | @ P P h    h 㿘 ?* : `l& *` €   # H@c8  2  H@@   K# H@c8  2@  HP  H `@`3   Hh  Hp@| *:   H H## H x @j  H@c  H@\  @ # H , @c@O  , `2  HȔ H @?V 2   H @5 ` % H) H HȐ@*   # H@ c8  2 HА@ @# H @  `'- H`+ I) I@` "`   )  |@  2 `@``` I` I  @ג`! I  HВ@ϐ I 8@ɒ`     HВ@ I (@` ` HR@ ߀` В@ I @@`' P*:  ` I ` I h  IX@ Ip@ I x`@ H  I `@ I@|'  I  I V   I  I   @e  I @]  I@V `6@   @@0`@ 2@ @  ' I@   `    6  @(Ȥ @ 2@ڐ 㿘 `       4`  @ @ `  @ `0ﵒ?`.& x*` € IЀ` " I I I而`@" I I   I` I@В  I@ɒ 2   H@80 ! I! H#8@㿘 `    ^ $^  @Z0 2   ^ $PM ?0J㿘 %&N  , @€NҰ NN`   " ` $ \(N  $ (N`&* : N  )  $ ( (N` * : N  ) )  + " ( " $N`{  {N  sN  NN }   }Nɰ  ( | )’~N㿘'P'T'X@P h'P'T'X   B븖 @P`N% Nŀ`:~& *` €zL s *`y:  L  iN(bdd 2 `2 ɒ `? -,L K *`Q:  L  AN9! ;  ;: 7+ 2`  +?  $N !?  N@   Nr㿘 i {2 4 4V  @^$m$ ` $  $ ? {$  " $@@@$@  `$@  $   $ ? z$  " $@@$@  `$@ " @Ȓ$ $  $ $ $㿘@  "zÐ@d㿘 #&N + * a@€N  N N  N`  ?N  N?@? ` 2Nՠ? IN?a ™ NhȠ   \ B#&N  * a@€궐[N8 N3 $ (*  : *N`? )! $ ( (*  : N` )' )  $N`{  {N  N  NN }   }N  ( | )N㿘  & ?z   `- z $@$`$ `$ ` $ `$ ` "` %$ ` "`$ ` "*$  ب - &㿘 7  " y  " y   y  " y   yݒ " @  ϒ ̒yΒ㿘  " yÒ " y  "yy  㿘@c㿘@P 㿘  x  @\?$x# 0 I!H$` @>w   `L@$` IaX @bf    @b_    Ia 0. @z=  $x @_`L Ia &   @P`L Ia @\lx?$xx 0`@\_㿘!  x @\U?$ x H ͜ ͜ ͜ , ͜ ͜ ͜ ͜ ͜ ͜ ͜ d  4 π ϐ Ϡ L 0 \ X $ l P X ` @ L X X ` ` ` ` ` ` X  X㿘! /! Px`x$` !`  I!$`$` $```$`` $`D$`H` `$`L"`㿘 /!```L"`T`?,` `@!"?@`@ @ ?@M ?<`  /`("!`,!" `0" `4" `8" `<" `@" xFx`㿘 * /aL"e  I!`  @Aېb"`@`" 㿐&@@ @0L@ [,@s ' &@3 /am` ax<`a$@` #(& I#@ax&`㿐! /!`L@ / `"*` h! "! I#` * "pp $ $ ,  $p @ + `+ ` @+` + * :`  ?Ѐ@4 +`@, $[$"pL``U߀` "p,!*` € /!TE$ Q @$  / x:$ 7$  =y$1$ - =@*   0L 2 `@v`@$ !$㿐! /! M  /"*`  ! *$p"p $ ;$ Ք`#    L   " L" @ $""$ $  @`@$ !$㿘! @֐  T ( M  I#x I# *bm  & `" ?.@l ?.@ `  #?. @V ?` . @U ?.@ 0 0? -.0@@'㿐@?2 I3#ȁ㿘$`" Icؔ ? K   ("5 " @ @c7 @@  Ic  k v &  ?` &@@ܐ @ ۊ& ` &V 2   !&@S 㿘"2&  /! *"p"p"`"`  #"`  !&@2㿘! @ ` `"d?" &@^ @2L@  (L@   N`  /"lb - #A : 7 $4?? 4 * @`,?  ` `??  ` `? ?  ` ?ɠ?  6? @ ?L@ `2 &@㿐2 b  & u  `& & "!&@㿐@b@0@ "$ /! `u]0@[ @3@ @(#@K? bl   ` 2#@@ #@ @ @@  /@b* @ J  J (#\"  (輐,  JN@? @ bl   ` 2`@ 02`N@ 0"``0藘 `@^Ґ@$N D  J l `@ `  ` + :  ax*  R *J 2J0%@#N   J l `@ `  ` + :  a*  R *J 2J㿘    @av@as  &t@& @^l =,  $& @^a  t㿘@P " L [ =@Ȑ  @  6  /" * @` &  L =  /!$٫@   /J!p` Ic @'  J`8@'  J`@@' h J Hڒh6` `ې3 .@ @($  I2#؀# /!t2`@y  p/   b@ b"2   bb "       ?$"2` ?$$ `* $ p$ p@2$ " '  `"  ? " s $  ?$`"  s  2 3 (""   4&   b    `    (㿘 " s @` `"&  ` sw st `& `! @ a&!@㿘  /b* `  N* `2 ` [@h 2J1 / (*  J ` (2 `J [ H(8[`]2H2H㿘ɒ J`?㿘 @  J@ J` =`?㿈! /!!r`!'''! PT? H? ?  ; L    " L@ ?"@ L "   y& $< , r, @''' " ' 6L2T $< , re, @'''"@`'"@ rU㿘@7M㿘@ *﬐"  @ 2`㿘/ *" 㿘ߐ ?`9,!|*` € ~`,&@  *b" ܐ$ >@7 &?*  / >& / >&  /` * >& !&8 ?`,!*` €# /`t ! /q!Lѐ!L$`t 0ɐ֗ L " H ~ &| e  ̔ 0# /a  /qӒaL$aL /z@cA  u@ p<  j /ђaLe$a ~&3X I"`Qz,ِ! G$ L D$ LmwiО ~&i  ~&@6b!(& ~@&$ *""" `&  /" p ~& /` *" ?"⠒a&㿘 ?`/,!*` €! / t 1 /q>!L /a S!L$ t6 0 J Xݒ   "`H1 /!  /q'aL &!  01 0Đ 㿘@]` @ @`$@0$`  "` & " ` 2` `p `@ @ ~$`$ `$ `$ $ $$ J@ `]"?["J  ][["  㿘 [@!ڐ  /!"@ޔ㿘$` I#!        p ۜ t T T T T  @ T T , d T T d T T T T T T T T T T  T T l d d h L ( t   d ` d \ d d 4 0 H | @ | d d t d H d 㿘d$@ΐ@ Y% -p   $p `$p@*?5 -#l( .#` `2`@3`    a Ӑ    +#` p@i ?@( p   ?! +#` @ 8`?@#@bk#  .# "  㿘 -#l` 4#*` €! -#X+  $cl ^@ "cl ?clဢ 9cl݀ @>$cl  #X +# @ "cl@ @ cl   * *?π #""ܐ?В "$cl *"*  #"@0 $cl@ +# /"` "` J! J! @  ?@ א cl  @! J +#"` "`@[4 d d@  0 J    +#`@  @ޞ +c*@ "@  n$cl? bl   ` `  *ܑ*` * ?Y" * *"* `Q" *?π "?В "$cl *" ** J` l#" J   6 4$cl? bl   ` `  **` * ?"! *"܀ *"$""@[ $" *" ** J` 8#" J    @$cl$cl  *$cl *"* ` "$cl   .@I ,#  * -J#0`  @@/$clb -*@ #0@ ( $clcc 2 , *b @  @" +c "@"" @  0@$cl@  cl2  +# ,"c "" E , ,#' +  *?"J ?   bl   ` 2   *"lb ?K `  ` " ?  *"@ @? "@" $  @ " ' *@ 0""* ' + /J!w`  `@ @ M  - * `"  *@ "    `@ @ ^  @* `"  *@ "   @ @t  * `"   @ D"c cl   *  W 0X  0Ub$cl *@b "  - ?5 0G? ? 0B#X` ,"# @ @ 9  *"$cl # -$c,c,! -@l#( " -߀   0%#X`L#(`s`c`C @   @@c, @@    @   @$cl 㿘 -"#l6?# ,c   - - - - - , ,##`"ch#cd#\" X @ $c@% J    .       㿘 .# # 2< -#X`  + +#c` ,@  0# ?##"` &` ?"  * #`` , ?"` `?#   #`@_#`  2! +# , "c" @_q #` `" "` "`$ , +#`@  #   "  @_V# , "@" " "# "#~" c   ,"# C4#.  €o  `"  , " ,# " - a - *(", -J#( s c C - c,?@I@  E  +c@  ?  /J!x`! + @  5 ! +#  ?@ ,+? +#* # -cX`"  ` "  @^ݐ#`  "` #*@cX  "#` ` "`  "  㿘  % J@  @@" @  @ @/ } +# 2"  2@ -#p`2@! +## +c"@` @^# -  -c#(# # #c,@^ @?* : `y5 0*` €@ 5  -`!  ,  / UN` 3ް?  -#p JN`@" @ J @W pp ``""@  ) /j!L @T`p,@p`  @@Tuj˒!L,@ ,@ p$p" "  + -# -cd   -"#\`"h  #  -v"#X -#d  - -"#\"ch @  +# -` "`d"X Ja @r  +c @" - J!N@N``c  Ja @[  +#K`  ` `@L  &G?N@ c.' +N` w W) +#``J ? bl   `  +# `lK ?   ` 2    N` %  N@ c@@EN@ y@b" N@ c - - + -c -#d -  "h"c\   % ,# -c  @  ? c ` "? #` -#d -  -"h"c\ % ,# -c  @  ? 4   +#` ?"`  -? + -# cd -  - "\"h! +# @# @#` ?"`  -#d`  / !| -`d""! -?#h@;  -"#\e$#h -#d  - - -"#\"cX[##h -#d  - -"#\"h Ja @b  +c -"I"X! -#\# -ch@@ #\$ch<$#\! -#\# -ch@"@ #\$ch"/$#\ +# ` -#d -  -"h"c\N` `@  -  *  -#d -  - - ##h"\ "X +# `j -  -#d  -"#\@ "h#@  @n -"#X +# R  -#h` /* a|   # \ a| - -d\ " ?"  J!  J!(  J 0b @U $ ! +#  -  -#d - @"h"c\  @#`@ -! +#   -#d -  -"h"c\  @##`@"#`""` + +#"#"# -ch ! -@I#` #` -"#\r$ch - -#d\@  ,?"\ ,"#N@ "     ?N@`?`N% -`?' -h -\@W0   - Z?@@ 0T"#`$h@$\ ? &L? dJ   "l*`: ?   ` 2J  J  J ; ?8 "l J  ?   `   bl* : ?   ` 2J  J * J  ?2J> ' + - - -*  L ' + - - -  "lJ?   ` 2  J  "  J 逢?  h cd \ " "l J  ?   `  0 @ǔ 2 ?@  ?   -` ِ?#` p"cX +# `Φ g% # -  - -) ' c  J@ @ l@ `  ` d$ch#\H !x* Hl `@ `  ` d$ch#\H ሑ*  R (c` `??"`c# -! +# i *#("  +c@U  - /J!x /J!y`"?@  -@   -#X`  +#` @" 㿘@?* :  `t 5"*` € +#`?@  +#`?@   +c   ?@Q   +c   ?@+  +#` &հ 0N@ " N` -"#$  ǀ f F` ` a  N@ , -`?c$ @   2 0' + `?`   ' +  `@ 6? `  4 0  +c   |?@ x  +c   n?@A j +#  ? b "l J?   ` S  OJ +# ` 4 2C?0A +#` < : +#` ` `@_J@  $  `  ` ??  @GJ@`"`耤``4 0?㿘 ?! -% +# ,#X` c@`? ? ? +#` ?"`$#X 㿘&@ -` "#  +# ,# @@Y2 ["  { ( ) 0"  } ]  0   0 ???㿘# +c! - #@Y c#`  .,"㿘 + .c# -c "@X" 㿘% /Lec  e_L$` @O2  $` $`  $`$@㿘`` @O# ` & `& @@&㿘 ! /em!Lej!L㿐 +! /!Ē +" "`` +##"""`#` "`" "` }!  -L"@ ?! - -  "###@  $#|#@ #@ -$#|"c$ -"# -#``L?@! -`L! -% /# Le&#$##`Le#$`# #@XV## @XR  -`L -"@ -  -  . +c" ##㿘@ 㿘`2  +#@@6(? @4" #  &?@"  @X/` "`  @X# `"`㿘! +# " @X#&@ " "  + #" ?  2 ?,? H 򀢠" ??㿘5 + w??t  /`l .`"#`("Ebl` 6Abl ("9#` & 3#.`8  &#`( bl#"N 2#` 6 #` (@"N#bl`  N 2` ??2 㿘3 +c [??X l /? J`H 2? :`"@(?,. `(2?% ,# @(2 `blN 2  ?,  `(@"N  ??2?㿘 + @gd / ? `@ c +  ?"lN c`@&Nc @7@ (@" `@6) (2` ` ""l8 2`@6 . @. @ 2`㿘3 +c 6??3 `l` bl I #bl` N 2` ??2I + 2/ l ? c H  2?c"l & H  "?  2ڐ?㿘 + @I??E `@6  + `?lN " `@&N @@`@6 +` lN 2`@&N@??2IJ`㿘` -#d@40?@  -("#``  JaX. ?% +@N$  "   @U -"`"#`㿘`"E? -cd?@"=?"`N ^  Ô  `   -#@ !?` 0?I3 +c@Nc$  " c @UDc"`㿘 -# -c*@  -@U xǐ xŐ @"  -# - - "c|*㿘  -#"#@ # -@2c $ -㐑* +  @rc$$c㿘 +      #  @O # `  -#   㿘 +#`      / -㌔$@2  : c @" c ` ㌔$@2  : $## @ ㌤2`@:`$@ #"㿘 `@k@ 㿘 +# -c    / -) -c7 - `c /!X M - ^  〤@` `   -,c`@, `2,(`cN`  c,c`@ , ` `c@ `  2 ,,㌢`@ `@, `   c@〤@c@ c c  〤@㌀@6   ,㌢`@   ,㌲ LN@@ #|@3wL#| %#| ``c`  +` <  >N㠠 ㌒【 @ wr#|.㠐 %#|#|@㿘 -#| + "@wY @  -#.$c|N@wM`#| @$#|#$c|$c|w? c|?@&c|$c| -#" @  $c|N@w+`#| @$#|$c|㿀  ) *!   ""䀢  +c %"\$ "䀢 " +%" +##\#``` ` z줒 @b?0Aj   %""9"`5 -/ -+ -- - 3 -@   0  2?@,`@@L@|]Ȁ `?"䀦  " ``"`cd %\%X&h&c, 㿀 ) *!   "耢  @  $  "!   ""耢  +c   %"$ `'%"耤`   +##`#\ ``` zc覒 `@ܰ?0G@@԰?wz 0s ',`@ z @+@9 -7 -/ -5 -- - . @z @ǐ   ,`@+@9 -7 -/ -5 -- -@Kې @z+@   "`?9 -7 -/ -5 -- -c%"^ac"{ 2`   " J?`/   0  zd &\&X'#h%,3 㿀  #\  #`y̚蠒  wE ze 0@<?    /Hw     ` 㿘 /J!w`   Ju!x   u ^ @u㿘 / ! -#  -#ɐ 㿘@u u㿘! -#p  #p` /^aL$#p$`$`㿘@㿐! J!@I Gbt@Qy   # @@{!?aX* & @ @@N@`*@`."(N@# * : bl `@ `  ,@p,N@* ?Р @ _`N@`@`.ߑ* N@ .E.@`N@}x@`"!# *: bl `@ `  2N@@?N@@uZ?Ц@ `N@ @N@ @! *`: `"l `@ `  2N@@N@ @''  @=   L  㿘 s# J a@*"@h 㿘@o 㿘@0 !'# 0! 0% J+ - 0/ J i  $ T$`L $`L$ T@@? faX* & @ @@F . @%P?@q  <   $`@y`@Y@@?@ P$# J@a@& @JM / /-`?< @ /@; 2L ?`? ` L /"?* L /2? @I #@@  @P@  2  Ȳ@Ő !x '@&ϐ  Jΐ! 0 L`y@N s 0 T` @N   0  J"a@)0` 0 P`)@Ny  $@В؀ 2  @>c@ @ O逢  J" J"  J"a@)#\` `/  a``? "`@$ː `  $` `  !` ? $ @$`  $`` 2 `y`Y2f @6H  ^  L` J" @2T <   8@N   J"0@E? @H28  @  J@5"H/ @&؀ <   @b^   J@ǐ  J"h@ !<  @@Ȓ!  J@Es"x㿈 @!     J!ؐ&@!! 6   J!@@?> @~ "  L ?Ò* @ ܐ 0`D ) 0@ @0$D  % H@  !@0+ 0@Ӕ J`H@ID  H J!@@O  J"@x@>@>Y @>!  ,  $ L J"@d 3 6 0 L`2 J"@W@   J"@ND@3$ L   L - JD  J"@= ''''@耢  J"@.@>  J! @  J "@ 㿐'D@Fr'H 2! JD JH Jc @d# J!@#@m# @ǔ ?  J J# @cG   J J#0@c> :   J J#P4c@F@ 2! JD J Jc @3# J!@Ӓ#@l @ ?  J J# @ǒc   J J#0@c  :   J  J#Pc@ 㿘! s# # Jc@'b# Jb@'c@ 㿘@ʔ 3@ 3 2 3l 3l 3l 3l 3l 3l 3l 3l 3X 3 2 2 2T 2( 3l 3l 3l 3l 3l 3l 3l 3l 2 2l 2<㿘@   2"  @N "㿘@   @J &  @<  &㿘 @ @2   ."@, J-`?` J  l*8  + J (J? `2 "@ 㿐  ’ 2  @Ȱ $$ 㿘 @   J @Ԓ   @) & &㿘 2  `?J@   Ɛ "   㿘 0`\   0 8"`` ."`\L`*L   = J#@ B " 0#" `L  `<"  0`>`!  00  00  "``  "``  "``+ 0 0 "`X"`㿘 Jc@#, 㿘! 0 `    0 X @ `  0` a ' 0`` M) K SQ`@`. "  @D! @"  @ZM  Ѐ  *@ "    K  Ð@k``   K@B 㿘 0 `//   Kސ   K`@" 2` @p`& `  K`0@" @ & @9 & }` Ҁ Ѐ 㿘 0 `    K   K`@"R  ` `" & N` ဤ 㿐Ң  0`` sĐ A -< (?` XJ"*` € -@@J H @D B  /@1 3 ][?` -J!̓*` €  @ $! 0 @82  @2   @ 4 0  @`? @@ Ӑѐ`      㿘w 0`` ; m    `` 㿘 0``   }`` 㿘 K`@ ` 0" \  0 ``"@.  K K`@ H0`@ PĐ@㿘@h    `N"!0!@ Kh@`M`>䀤<  & ?'Ȑ ̖Ș @?  K`p@Q ` @'̠  K`@!   @K̐ 0''Ȑ Ș @?Қ  K`@1 @Ad  쀢@6'  C  @"N@`>5 2 `<`* `'` ؤ`? @L Oـ  K !`Oؔ?"`` !*  #!@`  @`@ ` `?"`Ḓ * "@E  㿘  K`@#"@ 㿘@㾐 ! '# K' ) K @6@@`? sX* & @ @'@ " @C@ @  Ka@ @O!  Ka@  ! @- . 2*! @@ 㿘 s# K a0@#"@ ` !' K! @۔ )   @B  2@@T @@Q!@e >Ԓ?@?@!, @&!,!,O@9  K@?!㹘 !'@  `m K"@E < @ @ `0#$@/@C:  K K $@%ݐ@C-? @@ޤ@C&? a ,@`: K#@:P @^  X  L``@C ?,@O X` K"@3  K"@, e`e@  ` K#(@ߒ@9b @9^. :`@ z` ` K#H@    *` J@     K@?W#p㿘@`a@ʔ ??@4 @4 @3  $ @9# 㿐&   "`L? K# K#Ȑ@  / @Ӓ`@:5 0 a#\ K KЖh$@%(# h@h& ?$L`?L 5 0 K Kh@% $# @hh& ?$L㿈   ?'  @= ?㿈 L L`H@! 8 ~ c@?1- @ # 2,L@ S L P @  J L`X@˔  " @ L 0 L``@pQ ` a   @ `  L L `h @38@  L `@$ `@ @f J *@E 쀥 @h@H㻐 !'@Ac  ?"L L L8` L @w  .`2`@8    L` L L`8 @ؖ@Z K  L`G L L`@>{,@ې   L L`ؔ8@ / ; L9  ?- L + L L@5 @0` ,@Д$#' L `8@0@A ߠ @p !  L@=Ð!㿘       2N   , ) "l*`: ?   ` "N N  (*`:  - +s? 2No  N -"* +*:  G D "l*`: ?   ` *.4:  .`K $ ?Ѐ`5`- @-`B2*@ *@B `5-@-B2*@ *@B  N   8@ @ N j> n  k  h f   x`  K@  ` !*`@ R` 2O N  ? bl   `  , @@C #?@ @  @  @&`    @    E>  (K@  ""`L?㿐    %   2``  @3` + @0;    4    ""`L?  `X  @3` + @; +2@ + @   @ `դ   4 0@ @ 2 @ @ 4`,  ,`@B2`*  *`bC eC (0  8  `   &`F F?    LaP@ +   ?`c ?  x   xJ LX@!   xJ L#``#\@!   !' L! @} "@`  @r@n @j!@@V!,!,@@5  L@;!㿈   ?'  @:g ?   @* J@ " 㿐'D'H    L"H-'N] `.`?: -@L2 Ǖ< 2 $ '    ?L@ "'`.`: L@@  @:  ?'  ``@X 2@3u @; .`   &D@   Y-: U R@ڒ NHN D..`  L   <,@ L`  2,@L "),@L  $>   < "; "   2 "  ,@ `  ,@L Ȣ`,@@>H 2" ! 1p'@W" h  L@"P 2L L bX /$ L@"p  L@" ' LJ   L@ $#($@␐@$ $@*@$$@O` J@  :2`*@`J@  "` :"`  $@`@ܒ`J@ 瀢 $@L  / @rƐ .?'l@sl l l@$@ : ?L 2,? l  l%`h ?@??   L@9"㿐 1`h@v ?㿘 1`h :@r@ 㿈 1 `h///@u찒  $@_@@ @&@  W T T T T T VD T T VP T T T U Ux T T T T T T T T T T V T T T W8 T W\ T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T U` T T T T W T T T T UT T T T W㿘 1 p 1 L" 1* N% 1Nۀ`M T#*` €``,`` ! 1`c 1 1 ސ@z d 0,@/ d 1`Р @zx  0, Ɛ@/В  0, "\ZN@ N R@P N @``` ! 1 1  D` 1 ) ' L!  @`" D@ `` 񀥠 1 :1 L,¬ `` 1 :w1 L,@z * @/x  `` ?$@* $@Nf p$ @$@T:T1 L㿘 z N?  bl   `  "lN,  N*  ?А   ` , ."*  N? bl   `  N?Р "lN?   ` 2 N * @fp *` ƀ: N   `H* 2  * !r: *`2`:`@: @y 1 N Jƀ? N J㿈?@4 !? a @;2 聠"# Lb @= !"# 聠"#P? '?''   DD"# !8    "#n  ƅā"#]: 'Ԁ 8 Ԓ?'2` @'* ''  * '̒ 'Ԑ`̐" 'Ԑ ̐" 2@@'̑* 'Ԓ<'  'Ԑ `  2 @ @' 'ԓ: ' 2 @ @' ''''''Ȁ )Ȑ ' Ȑ 'А" 'Ȑ ' 2 @ @' 'ȓ2 ''Ȁ SȐ ''  1 *Ȑ ' 䀢   ܒ 'А" 'Ā ?'Đ" 'Ȑ ' 2 @ @' 'ȓ2 ' = Lb L@? Lb- Lb L@D??'ؒ ' Lb?ؒ ' ' `@'ؑ:` '2 'ؐ `  'ԑ*`@'''?聠"# c d| eT f< g g h il j| k l m n o p q r s t u v xl y z$ {< |l } ~ | d L , x d P <   c d| eT f< g g h il j| k l m n o p q r s t u v xl y z$ {< |l } ~ | d L , x d P <  h??'T a@6??T  *`X   'T c Lb Lb' Lb? a` `L !"Ȑ @ #  a`  L @|7 `L !"  'T c Lc Lc ' Lb? a` `L !"Ȑ @   a`  L( @| `L !" ??ؐ 'T c Lc@ LcH' Lb? a` `L !"Ȑ @   a`  LP @{ `L !" j 'T c Lch Lcp' a` Mb? b(? a` `L "" Ȑ @ q  `L "" 4 'T c Lcx Lc' a` Mb? b(? a` `L "" Ȑ @ ;  `L "" 'T c Lc Lc' a` Mb? b(? a` `L "" Ȑ @   `L "" 'T c Lc Lc' Lb? a` `L "" Ȑ @  `L "" 'T c Lc Lc' a` Mb? b(#? a` `L !"Ȑ @  a`  L @z `L !"Z 'T c Lc Lc' a` Mb? b(#? a` `L !"Ȑ @_  a`  L @zs `L !" 'T c Lc Lc' a` Mb? b(#? a` `L !"Ȑ @  a`  LД @z/ `L !" 'T c Lc Lc' a` Mb? b(#? a` `L !"Ȑ @  a`  LД @y `L !" 'T c Lc Lc' a` Mb? b(#? a` `L !"Ȑ @  a`  L @y `L !"J 'T c Lc Lc' a` Mb? b(#? a` `L !"Ȑ @O  a`  L @yc `L !" 'T c M` M`' a` Mb? b(? a` `L "" Ȑ @   `L "" 'T c M` M`' a` Mb? b(? a` `L !"Ȑ @  a`  M  @x `L !" 'T c M`8 M`@' a` Mb? b(#? a` `L ""Ȑ @  a`  MH @x `L !"J 'T c M`8 M`@' a` Mb? b(#? a` `L !"Ȑ @O  a`  M` @xc `L !" 'T c M`x M`' a` Mb? b(#? a` `L ""Ȑ @   a`  M @x `L !" 'T c M`x M`' a` Mb? b(#? a` `L !"Ȑ @  a`  M @w `L !"~ 'T c M` M`' Lb? a` Mb?Ȑ @    MȔ @w `L !"N 'T c M` M`' a`$ Mb? MbD? Lb@n !聨D Mb?$ b(? MbD? Lb@L !聨D b(#? a` `L "" Ȑ @  `L "" 'T c M` M`' Lb? a` `L "" Ȑ @  `L "" 'T c M` M`' a` Lb? b(#? a` `L !"Ȑ @  a`  M @v `L !"p 'T c M` M`' a` Lb?  Lb L@? a` `L !"Ȑ @s  a`  M @v `L !"* 'T c Ma( Ma0' a` Lb M" M? b( Lb  ? a` `L "" Ȑ @  `L "" 'T c Ma8 Ma@' a` Lb?  Lb L@? a` `L !"Ȑ @  a`  MH @u `L !" 'T c Ma` Mah' a`?  Lb L@? a` `L !"Ȑ @  a`  Mp @u `L !"T 'T c Ma Ma' Lb L@? a` `L !"Ȑ @c  a`  M @uw `L !" 'T c Ma Ma' Lb L@? a` `L !" ... ... (@haB   @@haB,C( @@=@@<@`dT U@haE@@>(((0pLl A@haC@haC@haC|W&A@haC @haC @haC X K?P/ >],aU*چ3Jt, #+\OX? ^qGEUfLn1 'tZgQ<?S>-Aϕu+14|Dwc{*} U`H-`ُ9(RTHKDgA0|]Tp 7@zyQd)ute9^"JC@Ii2 HҲȐ @)  a`  Mؔ @u= `L !" 'T c Ma Ma' Lb L@? a` `L !"Ȑ @  a`  M @u `L !" 'T c Ma Ma' Lb? a` `L !"Ȑ @  a`  M @t `L !"n 'T c Mb0 Mb8' b( Lb  ? a` `L "" Ȑ @x  `L ""; 'T c Mb0 Mb8' L"@/ !? a` `L "" Ȑ @I  `L ""  'T c Mb@ MbH' Lb? a` `L ""Ȑ @  a`  ̔ @t4  MP @t. `L "" 'T c Lc Lc' Lb? a` `L ""Ȑ @  a`  ̔ @s  MP @s `L "" 'T c Mb` Mbh' Lb? a` `L ""Ȑ @  a`  ̔ @s  MP @s `L ""[ 'T c Lc Lc' Lb? a` `L ""Ȑ @n  a`  ̔ @s  MP @s} `L ""  'T c Mbp Mbx' Lb? a` `L ""Ȑ @3  a`  ̔ @sH  MP @sB `L "" 'T c Lc Lc' Lb? a` `L ""Ȑ @  a`  ̔ @s   MP @s `L "" 'T c Mb Mb' a` Mb? b(? a` `L "" Ȑ @  `L ""t 'T c Mb Mb' a` Mb? b(? a` `L !"Ȑ @{  a`  M @r `L !"2 'T c M` M`'? a  a` Mb? Ȑ @?  `L !""#x???'?'?  @  '?"#㿐'D'DD `D `??'':` ':` '|'耢 耢 e ܐ "# ܐ@'? 'ܐ ܐ 2  @ @'?'? Mb * $%D? Mb * &'??'? * '?ȁ"#0c: ' ܐ "#2 ' ܐ 耢 ' 8  :@  '=耢 3耢$ D"#R"#K%?2@' "#92 '  8 ܐ :  '''? Mb * $%D? Mb * &'ā"# 2@ : :*:       @    㿘    b`  ?   b`  8  R  @ $D` @  $$`@ $:`  @k  @ € $@D@`@ €  $@$@@` $@:  @ $D` @  $$`@ $:`u ?n #!@? ?#   M"ؓ3   2 "  S Q 46, 6 +   " B `  " " € `" < . > @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .         b`㿐? M؁  @  ?@ `㿐? M#  M Z #腡 B M#7ąB' B'@    ɖ @> . 6`  `6 @3 @ M?#  M$%#7ąB' B'@@ f #  D'…B'@@ F #dd M#dd` B B NBD# 2@  2*2   㿐    b`  ?   b`  `V  $D`  $$`$: 7 @j`  @ $@D@`@  $@$@@`$@:   @ $D` @  $$`@ $:` @??#@a@? ?#@   N 4@   "  d`]4 6 6 ,@ ,  @  "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @@b  d , 6 @4 =   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@U@U㿘  R  @ $D` @  $$`@ $:`  @i>  @ € $@D@`@ €  $@$@@` $@:  @ $D` @  $$`@ $:`u ?n #!@? ?#   N!3   2 "  S Q 46, 6 +   " B `  " " € `" < . > @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .      㿈 1  ''   @%i ?`@}찒   @%W ? !  L@$ L ?@ @  "`L " $ 㿘'L'P'T'X@Y;L㻈 !+ 2`'7 15 23 N/ N@$  N@8b b# N N"@`%`Ā ) 2J #@ & @ & @lb    @d&  N"( N"0&  @n찒 @ 耢J `#@ $  @V찒 @ 耢J `@ $ 0 b8@=`Ā %`J #"b8@1 $ b8@, $  b8@'쀢 t$ $ $  b8@찒 (@Ĕ 耢eJ a`_#@[ $ b8@찒 @ 耢NJ J`H@F$  @)$! N"@@ !"P@Β * N"X@ǒ # @ b@ﻒ "$ b@@ʔ @(Ӑ   N"H@漣  N$   @ O!  N@%H"` 㿘 2 `@:    1 2  ā㿘@* " ! 2@m    İ 㿘@  ! 2 @W   İ 8! 2 1 N@녰 0""p@k  ̀@<   N  O "`L"p@>b $   `L@ 㿘! 2 @$ p N" N Nbp   ''''''@܀@(%'' Nb '' @k 㿘 2@   2H( HJ  " H?" J  H  2*? " 2HJ% a@$| a@㿘q@Rjbm `9 1 *$㿘 "  $ a@$/ a@$ a@$̈́ a@ !'@ (   N"@c`^ @!    Nc`@"0C` "`& & & & & $@$ $  $ @$ @(`'H 'L'P'T'X'\@b!@AH ,@-P`€ $$ @ِ $   Nc`@O",``@@@  @$@ &  &@& !  N@## !'@ɱ!?  @q /@q% @   p   @ #@`b  N@##㿘` $  !㿀@( $` @`   @$ @Ӓ   & &   & '@Ɛ$ & &  & @\ `$`@2`8  $`''``@ަ  @ @ ''  €@s "  @$`$`@&$ '@c``@㿘 $@'   @!@ $  @@㿀 $`!@Z @X  @S 2  N@# @$a  `@$; a@ (㿘! $ L @p- ?2 L 2?  @_ޔ ? ? 4 ?JJ2 @(*`*$: a@$6 a@   ( ( @    ̝㿘@`@ @"` .`  А  *`: ?А *`: ? `*`: ?` `2` ` `  l ,` €?, ?".` ,  ,  ,   , *`$ @$.`.@㿘  2  @  耢  @$    @ :, @ #H .",   @ ` :  , ,  , @ 뀤, $ a@$i a@$S a@㿘! ! @â @    @   @ 2  @  P 8 h ` `  ? l 2&+` `  `  `  `? l  +`\ @ +G` Em4*` \+  nv+ \+  rp+ \+  bj+ \+  ad+ \+  v^+ \+  tX+ \+  fR+ \+  sL+ \+ Є 0+C + >+ ` @ ` \+0  00+ 0+ ` 0'+` \+  M+  l `    ^+`  ? +`@+ -+ +  +㿘@N@:`4@*``2`"*㿐@* ig)  ` "l@  ` ***: "%.:  :  & :  "l@  ` "`.:  \  @2`*.?  ``:N@͔"@ @ @*  2.(&@*`"&`N@:`@"*`&㿘 N@`N@8N@N@ "*㿘'L'P'T'X@L㿘 s#!  O`P@b"`@," O"@X`X@@㿘@M>@  $>>2 㿀'@Mѐ ?''@&耢 @a&㿐  ?  @~ ?? $ a@$  a@$ a@㿐1 O#7 3  w5 w; 3 33 3 2 O&X&`&"!'`#  .( > @?*  2 3 (@ (   (. @?*? ( 3 3 ` O 2@  .@/@.?$ 2 O 2 2@Ḷ  .@/@.7$ 2 O( ./$ Ox  G, ᠐' _᠞ Wᠺ O,᠔  , "''@#   O# 3 @4("(' 3`@4(@'@(#ײ`` ʐ  O 2@ s o᠞  k g ᠪ  ) 3! "@  @    (@'@('$" O 2  " %@ 3 @  ``(@'@('` 􀤠O G 2 OX .$ O C 2 Ox ( ( . '   (@&@$ . $(  , 3 3       2*`0"㿘 !,`2 u  3 wa k w k!6  a" ga b6  $ d6 . @ *& 5@ *`( h5 f * 5j a, @ l o ! 3-@ s  3n.a @@  3 @a  w@ 3"!a`&a @     < Oa @1 s@%1 )22 0@ (@@ !#2@ 1 t@   o! 1 t*# p !3`1 u  @! p 1 q!3`  u !  q 3`1 r ! @ v@!  ` r+` v  @ @$@ $$$   㿐'L`'P  3 3' ' 3 3 `'' 9 G7 O!᠇3$3@3.`#( ., ;1 @(31  @5@ @1 @   . @ @ @@c 3 C ; ?ᠪ#)>' ~!~     6 . ( 0 .`@.  @6  / 00@@ @@/ 36 ?1 7!6` (o  D.. E᠄3 F. a@`?  Wᠷ4`4` c `+  4`, 4 * 4  #4c %/ L _ ᠄  @   @P  㿈 !,`  / / / / / / //''.@.`.`.`.`.`.`.`㿈N@ $ N` 1@@ !,`2Z * *  " (ϐ 2 N@ _k@   N@ `z ``ŀ`Z  `@ˀ`9 `-4ґ*    N@ `z ``ŀ`Z  `@ˀ`9 `-4ґ* @ % ]  N  *` *"  N p 2 N ! 2 @!(@Ԑ!(!(9 N` z  `?ŀ Z  @ ?ˀ 9 -  ?ґ+ :  z `?ŀ Z  @?ˀ 9 -4? 2*!(*`N`!(`@ `  +``  耢 B  03  3 .@ ? 3 `.@ `? 3 `.@ ? `.@`*  3  ? 3 .@ `? `3 .@ ? `.@ ? `.@`*3 ? 3 .@ `? `.@ ? `.@.`!( 㿘.`6`I PHN N @6 3 0(0.++N `! `<0(.7`N  `(.7` 㿘 2 a $. .  PȒ . .@ . @6㿀 !'  ' w,`2  `@`*`,2  2  (  (˔ !(  P@N Ё !' P`@ `N@ 2$ N``$``a2 ` `N` $ @  *  `@* @2`  !x 5@~  `  ?#@ @b @И ` @?@v `@r `@ ?#h#f 7  @J.```$ ?#h# @% ``??#h  `*`2 " *2 " *2 " * w! $ 2. . .  .` PȒ @@  @@@ @    P@!*2@ @- P @0 @(*`@ @2 @ (*`@   * @2 @ ?* @*`@ ڔ*㿘&0@2 2 c@2 . #d((33c@3. #d(( 2 2 c@2 . #d((  33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d((  2 2 c@2 . #d(( $33c@3. #d(( (2 2 c@2 . #d(( ,33c@3. #d(( 02 2 c@2 . #d(( 433c@3. #d(( 82 2 c@2 . #d(( <333. #c($@ hD@&@&㿘&0D@2 2 c@2 . #d((@33c@3. #d(( <2 2 c@2 . #d(( 833c@3. #d(( 42 2 c@2 . #d(( 033c@3. #d(( ,2 2 c@2 . #d(( (33c@3. #d(( $2 2 c@2 . #d((  33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d((  2 2 c@2 . #d(( 333. #c($@ h&@&㿘 Pa@H*`2`  *0 : *0@`( ` 2㿈.7 6ܐ, 2 @ + @2$@  7'' , 2`*`$@ `**`2 $@   , 2   .`2  `* *`+`&@2&  , 2  , 㿈/ 7 7 , 2 @ + @2$@  .67'' r'k', 2`*`& `**`2 &  6 ,  2  J'C'{, 2   * *`+`&@2& ߠ / 2  ֠㿘.56㿘.6  `O *`2 `  㿘.6  ` *`2 `  㿐 3``*``*@(`@ `*`+``+ @ @  '' 2  2` `2 2`2 2`.@.`.`.`.`.`.`.` Ҳ`㿐 3``*``*@(`@ `*`+``+ @ @  ''7 2  2` `2 2`2 2`.@.`.`.`.`.`.`.` Ҳ`㿐 ?  @  . ( *`*@ *@ @ '** +   '..􀢀2 . ...2 . `. ƴ㿐 A*`*@ *@ @ '** +   '?..2 .  ...2 . . @  . (  Ŵ *`*@ *@ @ '** +   'x ..2 . ...2 . `. @  . (    `? 2`*  !# ! wb'@$""b@c @⼒@$ w""0/ w5 T) w" @  $"⼐ @*`@," @@,@|@,⼔@,@,@p@,⼔@,@f@,@- @]   @,Ғ?    ??@I  @, < @, <   X⼒ x@ސ@@,ڐ @,  @%@,@, @ O  ⼐@,@ F   `@ @,`@,  @@,w@, #@@@+ *    %" + "*   %" + "*   %" + "*   %" + "*   %""  %"" `%"*`᜖ ?耢 ? T@*!`㾈 !'LL'D' /   w  "cL  T!Ē  "  %L  |"'p''@ P@ `@ @ @@ 0@  @  @ܐ  @א %@   ?????'̐ ?'•  / @ϔ  ???''????'???'` L@DD@Y;L-+ /O? bl   `  O` !*`@ R`/ O` !x*`@ R`/, @V  O` ` ɀ,̀ L Ta@X @Y , @\ p @< P @8 ` @4 @ @0  @, 0 @(   @$  @   @ @ cL "%L@SEcL@xAcL`" w`4%L` w%L?  !  T@!Ё㿘 wbȔ ǖ  w L` !'`''' ''''' '$'(''` ``    `` `+ "`L?!  T@!㿘` ` 2 `@    "`L?`?` &``@ , :   @ * &@@+$K a@㿘 "1 wN 1 w T#Pa'$@ʐJ /"  J / @1 w T#Pa$@" J /2"  1 w#P@ΰ#P0  ?"`L $# a@% a@$7 a@㿈 !  T #d   #\#`#@@' #@㿐L? bl   ` 2  ' @ @#  J@`:`l `@ `  `2 .@J`".@ .@``֠ 㿘! x#P  #PH` `` T`#\` #`'@ #d@Đ@ T T"8@bH  [?@{@뙐U G J?` '< @ ,  T, bP@$ @ѐĀ ' TĒbX@ě @ @{~@  @d  @U @H  "`L?  T@;"hx !'@ T T"8@ևbH NX?@{D@$R  J?` '؀; @ؐ ,  T, bP@/$ @^䀢 & Tbx@(܀ @,耢 @{ @!  @( @ @֐  "`L?a  T@ɐ"㿘 "' N  !  "lN?   ` 2  Tb@L@4   "`L?$ a@$OpenBSD: sigsuspend.S,v 1.4 2003/06/02 20:18:32 millert Exp $ o a@$t a@$OpenBSD: sigsetjmp.S,v 1.4 2003/04/22 19:57:57 jason Exp $`" (0? (`0$OpenBSD: _setjmp.S,v 1.5 2003/06/02 20:18:32 millert Exp $" " " @" `&"`@>6 0`$OpenBSD: setjmp.S,v 1.4 2003/06/02 20:18:32 millert Exp $  0 "! H P """  """㿠   @" &  g @㿘 Tb @U 㼐 !?  x c# '` $  `7  @g  &`` x x#hcX"#h" 3 !/@L *`  @ *  " ` 2 @s & @'  x# @ %@ X "  '@Q @ X`%` XM`X @" E&XX    D &X/ % l    ?  ` 2 .ဢ߀݀`2 @ϐ@$!` `ؘ  T @;b 2@!X"` X`  "`  "a  !  T@"h ! a' ""@N    @?А@! @ OЀ   TbА@{  L { / T- T+ T) TL f"e4i` b2f``2c`  ؒ *2#"0  $@Δ0$@ǔ0$@c0 #\$# @@x@ )  @@ @x` @x  "& 2   22 & @ 2 ``4 L  f   T@ _#@㻀 ! a' ""@Mܖ    @7?@lF! @ܔ O 9  TbА@˔ 2 '4+ b2($@ѽ@x@   @}@ @x7 #@x/ a0@2  a4 L ΀ f a  T@ #P㿘 `P @:@Y  `P  `P @<㿘!  P@! @ P  @4  P@Ғ 2 P @㿘! z  T T#`@cp$ @1 `P"`P㿘! z " @$  " P㿐 z`    T T#`@cp $@ҍ y J?` 2'#! z @ , L@ #@N # 2, {" @ʐ  *  T @Fcx , L% {L "  " @4x ,@`@7  " ""`  "'$L " *`:    $@ , @x " $,  "$L  $ 㿈L@ 0  `L@ x X2 @ ` @, `< "l:`?   `  @9, ?Г:`! $, : ?   `D : ?.    ` ?? ` @, `ʖ*:  . `$? bl   ` 2$?$$:  . *  x" '" "  鵔؀ ?  '$ a@㿐 @?.@ .  ?#@.   ?#. ` '@   $Z a@㿘 { `   @Ko  $` { ` % {@Kc $`8 $ 5 `* @*`@*`@ *` ' "`@v.` * @*`@*`@*` @u$ $ @K8 $`*` *  *   * @&`$O a@@"?'L'P7'T'X7L@uʐ '' ''@ ?  *@v "& "&@u'&  "`L?㿘@u  T. #``  ,+  *    * @ `J@  @`*J@  * .  ߑ+ *㿐`2&@2&'5+ UL@ 1 T# @Ԭ  2  `@ԡ 2  `@ &@  & ڤ   @pHa( 2& 2":J  *@`*@ `: DJ  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ `(8dLL㿘 { @  ` {  А *`: ?А *`: ? *`: ?ɀ`2    #8,  €,@` ,  ,@ ` ,@`@*ฐ $@*ก   {Ѐ *` H . *@  ` :   *`*@` *@` *  {*@ @(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  㿘@Β `@̇ @k` @f`  P`a` @    㿘@@q , ?@Jw@ 28 @6 @   % @sY  &@  U"@ϒa @`  @ @ @sd@&@㿘 :     @ $OpenBSD: ffs.S,v 1.3 2003/06/02 20:18:32 millert Exp $x "2 J "2 J   "2 J  J  $< ( b("" c4" p ?" d ? l0 "  -  ? s8" w ?*@`! - r*@`  - w*@ (@@` 0 @ 0  - x S s*@`  - r*@`  - w*@ $` 0  0  - x S s*@`  - r*@`  - w*@ " `"   *@ "   *@ - x T t*@` *@*`$  a@$ a@㿘`  "`L?@r 6`? -&   ,,-`@5  6 @4 4ݢ2ت`k@4 @,` @4א @,`  # @4ǒ   @4-  @,`  (5 : @4@4  6  @,`   @,` ڨ@q $< a@H @ D% * @,`@@G,`@*` ,  &, @G& @ݐ? (* @,`@@G~,`@*` ,  & , @Gs&  2?* . @Gb. ?$ a@㿐 #\.`2`@( !'L\'D'P'@"   U@# L  U Uc0@#(  .``2 @DL@SP,`  U U#(@c0  4`@ DL @P@Fж U84` @ؐ  D??@ ?? '''@{s ˰? `! {!@7!D!" '@; #''  cv `L`0 ?X'`=" ` 4 !/#\``! @  Ucx@!%  Uc@ِ @ą%L`#\/`!` @  Ucx@! Uc@ `  ` @ݐ-` @L   U"@詒c @א @ Q?`@x "   L # !   U"@葒c@ `# U"@ޢc`@臒`  @ @+?@`@H` q`@`  Uc@K '@<!'@ 4`* @o֐  @E- U @@A @Kw@: @ / @L  U"@2c07@6 *   +6`& *``+ &%L@   @% L: L "  @Y  U"@c0 V"@`o @Eр   #\  @  @T OK  @#L  V"@ʒ`Hl' '@  #\  @s    @*# @%!   V"@秒``D@LL @JԐ@PP @Jΐ@ @JȐ@HA   @`LD  V@"@炒`O @H*   @J O`   @  @o  @@o͐ @  ? !  V@א p  ? ???' V`'ܔ@yԀ ?0@ 0Ԁ   @,   2 @?㿀! !  ?  ?'//' @ !  V@ 0 !'   V V @ؒ` `@ @nZ @j`2U? "`"N?@Z H  V$@n@P@ V`@ɥ@ѐ`2㰒   V# <   V!T`\  V!(` @ V!@   V!X  " @?  V@ !㿀! !  ?  ?'//'@  !  V@!㾈! !'@S!?쀢`# =` ;` 9` 8  J? bl  J   + : bl `@ `   + :  *  R  * J   р?ȐJ  7 *  J " "  J    "lJ?  J     J   퀢?*J  @ L + -L   @ 56 @Ғ -   @a& L   @ ?@    @` @T @OL@ + -L`  @`0 # ` @`ܖL`  @ `` @`͖ @/  ?@(`?  ?  4  @ג 2L?  V@!` ! !'#\ /! @ܚ 2;    ?ؐ ???' V'Ԑ`'̔@wc̀  &a@! ̀  !/  !#\ @ 2  @ƒ   2/@d̰ a  V@l!` ! { b'#\*b /! @ 2S  !#\ ! @v 2F    ??ؘ ??' V'А`''̔@v̀  0@+̀ ̲ !/  !#\ @I 2  @_   2/ " Va@m @̰   V@!h`'X V"8'X@X   V  V"bH@Y? @)bh   @r 2@ڰ?0&   @D  V"x@7g  V"@?0w  V q   V@А"@)1 @7J  V@ǐ"@)( @)$ @=  " @]`L   V"@b@) @Ւbh "X@ϒ X J@ 2'X V#'XX@I / "X`' Vc'X''@eϒ\ @Q  X@H / "X`' Vc'X''''@eB X# V`@4 2@X'X@k7.X ` c  V@Y#@( "c &c @f> 2J@@'X@@H / " V`'@ V#&&&X&&@et @`L  VX"@yc(@( @? x؀ N   @_'$  VcА '' @a@R$$   V#ؒ $:$$ @c    V #X  V#D* 㿘? @ 㿘@ 㾐 !'@!``  .  /"`L*?,  @( 6 ?4@c44@ @?   L`0 4@, @?2@_?$  W@l P㿈 ''@C 㿐N@ ="`@Ð@5 "w @*7@* ,`` i  #8 ` { `  `8@jj*` *,`$8 `"@j*   ,`8@$8 c8" 'L% L  =2 $@i  8*`" (?`*`8* : , *`: ,   =2 =,@ *`,   @* ,``  㿐 #8*`  "  "@⦒ 㿘  {c ! @?B 8@ ! "`LN  "`L 㿘  ' @?& 0% 4 ! {#@ B  @?`0  L#$4*` @# @ @#@? `0 @?`0 "㿘! @> 0@   " 4@> 0x@֐ W`ؔ  ' '''''!'@耢  ?$OpenBSD: Ovfork.S,v 1.3 2003/06/02 20:18:32 millert Exp $ B a@"` X !>' 2 @: 2% Ȱ!  Ȁ  ` @  2` "`@ `@¤ 2 W@" 2@p @’a  W@#ȁ㿘   "  @0  2  W@1 W#؁$ a@x X X (`0?' '> ''@a {? "   @S '? @N  c8 X 8Ւ@&& @h  @d ܐ@c  @6 @W @T ??܁% a@$] a@$ a@EEEEEEEEExElE`ETEHE< 1( X+ @ X( P X% p X"  X  X  X! X!  X!@ X!h X ! X ! X! X! X!㿘  "`L@h ( `&& & & & & & & & & $`& $@$$@ @ h X bP@ ^?46 `.  @_ K@r H`D&`6`6&` $@ * 2``6`86`8`&` &`%   צ@P@B &"  2 8 $ X"X a &  $ & $  "`L@J@g@g @g 㿘`(`D&`$ @@E' / @2`L`  `@@ &`( `0&`&`& 㿘  ` @g T 6 6 @g  " @  @gu@gs  $ `$    L .  $  `@g] " L?@gW 㿘 $@1 < `4<@ $48`&8* 2   @ * 2``848$  X"X ׹ $   L 48&$: "4:*2  X`"  :$ @ 0 @" : "  " @$ 4 8ܰ` *$$@u $  @Ԕ? "" : `L 4 :$ "[$ $2@   $$@ C$Q@fT6 2<$  c $ $ 〢 2#@H * 2``48$   X"X  $   L $48: 4: 4< $  J /@  /*@(`@qDO$@fg T6?2 @fa " L$C $* T62 :$ 22&  $   !  L  $$ L@$$$ 2 X`@? $ $$$   48$ 2`<   L 㿘`@  E"`L $ @>"L 8  9 27   "@y@2  $& $ T 6   J`/ $ @&  X"X e @&  2   㿈  $ 'H @Cq   HH [   L % U5 82 $ `  ?`  4 ''쀥'H2'@@|  H 2 :L%  :L`'@B5 :'  ' $ J?`/  $B  / * U 6"@ '    2 `L` .2 `L` ?` ` `@` "% `@ '@ `@͐  % L@e0@@B 5 8 $ & $$LѰ   "   $  '@ "4 6$  ` $ $ `  : 4 :   4 8$ 4 8 6$  쀢 " $ `  "  $ $  D $ #4 8 $    ($ @ D D$ @  4 8* 2  *`2  $ &```@F  2^ $`@B5耢@c $   2-- $H29 U 6 2   $ B     X`@s?  5 8 $@U& $2 H   5 8@dl@@A 5 8 $ & $  ?;"`L @8 $``@`:    > 86 > X>> > > > (> 0> 8> @> H> Pf ``@? #!  Lu` 2 &`$ LQ m   L&`  > X>> > > > > (> 0> 8> @> H> P:  < @ ((&`0 &`, N`D`.6`4N`E  ?`Dc  2`  `2``0"&@`R`6 6`,  @  @    㿘 ( *@c$  2 $   "$ @c$ $   "    @Bb  `"`" 㿘`$ H@cg   @t`$ ``6 <& & ( M ?& @@ΐ D㿘@cs  㿘 a   "& @ca&   ?"`L  @cx&  2 &   "& @cO&     D" "  2 D""  P66㿘   @h8   8 $ ,   ӗ  ?  ?`0@ `,@  "`L ?7 L&L$! a@$R a@$' a@0 !'! X"T  "@/$ N . N  2 X"@$ /@@  @` X "@(*`J@ /"*`ڐ &i! LL 'Ւ 2#< (@ 2``   >N"`Lǔ# H! .@@ ׯ = X"$@Ԑ@F$ "2! N@ / N`@ O @@#  ?"`L  Xb@$@$   L  !  Lې$ L   X@"   `   "`L@aܐ# #  /,&@@{@a0Đ "#.@aȐ##`' . X-@"@=g-`d ' " L' ''% @"ʠ?! * .* '@aߐ @ ' .- - -@?g |`Ը u /-   @B b L@.$?#5 @B T LL` .2 `L` `  ``@ɒ " L' L$` `   `c/`@aw "&@&@@̒ 2 `? /, ``$ @@>Đ-f' `' L ' L``@a/`@a* @> $. a@`   ` $  @@ @V@: <  "  >(` :`@?? D8 >` > >> `` "`@``  @`㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @L@E?@; kby@*@#?@ 2 8@@? c3> '"`. @ . "@٘2 &  : +   ; &   + : :&㿘   bl#% .> @8 @"A @!@ @C @!@ޢ  @"ɶ@"ֶӢ &@D(@"| ʢ , N@: @ò` `* @@@@ @  ` @2   " @: N @  "@ : N@ 2  y  @  #  @ N @  @ @ (b N?   ` 2U *:  _"P @ :M N@?@   ` 2U;*@  "# @ :4 N@ @  2 @ :) N@?@   ` 2 *:  _"  @( N?   ` 2*:  _ . c`$ .  `.`2@ `.> @P@"Z @>0@"W 0@>@" 0@^0 ,,  @ `?, ` ?,   $@ &@ @ @ 2 .` @ @.@ 2 2>, /` " `/` @>, " & q 2`l# ?#$!"\ D/  > > /   @ /  "?>&@ ,   :, :3 2"  :@, ,  &@  :: "   : 㿘 @ N * @j   )  @ N@" `   `2  `      ,  `        `0 "  @(? `""l `@ `  ``_`"l @ `  2 _` `$"l `@ `  `_{"l @ `  {_  {  @є2  @ @Ě]`& ` `㿘  0@ N * @  )  @ N@ `   `2  `      ,  `        `0 "  @m? `""l `@ `  ``_`"l @ `  2 _` `$"l `@ `  `_{"l @ `  {_  {  @2 2 @ @^`㿘 ك( >+@ @( "m M(NR?~@ Y @o@@_@耦 $@  Z"q &( v82rm   2kf e b( 2a\ 2]X 4YT  ( Q J G((@ @0@@0>@@; #7((@@ 0((@@ *(@((@   >(@/(@@.  @@(@(@0(``   ` $  @@ @@: <    >(` :`@?? D8 >` > >> `` "`@Y~` "`$@Yx`$@Yu 㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @l@e?@[ kby@J@C?@7 2 8@!@? c3> '"`. @ . "@2 &  : +   ; &   + : :&㿘   bl#% .> @8 @"A @!@ @C @!@ޢ  @"ɶ@"ֶӢ &@D(@"| ʢ , N@: @ò` `* @@@@ @  ` @2   " @: N @  "@ : N@ 2  y  @  #  @ N @  @ @ (b N?   ` 2U *:  _"P @ :M N@?@   ` 2U;*@  "# @ :4 N@ @  2 @ :) N@?@   ` 2 *:  _"  @( N?   ` 2*:  _ . c`$ .  `.`2@ `.> @P@"Z @>0@"W 0@>@" 0@^0 ,,  @ `?, ` ?,   $@ &@ @ @ 2 .` @ @.@ 2 2>, /` " `/` @>, " & q 2`l# ?#$!"\ D/  > > /   @ /  "?>&@ ,   :, :3 2"  :@, ,  &@  :: "   : 㿘  ,@ 0 ( N` @:  , @ `@땒+  @ N@`@( " `   `2  `      ,  `        `0 "  @O ?  `"bl `@ `  ``_`bl @ `  2 _` `$bl `@ `   `_?{ bl @ `  ?{_  ?{  @ L @ `@`@@ߘL& L  `㿘  4@ 0 ( N` @\  , @ +  @ N@ `   `2  `      ,  `        `0 "  @~ ?  `"bl `@ `  ``_`bl @ `  2 _` `$bl `@ `   `_?{ bl @ `  ?{_  ?{  @& L 2`@ @ `@`@@L㿘>!`+@ @( "v`M) PV~ўȄ@ d ƞ@"y@@o@耠5$@  i"@&("`8@2@ ``2@| {@v `2v@o 2p@i 4j@c `(`` ` Y@T   @ @. @@O@ I/@("F#A@ `@.`@@6/@O@2@(@  5> (@  @@/@@ `.``(  @@@/@@@(`㿘<"e @ @4"E@ `( "`    "  { 㿘 !@ϩ$\ a@㿘@)@N㿘 'D"l'H   ` `2 -+L  L0 L x XL )0  )`#?)  >n Ֆ`  $ `%E  "l   9 G "h @`4?@  @  ?1  *' L9<@  b 41@ @  1?#? ' L<@ B      ` `   ` `   ` `H  DH"@㿘@"? @ @8? !?` Xؐ#`  X#   ?"     $ ?   `*@ 0* @*  @* `      +` *`  (*  ! ` H;j&. ㉘ `v  " : "" " 㿘 (0  3`+ +` `? @@ "  > @@q @W  ?@S @ ?*@  @& @]@㿀` `!' ''  `*2@ `?`7 x 8"  c  k   >`P>@>`>`>`>` >`(>`0>`8>`@>`Ha  X@樐#0P    @']'5ک`x@) @ @7`/` @:1/@ cV @1 )   (@  `ې  @7 /  0os/@Đ b@ @0` (` @=_)@Ȑ c@ @7`/` @/@̐ b* @1 )  * (@ А b @7 /  ?Q/@Ԑ a@ @0` (` @`&)@ؐ `ؐ@ @7`/` @"=/@ܐ c @1 )  ?֔(@  c @7 /  "W5/@ c@ @0` (` @)@ a"@ @7`/` @?f/@ a @1 )  )P8   c  @7 /  m8  `!@ @0` (` @= @ ab@ @7`/` @0,@ @ c@ @1 )   /@ @Q @ 7 /  :m)@@ @ 0` (` @5Đ/@@]@ @ 7`/` @(@@@S @ 1 )  6(y/@ @ @ 7 /  9)@Ȕ@ @ 0` (` @xs/@@@ @ 7`/` @0(@@@֔ @  1 )  =5C/@ @ @ 7 /  V)@@ @ 0` (` @*x/@@@ @ 7`/` @?;(@@@@   1 )  /@ @ٔ @ 7 /  #J)@@ @ 0` (` @?@aB@ @7`/` @!}@b @1 )  gXa" @7 /  ?yN`  @ @0` (` @)/@bD@ @7`/` @@c @1 )  =Ґc` @7 /  /`p@ @0` (` @ &ߐ@bƐ@ @7`/` @:I@c @1 )  5;̐` @7 /  "a@ @0` (` @6u4@`9@ @7`/` @9@a @1 )  蟐` @7 /  1+be @ @0` (` @= H0@bD@ @7`/` @ʿ7@c@ @1 )  *1c@  @7 /  ?$7`9@ @0` (` @V֐0@aÐ@ @7`/` @#37@`@ @1 )  ?1`}@ @7 /  !a7aѐ@ @0` (` @0@bO@ @7`/` @?97@b@ @1 )  (P1c@ @7 /  7a@ @0` (` @=ߐ0@b@ @7`/` @/N7@b5@ @1 )   1b@  @7 /  :ᴐ7c@ @0` (` @   @  & & & &????????$ a@$ a@$ a@ ` (  *88 " (" 㿐 '`v֔㿘 @? @rm㿘  @re $" a@$ a@$ a@d 0TtΤθθθlllllxHllllllD(    " @@M!S 4x * @`*`@M$` $` $`@Mj @$`$`$@$`$` И P` `H  " "  ! $ $ 4$ 8  !$ $ $ $ $ ($ ,$ 0$ <$ @@$ D$ H@  `?$ @:   "@(  @8  @ `$ $@ P@ @ @ |4 (< DbE$ L$e& & & @ ` "`@ `㿘   @J @:  J@ | 2@  @&J@ |!` & "@ \  "@ ;  " @ | "@ 0   " @ n "@ "$㿘 @?ܑ* : ` X&!* € @ @B   D`" D D  ,  " @ @J@ )} )  ,  H" @ J`)g&@ c@Δ   ( "( `, T"`,@  `( "`( 0 G"0@ C@ >  `@95 @ 0@ , @ @ϒ  , &@:` @:,  @ "l `  @ , :`@ِ @  @?֐ , :  ? {`  ` "l `  ` &@ , :  +"(  ? *"  , {J"@K "@, "@? "@ "@2 "@s "@$ "@  @G" "@  @> $@ S@0 @J@ ,2`& ` "l `   !@@@  @n @:  J@ }2 `&@ :J@ }"   @ &J  }  @ @ߒ @ܒ  @ ! @?֐ , :  ? {`  ` "l `  @ 㿘 @ @ &@Ԑ *J㿘   @ J@ ^2 `&@T  `( "`( , ", @-  @  ` :J@2J`` & @,  `( "`( 0 "0 @Y 㿘J@ ``\ & @ @I J &aa)|a{`." `[`*,`:`#a(),`:`! a}a9,`a1 ~b[,`:` `@q| @ٔ w@Bs@  o  D`" D D  ,  " @ @ `  J@ \J` ) \G )  ,  H" @ @ ` J@ \ J` )`,&@Œ (.` H @ `@c@u @    "`H`2:`@ ,`:`@ʐ  @"J *  &"@j "@K "@^ "@?| u s`$J \o`$J {k`$&@l @ #J@ , ` & ` "l `  !@P @D !@ @ ` : J@ \2  J` }2 `*&   : J` &` :J` \2J }2 @ @  `$  㿘 "l   . J@*`А @ "   ?  `  $   @Ғ 㿘@א     ZbH@o  2&    ZbP@`  2 (@p  & @: J@ ^2`&  @:J@ ]2 `&@ ` ] *] ``] @:"J@ -2`&@ ` - *- ``-,` ` : J@ -2J` ]"@ @ :J@ ]逢@  @:J@ -2 `&@ ` - *- ``-,` J`]&@=   x ` 1`?,'` % @ `@ ?l  ` "?@ * :  @ `@* ` ,`?<@` @U- `?, @ `@" * * `" * ` ?,`  `" ` @ ` * * `?,`` @&@  @͒@@[0@y@ 㿘 @ J@ - [    * @ 0*:  : ="40e   &@ J - ]@ @ @ @  @  `  J@ :J` ]3`@q 0m   &@h J - ]@^ @ @ @T  @ ` J@ = J` ]`?&@> 0:@ @ J@ -2` :J` ]"&J` -`& -@, *`: :`@@ @ ` * `@   .`㿘  & @ J? bl   ` 2" ` @  @ 2` @J`2`@В 0!L  @ `@* ` .`L `  `@ܒ@ߩ L 㿘 =@L@ ` + `@.`㿘 @ @   ` :J@J@ [2 J@J` .2J@`$J@`$ .@ @ ` J@ . J` ]`$@c . > 㿘 @  ` : L@2L` ] ` &` :J`2J ]2   a@" a@@@ڔ 2`@J`"N``@   @ 0L@  l@  `  *`P( l@  `  x*`P(*`: 㿐 &  ]&/// & &㿘 ` `8` "l `   * : Ւ0@z`   `4, "`4㿐 &  ^  ]&////̐& &㿘     .  `y#H*` € $" r&  "@L`Ԕ  "@(  @j" "@  @a $@ 0M "@( "@   "@K"@  @B $@ ` @ݐ 0% "@ "@0@Ɛ~0@t0@  ""  {@" " 㿘   "    _ `& 4 @{   @E\,  "`@E,  2  @E|` " "  ` "4 ` @EB !"`@E 2  @Eb` "  "  , `  :`@=` @$ ` " ``%   @ @"       -   @:`$   %  * --%% `  (  @ (*@   *` 㿘   *`   7` 2. * @% @  @ ` @  @ @@`@ ` @ @ `@ @ @ "`@ *   &@>    `@ @" * :       `@ @2  㿘`@͐`  @&`@DL @D 2 `` "&` @Di&`  0"?@&`  &8    ` "     `&8   `  "     㿘  '`8? @  Ò `4 &`4,@ @ 2  ɔ 2,@  $ @ $ @㿘  @c@ .` *  @<. @$ 㿘      `2`@:`*` @E @ *`"`& 㿘  ' ߐ ,   H.    @ "@ @  "@ ` ` "@@@⦕* "@    (@> "@㿘   @C.` 2& ے 0& 㿘 &`  @C*` &` ʐ &`㿘  w `  >1-+)'%#@ `:0`@ "3 / &`@" !`@""c>$""`@ * @@  2`(  `@$ &`@ 2@`@ $@B  &`<&`@ &`(`@`>@ `@ `*`*  ! `>   4  2`("`(㿘<"e@& "4"E@&  $@B  " @B  " <@B < @B@B$ $$ a@ߘߘߘߘߘߘߘߘߘߜߜߜߜߜߜߜߔߔߔߔߔߔߜߜߜߜߜߜߜߜߜߜߜߜߜߜߜߜߜߜߜߜߜߜߜߜߜߜ߈߈߈߈߈߈㿐! {  Z  77 X (@J#P@V#P#P$ (@"   @`@ @ "`@2 @-  - Z@'`%? Zh@`@- ) ZL`  @L ? @ "p@*L@P$ ("@5` Zh@@PJ@ @ υ(85 ԇ( @*@  `J@ @ H*@`*@ $a a@㿀!  *` *  *    *    Z x #\ #`  "#h#d#l@!!㷘`&`&&~@  & && ,` ( 2 :$2  2 `   \2 2   \? 2 :2  2` @0@㿐 {  }   @ " @ { @㷘@ @`2@ 2  " [ {  ] 2  "   }`2 `   〢 [` @P&@L@ [ { ,`>` }`8``@ ] 2`@ "+ *`'``#`," ` 2   * 2` * 2`Z&``@(@& 㿘 ~6 (2.?  *@`@  /2*@N   Z@" @.H "%  @, 2 *: 2`J@  @: 2* 2`2㷐'$@`a  `? *`]`?"D` `[`*C `M4J ``!"   [@֒ ] 2   [4`!8 6`[4`! `!4 `- `4`-  `] `4 4 `]` 4!&` 4!&` ` !&` ?"44 `4@- "@` 2 #"?@#  `- `*`  #<@u  㿘@@㷐  #\#`@  (\`  : /6@ " a "$  /;< 9@(@2 @ 2  2  @ /? 62@ `$ @4  2 `3@  /22#\  / 8  6 /  #d#h@#`㻈\ ` d h 'g 6' $L@Q 2` ` @”$ S?L`€ L?` "H GaD @ /`41 ) \ .` ." @4 ` @ ? 6#\#`) 2`  2J`` @`@a@:a  Z@ӎ"㿘`@ `@, @>@>p` ` N?@>J&`  `` *`@,&`?$@&`  @ `"@: @@>F& @$ "@@>f?` * $@`&@@` * $@` @   #@ " L ?㿘@:a `?`]@ @``[`*@ @I@"D"K  "B   =  ,  * 2  @`! `?`2`@`* - ]@ @ 2`@( `" @`* @  ˰ @*@`?㿘 ` * ?? @@ ?@=?`@= & 㻐 !'  @q$   a Zb@%$` @` @@Za  Z@{"㻐 !'@G$ ? @$€Вa  Z@X"ȁ㻐 !'@$$ ? @(€@ޒa  Z@5"Ё    (*@ ` 2  $ a@㿐`w ?$OpenBSD: umul.S,v 1.5 2003/06/02 20:18:32 millert Exp $ /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@ ? ? @  gc" "" " X !'@ 2@@5 #  # .@-@) :  *  . : .  {. ##`% {` x4x`4 `4 ` 4 4 4 @) @ `*@ @  @ x4@ 4` 4` 4` 4` 4` a  Z@"؁ xN -    Zb#\@7# Zb#\#`@#! Z#\#`c@t! Zc @d @@f!0bN  ӑ* : `K` *` €   0,@  ,@L@  @` Z#0+ 0 Z Z#8" Z#@#耢 L@ `" 4 @  ,? @,@?@@!㿘`&    4 `   @b$ƿ? /`4 / &/$) a@X !'@ 2@=@ #  # .@@ :  *  . : .  {.  cc % { , ,  ,  ,  ,  ,  ,  ,  ,   , , , @5 @J `*@ @)  @%  ,@ ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` a  Z@5#H xN -    ZcX#\@ڐ7# Zch#\#`@ƚ#! Z#\#`c@! Zc@ @@f!0bN  ӑ* : `K`"*` €   0,@  ,@L@  @` Z#+ 0 Z Z#" Z##耢 L@ `" 4 @ْ  ,? @H,@?@?@!㿘`&    t `   @$? /`4 / &/ @ 7'''L'P'T@ѥ'Xa'''''@ LPPdHHHHHHHHHHxx , ,, @ h h h h h h h  ,,,,,,,      ,,,,,,,,,,,,,,,,, ,,,,,,,,      ,,,,,,,,,,,,,,,,,   L  0$@dL !'    @ `? "l `  " %!   & &  4@ 2@ "l@  ` 2 @2   @ xc` 0,  €  4@ 2Z @Z` ?& & ޤ@ l2ڤ`פ,* Ѧ!H B !h < 7!h!h3 1 @3@* @' !h  ! 2u@m2i"? "l `  !H    @@P 퀌@ #  ? &  &@> 2ܰ bl@  ` 2  8.@ ,  €"   @@& @$`@$& &@ @ "?/ J #  ?& &   4 @  "|0 L`  ?& &  p@  4 @ @X@0 L`  ?&  ,@&`@"L,@&"?" #  bl@  `    &  &`4@ "~-  l@  `  ?&  ,@& `  4@Z "$@T,@8!H ?Հ`MB"*` €` ""   "-`R   "-`R `` %   逤@  ,@ `? &  &@  2 @( @A  x X@5$@,@   x: p2l"8!1 ?Հ`:+!*` € "   $ !,@ `? &  &@ 2 @(8 @@Ӓ@/ @ e E@Œ @@$@,@@ 2":"$@d !?!  Z@n# @^` @ `  ( 6( " * @- `]** @]6` -* @ 㿘< 2 * $@ % &&@@ʏ@@&$@ @8@~"@&&㿘 0 @2 4@4$ $& 0& 4c  @,@< @& ,@5%  @@R& 4&& 0 ?㿘?, !`2` @ @m+,+++|+\++++++++L++++l++<++++++++++++++,+++|+\++++++++L++++l++< 㿘 1 |!@ " |@2{ |&!@"!< @! |`@2D$!< |` "!@ |!<"!D @Ƿ ?J:   JJ2JJ@:  :2J0 2J J@ 㿈#\?@ p !'X\'DX 'H'T' ?X # |a@ @T ! |!<@1ݐ$ !<a@@U!<' ̬@1ΐ$ } '܀    @] A' [$@ݔ"`#/  `+   @ #T@Q찒 ` @@1Ɛ@@1 D@ @  H"D'" B j '`9 /M@  `(<,L \28,!, %$@1 $@1  F ' L? @*M@@ s$ 4˨ . ϶? , L " #"T@ 2ݦ`@- 2զ '܀ ܴ N܀ @17`??x  ?L: ,?#\$ ?  ؐ@1  " ?2 :,??K %L  : $ " ''L?`: :, '"@ !%$@0$&@ '@0Ր @0͐3 @$ @Ɛ@@0? [hX = X $t$H"@0Ð 2 @0  "`L@0? D#@  !  [@d"p㿈@''`?''  ? J ? ?  &@J `?  JJ|:? ?J:|?  㿘@@㿘1 |!H " |@&!H | | |"!P"aD"L 㷀 ! |aP ' "$P |aH  P [@Dbx $H0yְ ) | !@`  |D H"DS H@ْ젒 H`` @Z@Đ P$H`$P`  [@bx $H0I*?쀢`2L |"!L?  bl   `   |*:  : #!L  J?`\2#!L#!LJ?`\2"L"L:,@ $LJ  : \2$@"%@ '^?<ᜨ @֐쀥 ݢ@ H@e젒 H` ` @@P $H*? [b@X'@Ĵ- #\?1    #  [@("㿘 = ?@/ d 2N? dmS*2Q* N :s "q*А  ?  *`* Б: @  N/7$*`*1* : `2$ ǐ (*` € * ? *? *? *? *? * ? :*???*?  2N"@.`d 2  -?@.ː)? dN :  ^ \ N`:`2 *" ?"@.͐ 2  ?@.?&㿘? = <?@.k d 2L5? d  `"@@. d 2 `#?@.}?@ dL : 2*@*@`"@?"@@. 2 `?@.a?&㿘 # 2N@2? 0  `N@ x X `    +`@А *`: ?А *`: ? *`: ?& 㿘N@ :`N@ :2``@;.`.`   (8 J2J " $ a@$` a@$ a@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  $ a@$9 a@㿐 !|` !tO"@!t "@ - #)|at,  ##@@u+ @ +` *`" *" *  ** " at"@ "@    at !*`t *  *  "!l  "ap@ *` * 㿀 a|    a* ' [# ` ? !t@Ȑ䀢 ?-| 2  % ''' % t,    @Z ?2   @  `0|   ! at*   "!l"ap㿘  !ta|  " !p"@ :`*`  "C   "! $!|#"a?             "!" $!|   ?  $!|"a#!  `* "ax $at!| at "?!pat"@ :`*`  "㿘  @@  at !| " !p"@ :`*`  "`4. ` ,`   `@    ""! | |  $ta(  "pj* @ "!l t* @"x㿘 !|`  !tqbm `9  * $!  l ap@ "l!x 2` lap at  l #apap  #ap !t#ap㿐@@' ' "`?$$    *` 㿘 )  & `&  &@ , 㿘   2?2?    `*`,  @ה  ` `* ,  &?   2 ?`2? ?   2 ?  2? .2 ? 2 2 . `0 *`    2?  2 ? .`2   ?$h a@$Q a@${ a@$  a@% a@$ a@$ a@$j a@㿘 'H'L'P'T'X!@H㿈`  `@''''p$ a@$ a@$ a@ $  a@$  a@㿘 (   "`L?6?@F @2 P (    ? 2 0    : @  0f  < :@ f  "  :@ F㿘 㿘 |@aX㿘 | "\  0?,@N    0,㿘 [#@!  \ .   @~@ 0? [ @~ @vǐ@ɔ @~{$Ä a@$ a@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" 㿘 ! } 0 2 J \@|#H $ 0 0J`  \#X$ 0 `2 1 | 1 - " ""h `  @֔ `  N@   |"h  @ @”  P @֐"h-    "h-  @ ? @ /  |"h  @  - "h L@ < / `L@``/2`/ N@ /*$@  &,@U,L@ 2ޢ`  @> @9 2   @ 㿈  |c#H @H ) \ @  #p#\;``#H @@#H`` #H㻐 |   . ᜐ"hb  '@ϒ , \c@ɐ  \c@Ð  @  !"ؓ.  }  \ 0@$ .    @h@@ !  \@R#㿘 bؠ@ebذ , N  , @[@  \N   \@Q#   \N @ /  \#$b a@$ a@㿘@\$_ a@$ a@ 0? (?#$ a@$ a@$ a@$ a@PQlQlQlQlQlQlQlQlQlQlQlQlQlQlPQlQlQlQlQlQlQlPQlQlOOOPQlOPI @ Jg" 8o-"H XJ+"FG* ?`C*  u2?*  !00  `  `+ *`+ *`` *``*`*`"   *"* 2 㿐L [?'@ ې -ב2  @ @&1 8 E L? ` bl   ` 8  @-  0(L*  ` 2 А L   @&H 0 2 0 -3  =@/@&  L g  o a *`:  u*` : -)$8 :  + - =ڐ`=*` =  ?* : ` uҐ#H*` €$ ?" ?"" II -@%ے &`0 ? ?@ -3 =`@ =` ="  +` -@% ݐ& ? ?@ -3  X@r  -@% Ő& ? ?@ -L3 @Z=`G =` =!``=` ="  -@%y & ? ?@ -=`3 @5`" -@%`  &`# @%8 ? ?@ -3  X@AL  ,**` .@U`g"*`o`= -`X`+`-0?0<`u07*2 -2   +* )2  &2 *2 <c* 2  * 2 +-  =  *   - +  X2`2 `: J@+-X2@   `J@-+`8  X`8  `( 2 **   2 **  "J@2 ** ʐ $ a@$ a@$ a@ @(*`  *02 @㿘@@ @s @㿘 }a   @ % }= % }Pa@}ƒ Ȁ @  aa`? "`@Ɛ @  "@ ဢ0"lL?   ` 2 *:  "ΠP #"ˠP } }`8"`8  @*$`L $`$`@$`L $`@ 8"` "`L L %  ]`@@iؔ   ]L l `@ `  ` ]` ?$` `H@i   ]L l `@ `  ` ]`  $` `P@i   ]L l `@ `  ` ]`  p$` `X@i   ]L l `@ `  ` ]`  X$` ``@ix   ]L l `@ `  ` ]`  @$` `h@i`   ]L l `@ `  ` ]`  ($` `p@iH   ]L l `@ `  ` ]`  $` `x@i0  LL  =2 L@n$`@%L E ]L #" L #2  8 L "  "  8& L "& @Ȓ 2,J A }"62 J\2 J ""  *@'`# *&*  2 ** J "   "   J "  "  " 0 Jŀ"*㿘@y =   㿘1 }!   ] ] @}ے`&!@ @~ 㿘1 }!  @o8&!@  J " 㿘@% ]  @ 1 `@@?` $@@"h$`@"f-ؒ @ :㿘@t㿘@ @y` "&@㿘@ 㽈 !'ђ  B耢   <    "`L Ρ ?@! @$#"`ʒH  ]a@h   H        c@" @@!0%@a  $@䀤c``g  @!̐@!ʐw $@c&  5פ"   ` , %   `$@@$ '@O , %` @ @ "$  2``2$`@ 퀤@!w   8 @!D*  2 & $& @!9&  & @!_&  & && & @U& !  ]@,!㿘  `@ `= $3%``@$@#6 $"    ,*  @$@ ֘ Т06```(qܑ6`-    4  $  &  4  -% %    4      4  ``&$6? "" ? **'-`)@` @$$@`6? ""  ? ** @3 π@0,)$` $$$`6"? "" " ? ** @ @ @-` `@@$$@ $6"? """ ? ** =⇒%``@$@#6 $"    ,*  @$@ ֘ Т0aM$@$ @  $`%`$@ 2`? ""#@  ? **#@@8``% 2`? ""  ? **@  Ėݒ%㿘@Ӑ   }  } $*`    #" # # #?㿘` }*`!$@@  2 "  @  " : @7  & &   @6@  2 @$@㿘  @&   22 &   2   2    @  &   @ 2   "   & @ `"   2   2  㿘  ]-    X@ X # "$`L  `L X @} ]`L   @X @o b "&& 㿐 ]@9! ]_!xL [@{ Q ]" J``MJ  1 ]`M* ]`k`G ]`K`( ]#! ]! ]`m`g ]! ]! ]! ! ]!% $ ]!$!!@\"% @ ]!@S ϐ ! } ]!@Gax""! } ]!@̒  &&  &&@!$8 a@$v a@$d a@$ a@$+ a@?ch?#ض  @ ޺ ?@ ?# @!?3?a/?#?  ?# !?#?󀢡?#?  ?# ! ??󀢡 ?#? ?#  ̀??  ? ?# ! ?#?  ?#  ?U#؀Q??# #?  ?# !  ?6@! 0?#?  ?c@  ̀@ ?"@ ̀@?#?  ?c@ ! @  @! @ #?    L # #?  ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"  ` @! @2` @   ??  ?# ! ?#?  ?#  ?T#؀P??# #?  ?# !  ?6@! 0?#?  ?c@  ̀@ ?"@ ̀@?#?  ?c@ ! @  @! @ #?    K # #?  ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"   @! @2    ?#Ԑ# @ ?`?D '#\   @ؘ2@   v? " L@ `? , 4 $    "?J 2, ?:#@ :E4&@ @? ?`)` ` % _ J _"@z 2 `?$  ` , `4  ` ,  "J 2L Т` 8@9 `?@C0#@ՐSF ӄF @   "  ?b !' 4 @ 4    i ΐ d?cX  ]آ   #\   @ ?@ F ؐ @˔ 06*` *      @ `( ( @ @N  @   @@?#\  @??@ ,`4`$`` @  `J 2,``z0d %`@?`W@ "SL "O @y " L _2;`  @y 25` $` ``"!  ``  ?#@ " #`   ,`@ ,`,`  ,` 2  ? ,`4`  ,`` @ "L  8?#  @" @ @ !  ]@ؐ"㿘 "t?  , @€? 㿘 t ?㿘`? "`@  "@@p $ a@㿘 ?*`  }* aN  2! # b @Ȑ  $b@n 2$` 1  ]"Ȕ @ " @s  㿘 ?*`  * bN  2! # c؀ @  $c@ 2$` 1  ]# @` # @rՐ  㿘  c  #P  c'  #@ #` #`@     @  c`㿘 #`@    @Ӗ c$@#`  㿘  c  t#P  c'  l#@Β㿘  "7 L'  `L&L㿘 I#`@E    @ c$@e6#`  㿘  c  *#P  c'  "#@Β㿘  "7 L'  `L&L㿘1 # " ]@s1 #, `"#(@ &#,   ]"(@sb8&#@ 㿘@ 㿘! #`   "#$ א#`㿘! #  @D# c, $#`"#(@Z $c,㿘! #`#`X !'` u c ) / ]+ ]#( l #0` #0@`n `%#(@+ #( # R 1P'c, c,̒#\' #` #0@4@aР@ c, $c,$c,$4)#0 4@@ Ȁ @%#(#(`"%#(@;#0@@`Ƞ@%#(  @#(̒@V@', #@q_$ '@t 2L##`? "`@^ @  "@ q0 +L :`  \@_ o !  Y%#(#0 #0@_ʐ Q#(  ]@Ԑ#0@ P@x@Ȑ#0 ]bX@`Ƞ 25#(̒@@i',@Tbh&@Pbh&@Lbh "#(@v J@ #(@ K&I&@_g @.bh  " @v^ #( %#(@mT @bh  &"@vJ #(@ bh&@bh "#(@vL @ҔJ@ 2#(8#( &Ā#(Ā  c@%& J ,  *"@`    ""@*"@ `" Ā@  '"@  !  ]@"p㿘N  @  " @lܐ $ # "#$ @ 㿘 # " @uȒ 2   2 㿘 #` @@`@ 2@$㿘%  c L"#L (J @    ?L@"@L "``J@ @    ?`@ђ" @` " ` ]㨒bx"` " `""``J@ @    ?`@" @z` " ``J@ @l    ?`@" @b` " ` `J@ @T   ` ?@" @J`  "  c `$# $"㔁㿐N@ ' ! ]J@` :'`J@ `'@˒"&@ǒ"& @Ò" [ @uTJ 2 M& @" G @t@J 2{ 9` 9& @"& @" - @r&J 2a #@4\ # @& @{"  @rn J 2G @4D @4 & $?  ]"x& & & $@]"& @Y"& "@U c (&  #`"  2&     &   &   2&   2&  `2&  ` #t` @ 0 c? @-$㴀  c İ  #` #@]8 #&##   t I c . @7 " ] ]""#\% #` #c@^i@c  $c &#@' $c$cj@ #  ]" ]" c㐘@ M TJ&#Ԓ@g̀ @&# "J @#  ] ]""@Ж@И@] #*  c  @Ȥ#  ] ]""@cc@]c@y&#  $c䀢 "R@pN c@@f' c*@! p#L ;`#L x 2`/x"x@͔  ''@Ȑ L㴀 ! #LJ + -J  @#L    "c  "c@0 "@jN  "c'#LJ  @@԰ ̀` J@ I @ @E<㴰 P ! ]b  1'' ]'/РА"@f 1 #t '' Ȕ  #t    a  ]@"㿈"%  #? ) 8`#<)`2#$8 #` #@[͐ #$8%#<# ]b@%耢 2 $8@  $8%#<$%#<$㼰 X ! ct ' @ ;    "#x?5 7 #LJ`+`-"J #L# cc @[ x#LJ   @ Y#! # @F$#~c  ] ]""@! Y #`@- $㈀2#L@ Ē@Д @`?x " J  M#  ]" ]"@V! @\# 1㈀ "$@$㈀`@ $#L &'  ]" ]"@/! @[#  ㈀ "P$@L$! c@I#c#,֐#L <`#L $`05` `@@& Ģ ` J@  @Q @#Lؐ #L@q #L| ct @&ctJ&㨀`T x %xx x 2/А В@  ''@Ȁ ! | ct @&ctӰ %&㨐 1/@`  В@Ք`''@АȠ #|` ct @&ct  #L !  ]@"ЁX ! ct ' @{ = ,  ] @  "cx? 5 7 #LJ`+`-#L # cc @Z$ xy#LJ   @ Y#! # @$#"c  ] ]"#@,! Y #`@ѐ $㈀2#L@< Ē@t @?x " J  #  ]" ]"@! @Z# 1㈀ "$@$㈀`@ $#L '  ]" ]"@! @Z#  ㈀ "O$@uK$! c@#c#,z#L ;`#L %`04J ` `@@ɐ Ģ ` J@  @ @#L { #L `| t @%tD&U x %xx x 2/Ȑ Ȓ@  ''@Ѐ ! | t @%tx  &㨐 3/ȠȐ'@  ''@zР #|` t @%t  #L a  ]@Ð#㿘! #   "c|"#x"@Ӑ ?$# "# 㿘 㿘! #t "#x@ $#t! # `"#@ !$# "#㿘  ?"" ]#    @pe 1  &#t! ]#0   @pZ &#t 1 #@   ]c@#0@%  &#@ 㿐 ct  z # 1 cD#H @$cD 2 &#H#H "&#H@c&#H$cDa #H "#L% * .`  cL"  * .`   cT@Ĕ   cX@   c\@ cL"   * .`  cL"  * .`  cL"  * .`  cL" * .`   cp@  $@@   $ 㿘@А 2  ]c@ & & @Ő P & ]c@ 㿘  @2 *@&  2 &  ]@ ]&c@  * "  & 㿘`  @ .`@ @` @*@@㿘  @: ,`@@n˒ 2 `@* 㿘L@  @ "l `?  ` 2`L@  `L@  @ "l  J`@ ?  ` 퀢  L   "l `?  ` 2 L   L   `L"&  ``&@  ]c@I @|@* & 㿘@  2 ]c@3 `$ ,|  ,v   )p    "@ @@ 㿀' 㘀 . @5 @,@?@2`''  ? ]0@̐@d耢 & ]c@ & @#@ 2"  ]31 ]0  ]0##Ф#@@W䀢   㿘J`"e # ]J #^ "  l@  ` 2J 2  &J 2L ( N &@Ґc4?2  &J` "l@  ` "J "L"@ &@ ]c@\ @@  * 2 㿈  @' ^ @03;. 1 *'5 v  ? @ 0 "` &Ē㿘  ` `@m   `  @m     @l   㿈  @  ^ @%X ВÖ 1 L ' 耢 " ?:( @  01 "@   "@ }  @ v@ t  Ð@ e 0@ a 㿘@ 1   ]c@s  ]N  ]#` ]N@  ]# ^0@;㿘 ^ H  ^ H` ^ ^ H@$8㿐` @n" @h"@   㿘ږ   Ӗ  ɖ   ” $ @/7 ^"NN? ,2 N`@iP  @ ̐  @R 逦@  㿘 #! `$#% # $c@  #  "#@ #  @ @ #cĀ $#  @$㿐 #Ĥ`'! #   ^ X   @l< $##   ^`p  1 @T0@ g@b  ]c@| . #$Đ  Ȁ  "@" "Ȑ 㿐! #'  ' ^ X   @k $##  ^@Tf `p 6 1 @TZ `@ `  `  3`  2  2 @b "  &# 㿘'L'P'T'X@L㿘 s c!  L ^`x@$"` @" ^`@"@Xk ^"@`@ 㿘'H'L'P'T'X@H㿘 s c!  L ^`@"  @Ɛ" ^`@"@XC ^"@`㿘'H'L'P'T'X@H㿘 s#!  ^`@֐" @" ^"@̒`X  N "q @ @ `"j N@ "f @ @('_ &'@&@UXĀ  T "h Ė ?''?'?'' ` #\ ` P ( ؟     ^`@Wg`Đ?"`h@d8ఒ !``@ & & @k*@`@ '@ ' @\@@*@`@a@Vzā㿘@aR @aT` 㿘 n 㿘&@&&  @*&"*? &&  㿘 X `!`"X 'D@g{ = ?$@ 5 1 ^7  `" T " &\N@ :!&\ ? ` @P 2 @܀ a-` `! !T`" N@ : ^"ϔ   "!\"!\N@ ? :"` :0^ ?`   "! X D*``"%X `:` !`5` !T`" N@ : ^!   "!\"!\X ??%XN@Ā`: X??%X !T`  N@ : ^"Xr "!\  ?2'@ `2   "@㿘a! !l?  ^@"p@ $!l!l *`:  + -"`*`:  + -  !X`)  %!$X! `"!' ?  "ad"h! X`J`X!%!  ah ^!$`! !dah!dX"@ " $X !d$X?%!d$ahC?*@$`J -  ^J 0 @fL - *  ^!` $`X * @  %a%$X`# ad?! X!h X!h?ad$!hX"@ " $adX $X!d  ah?2`X"ah`J` "`$`J` -J X!  !h ^!$` $X!dO!h!dX" "@$X?%!d$!h)X* @` "%JJ`-`"J`-   $``:@eא 2 G? ^!$``J  :$` -J  -@e  -`J`"?J` X $X !T`  N : ^"@< "!\ ?6 W25`J` ;1``J`!X $X !T ^a $`N : ^! W "!\N`:Y ?W :* @$`ޘ  ^a$`I`J@ : `J`@X =$X`%aJ "J`/%a : X $X !T ^a $`N : ^!ْ "!\N`: ? :* @%a` XX 6 ^* $X@ %aX ^!`$`$X㿘  R 㿘H 㿘> 㿘 a  @@1 a  a @㿘! !  ^ ^"@cKb$!@cu a "a 㿘! ! " @w$! "! 㿐 a    ^ ^"@c)b $@bђ w J?` 2'#! #@%, L@ #@d # 2, ^   "@db , L "  " @d☢  ,@`@d"J # ##"`"``!L  *`:    $@dN☠ " $,  "$L  $#$I a@$y a@㿘 @j   "`L?㿈'HN@ r'D w HJ`   "`Ln @ ' g w耢 @. 0]?` HL#ؓ*` € * J%  2 F%  C"   ?"` <" |  8"`| 5"  1"` ."   *"` '" x  #"`x  "   "` " t  "`t "   "` %  %!   _#$ $ L  }   "`#\   @c? ?"`T _#@ϐ c 2  H?  "`L( " X & H %   *` @i%  "`a&L  `@ 㿘#?  `  \    * `""` "@""" &  |` @1  6  4  `L"  *  T   "@   T"  `  `. @ Ѐ`  ` "`@㿘? (    + ?>   >  `T,    2 2 *   *,`  @Ȑ    6 6   : 6 * 2 2@6 6 & @ 6 @q@nM 2@*6 6 6 6 &  4 `   ?2 * #@ `" 6   2*  (   #  `  +@ 2*` +@*#  $@ ?6 6 ` `L `T * "@`T&"`TP `T`  "    ,`  `"@|s  $,`   2? $ *` 4 `T"@$ ?`": *   ,  @㿘  H`  p`@  "`L    `2  2  ` (  ` @u 㿘  p`@  H`2  `j @ L4` "  `b `  P  `[   T*   ?@ `N `@ !`@    x`A@??@; , 1  * ?@ `+ ?,@2 2 *`  2 `   `x* 2 @2 @   `$@@  `! 0L   ` @U0@P@㿘   H`  `{ @0 p`  L6 #  `m `0  P  `e 0  T+   @0  *@?.  2 `L 0t2 *  2@  `  `= 0e  ` , @ Е,@  *@$@    `4   T* @ T 2  @"@ "@   :@ @" @ "@  * @$'"@$@@@2@"@  `L2 "  T* " `2  @  VT㿘!  D   `͐!P  $ D"  ` @  "`L㿘# ` ! @v  ` a` " $ ԰ 0W $ `  @`  `  `s!p㿘# ` ! @K  ` a " $ , $ ` @7㿘  `@+  `!  "`" 0 <`$`   @   `  `!p㿘  `4! 0߀ `.!0? `' 0 T , "  T * @ % # '     T"  T@ `  `.`  @\  `ٔ  `T*  "   |`$@ ` 2"  $``" " " \`\" "A$\ ` :`@ 2@`@ `"`" &` "@0$`` @`&` @`%&``2"@  &`  &` &@" 2@`&`&`   ``" "&@$`n!8@ 2 ! ` @+1 `  @' @}  @!  `&`@&` @S  `   L2 P$  &    T.`" P`@  T?#`P ѐ㿘@L #Ԁ`  ``? ` ,  "??, @<`2`$OpenBSD: brk.S,v 1.5 2003/12/25 18:49:07 miod Exp $ ` @8   : a@ `$$OpenBSD: sbrk.S,v 1.4 2003/06/02 20:18:32 millert Exp $ $   : a@"$㿘'L'P'T'X@L㿘 `d@%㿘 @d㿘 @ǐ d㿘 @ɒ`d㿘'P'T'X@Ph !'P'<  d@  ` `a ## #ߖ#` :   L#`  d@@T:̠ `0@x((  (6'$@@?̖ `8@ & 6$` 2` 2` s#&`` `H@xʒ & 6$` "` `P@x & 6$`   :,  , *` ?$- `+ `:  %`%N m`% d@ @J2@xHbX@x|6$@`N % `` `. . $. *` ȑ: .P@ & 6` $'@ `$bh '''' ߔ `  `` @@[@@! L 7@A@K@͐ @@!  L 7 d`  `"p m  >@YԐ $ `$b ''''АĐ d@ @x !  `@͐"㿘?"& ?&&   !'2    ?3& I ?-a  )  ? j ?/??????????? `/b7@V! hc j? i&& a  `@v"㿘 2&& "&   &㿘E?&& &  `"` td8d|P8@d0tHlP㿐@=h' a!`@ "`2*? *H !'LG`%=L`z7!`*` €0`` `"*` |  a!h@P`` `"*` `  a!h@@``  `"*` 0  a!h@0``  `"*`  a!h@!` dѥ'l aap@ `c @ ߠ' `̐#`  aap@ɰ`  aax@ږ a!` aap@Ζ` ̐Ȓ "  aap@` a a@` aax@`  "  aax@~` aap@v` a ap@m a!@f`  `# `#@Y aP! aL!@ aap@bI`@'`'` '`'`'`'`'` '`$'`('@?'ؠ a @u@V$ `# a!@K` `?͐" aap@% ` "  aa@й > ``'l` $2m d 2 n! 2mn!m d  !n! !m!n? $? $@?& Ζ 4` -`` -` 5-`:  V g  aap2  a ' d aapa@ a!``` " E  a @  aap@` aa@w `nc `c ''` '@hf' '` ds'l aap@jQ` a'la@aH`( @r@` D`  `d @ @c9` 5`$`6 a a! !@Qג <Ԓ <* , ,  <- aa@#  `c  . L    a@d"㿀# a' @ts@ a  a@K"@ `@  (*@  㿐 !А*"@'q"@* "@*`@*`'D  8`#`? "77''''@uN*@㿀. * "*   *   ? #    ? P? ?    ( 0 8 @ H88888 8(80888@8H8P?X㿘 !` @Q "h   R X 2 &  ?2 2 """""""0"4"D"H㿘@- h " `h  ` "@` 2`} $㿘@"P㿘@   "a㿘@"  ,P\ht8D(x? `}' *` € G  Œ耢 ~?|z d W  7  õ耢 n?l ,  )  C  #     : !              '9'    '1'                    $? ܖؘ @ ? ܀ ?  "`L ? ܖؘ @ ??܁H\pX\    ` ? d@  `  ab@p" `L  "h"`@$`X } `2@I& *` V`6  "$$$`  $`  ?$` $`$``8$`$`\$`T$` $`(@r$`$ '''''`X@G̖ @GC +``<`€$`P 6$` '     '  L  `"`"@H^  b~i$`@FJ$@ $`L G 㿈`'' #\b !'D  ' ('H\'L'P'T'X?'T`@'d'` $'` ('d '7'' 8& 8 `€ P X3 €H D@ € PL€ 2  & , ` €'P'XX  X  PX   L & ,& 0 `   d   & ,  Ԗ X' '+ T''Ȓ '|%?/ظb@!b?  #* $,  Ρ,   "   ?+ `Y `U 'p  't?ppt'` 'dX9& ,ހ   %`L2 `%`L`L 2G& ,x{ؒ x"@|'p"`'t@?pp@'ht@'l@?hhl'` 'd& & ,i \ %   \'\fܚ L " `L #"| & ,& 0L (v  X `@ 2p  @Fg @E .@F- , , TD `€   & ,& 0  %@EE , D@  @  T'T @E''& , , !  a@" ,"@0"`4"`㿘  " 8 8@% ("$"($"(""" "  "" """   㿘   " <U < `@ 880(80333233㿐N ! '$ L@T  L`   J   8  ????' $ $ $ $ $ $ $ `?"V  2z? 2v? 2r? 2n??h? "   "]?$$  $ $ $ $ $ $$ ! a#L`#L 2`"    "/? ꀢ    2/' ' ' ' ' ' ' '   $ @’ $$ $ $ $ $ $ $  a'  ' L' ' ' ' ' L`n'$$ $ $ $ $ $ $  U"   O2N @ "   D`2A @ "   7`24  2 $   2  2$   2$ @`@` `" `` `   n2m? Lg? VL$$ $ $ $ $ $ $  =  5 22  @ "   (`2$   2 2$   2$ @+`` `` `     2 `?&   "&@.&㿐 a  ""@  u  @*p?  b`(@M @ O  b`0@M  "܀`* J@ %J@ f" y b  2 @ @@  `J@ ဢ fĐ܀`@R `  &  !` !$*` €???`@.x& ' Z    L`1 @ 2) @f  "$  " ``@א  $  @А $  ?@  & @-` !'&'ܦ@ܒ G @. @ @. 0@`,?@ $#?@  @r   ` ` ܰ &܀ !@-k!  b@t 8㿐@ 2E @  2 > @OH %   .@H $'?j#?,@t   2 @?&`2G㿘   @Hd&` ? 㿘` &  $  $ $  $  $   $ `$  @$ `  *`@$  $ *  ` `@a0 㿘@ 㿘`"L    2F         :?8?6?t  "/?@,?c %?     b  b ! 2"@KВ."䀦`؀`2     2  2    a      㿐N (?`@? ?@?@  ?@O & ! $ L@P & L  ? J  ??c( !? 'D#"  ? 'L'? Ⱥ?  ? `  ``D 2 D?Dc @`#@??Dc# `   |"a?D@%ܘ#@ /bܟ@    e"a`@``?@_    T"a'L? " *?#@ $??c?@@#@D @% D/"ܟ "?@@'J* 2 `@'E* `4 @'@* 2 ` @ ```4@`(`?c@D@@%k$ /bܟ@耢 " @@ 4 @J @```@耢 (@@ڐ @ϐ@̐ bL`x %o@``@8d   b`H %]@`` 2W@`` 2Q@`??ؐ @ ?# `!?#` ?#?c "6@?c@@`2?@ ?###### `     ' ''' ?' c' ?''   '?ca ?@*# є & @          2  @2 ?c@@`?c@#@   ?#@??c@@` ?#L?#~?# "  #!  a  b@ 8  ??????????''o@   j@ 2 ` ?"aT     0! 0@ '''''''' '@''' @?''Ȑ@x `^% Ā   $ `     2$ <:㿘! "  b b @Ji`$"@J㿘! " @_$"?ch ! b ' ? b b @JE`؀ '" c@) ?#"@H v M # b`@KĐ  b ,@K`蠒 ?,  L  *`:     "@K蠒 , @6  ? ?L  ?`#`#` #`#`#`#`#'''' ' #' #' '   F ? #@$@`K ?  2@?#a  b@] x  ????<  $ ` ` H  8P  ? ???) b @K `*@  @K 2*@`^\ `J@*:    `"  @J 蒒 " `*@``"`J@  @` `'` '`'`'`'` ''' 2' @&@`  2@   $` ` P "Ԕ  "?`??? @5  Z  "Т`"Ð ` $bЀ .' b@" ba@6Ú !' b` @'` '`'`'`'`b?E'   $ ` ` @ܐ"Ԓb@6 2b)   $ `` 㿈 a " Ր":@ 2` ?"an?   @$&` T"!`;?#`)@ $`` ` ` #\#`@ #d  `@@  4@   2   2   &`@`2`!8- €         "a ?  "a0㿘 a ""T  `   @#  "!   "L"aN    J .Jd?`2J J .`? 2 d@  "dAd2  ? @^ 4Y   2 D 6`5"1D +D@@ 4;L =4 "   " `2 ``  2`""`  `" ?@ ?` $ ? $?㻈 ! a'  "" 耊` @#` "!2?`@x$  ?N .2@E @d@a $ b  "a ? @f$  b@ؐ!(㻐 !\' "?2? b!@ @    @  *`@ а? @" ɰ?  7`4`  *".``2  b!p b!x@D "䀤 " @ @E .` b2"@f@ s@E    0: < @ 8 22``2`*`        ?#@2` 2`  2`   `? ? `MK``2H? 2@2" =?@ ! "@"䀦``@y@ (@ ?@D "?  @   a@1 ? a  b@!㼐 !' @1Ȗ" (?@9`@@DZ `@!   ? @! %@.*`   b@!㿘 ? ?  ? ?  b  @C " @  b@e  ?㿘*`$ # b  А :`b(@GH 2  .2 N .2 *`  ` ! a' ""˖ ' ''Ā  "     ?  c '̀'    `@#@ `̟@Ԁ `    @oԲ @'Դ %  "  cl"""cl # @ z* <2 @ s* 52 @ l* .2 s 2r3 0   @$ ̟ Ԥ%@# Բ @'@ ` #@ @  @C;Ԑ@'%'$@g$ &Ī` "`@ ࡔ"  @ 4` @CԐ@'' @ @ِ@֐ bb0 %# :`07`0@1hĀ  bԒa %7 `@#@ &t`Ԁ  m` %  %?]`@Բ @U'@12Ԁ   baԐ %ԤJ @2 @~~ ؀` ܀  ?#@  Ԑ @d%Ԑ @'  " ` '` #@ Ȑ  'x'@ @uԤ'Ժ``" ̒ '̀` `@#@ `̟@Ԁ 2   4 %'@ d   cl@( @   " @   @B"Ԑ@%'@ ` @ْ "! "a    b@}n"p㿘 a ""   2  @K?2 @h 0@ @   @ 0@ 㿈 a ""ɖ    `@$?`@A&` ?       /""L   " " @D . 2N@j 2 N?  bl   ` I-N? ."DN  @#Ȕ D!  @A!  $"cl& cl"& " $!@' @/ "!J?  bl   `  .2 NJ ?J . N?  bl   `D  "a  @D : 2NN :2HN $N? .@  @#c !  !@A  !$"#l' & #l# &  "l#`J?  bl   `D 2 + :  : . J 逢?J . ! @~ O   bb@@ݔ  L 9 L f"( y b %2#`2 @E @  @@ Ԗ9@'`2L ̀ fx ! a' ""    @? @!`? ?@ ?@  "a )`&    ?#@"            /   ꀦ耦'!  b #\  @a$   ?"L"  1 b 2%@"@a  ! @~ O   bb@?  M r ; 7 M f"^ y b \2Z2W@R b@?ݔ%@9@ G  @0@ ` b"%@@?Ȑ  @@  ܖ ?$;& & @}औ 'cl#l "  @ @O  & &  "!@1 2 M  f   b@z"ȁ㿘! "耢  b b"@A9b$"@Ac ""㿘! "耢  "쀢`@Uː $"㿐 a  "K" "` +  b b"@Ab耢 $ ?@@  %a J?` 2'#!  @{, N #ߐ@Bs # 2, b @Btb   , @!P   @!I`  @`@ '  '  `    `"#l#l""" "L L "  "  "`&  @B/ "&$@,  "!$@L  `*`:    @$@`@B " $@,  "$@L  $@ @$' @h%a 㿘 a  "" @@   @ 㿘 0 @,      @, 2 㿘  " "      @-< 㿘  ``   " " " l #`  آ " / da b @Ab Z ,%@ L   bL "  " b@Ao  `L " , `  %`@C   @$@`ð $`L    *`:    @$@`@A:  `,  `L  ` `$@% p a  ##'`  @,h 2 *   b #\ @_/ # cd cd,$cd@|w bc@-2܀ Lcd   "a!  b@x# 㿐@|W    #` #@,# !  ! #h #h@|=$#h bc0@, `#h   "a㿐@{S  .@?` .@`.@`@{F 㿘  % !   & &   @ && @ $&@@$@ `&@ 2@㿘P a  "" 5 ahal ad @,`@ah @al   `@   2`  0* P@ &ђ ?  +`+`@RR@ 22""蚄?[[[[[[㻀 ! a'  "" ?& ` @ G"!$#d#` #\  @Қ   @$@d   )"a@j 6  "a ` 2`"P*` €         "a?  b@w#@㿘 a ""&     @  "!   "L"aN    J .Jd?`2J J .`? 2d@Đ Und2  ? @d 4_   2 D 9`8"4D .D@C 4>`L =7 "   " `2 ``  2`""`  `" ?@ ?` $ ? $?㷀 ! a'  "r" 耊` @` "!(?` b@z??"N .2h@yb ,@ #\P($@\Ӛ$  b@v#`㻈 ! a'  "'" @2x  b@Z#p 2p l b@<c f@ ZJ?` '#O@v, L@  @? bl   ` "`;,@@)j 0 "l`L@?   ` 2`L@ "`1 J ? bl   ` "*$@:Ð @Q,  @*` a ?$@` 'F'$]?2[?$Ԑ@ ̰.2 @`.2  @Z  ?4` <$` @ݒ @D  @@ @@  @8 4`  $` @.` ,` @,2 .`@(2 `@) /`2 @!```@x4`&㿘 a "" & @)?  )@.@?# .@2  . .`@   @ @ `   &6` 㿘.`  .2 .   ,,`6 :2 kђ6 , 4 2kɓ6` ,`6 㿘@Z%?' )!$T #c4    2@Z2`$  @Z2`$  2 ! 4 Ȕ!  2`ƪ 5 3 - 7 1 4  Ȓ **  `@Z~#$ c4 $Ѐ`  b# ,,`2   , 4*  2` , 2  kd` ,2`x 6ʒ 6cxe;#z @Ԁ ` ? &6#z㿘!  e)  cx!/    ̀ $ t  )  Ơ`'  k&ူ?4     cx@ *`ʔ2`35cx ` z . 6 upuuvLnpnuvL    ԝ㿘 a  "ڐ" a  $h Ґ" ,` ` ,`㿘 a ""   6 M I ?#̐ @ @2  @2      ' @~  ""   0?#   @ @2 `"  @2  㻈 !' %@$ $@@Q* `4 @L* 2  ` @&ƒ "   !  b@s#?㻈   ! '% #? @\$ @@* `4 @ * 2  ` !  b@si#X ! a' 'D'H"" D'   @>?:?  'H"$  '  <''Ā@ '   ސ' @  `   @? ` *@ #Ѐ`"  ܤDHВ`!*` €   )4?   # `'  %  #Ȁ` @ %J# @ܒ   ($̀ $#  *`L1 & L   * L "cJ@\HD ''''#q H`   *`L 7ֲ#ְ  ֲ@"@*` 7ր  @ L 6(Ā`% @'k @* 2 'آ 77@"7ր# ր `  L@c; "b* &7֑* 2 ""#y ֒"@*` 7 @  #`  % Ȁ   @ " Ȁ @'ܒ   x$̀ $#  *A`L "# $ 1   `#Ā 1 #Ā  D#܀ # &#D #@ HH#Ā   /'7#Δ  &#"`LD #H0H " *u@* `' ' 4' ''#  @{2  ^# 2 *@ +  &@   t> א   L`#0D! @'' "`L# MbЀ 2' '@# $ (X # (2 DH #    2   *@j@!` "@    " @['@  `a @L #Ԁ`  DcԘܚH`,!*` €   )4"? Dج `@'@   Ȁ`  ="`L <"`L" L? !  b@q #Ё㿘! #  j?   $#"#""́㿘 8 㿘 @? @$㿐 R?@qĐ`0`  `@@"$`0 $`0T` $` $`` 3\@n `ۨ  ?۠`2  `C  $`4` $`$`$@2(" $`4` $@ $` "$` $`$`@n ~~~~~~ ,8DP\ht(4@LXdp|,8DP\htD44D$DDD4hDt\t4(44444444444444444444444444444444444444444444444444444444444444444444488tttt@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@㿘` *` €1 b#1 b#1 b#1 c 1 c 1 c~ 1 c{ 1 cx 1 cu 01 cr 81 co @1 cl H1 ci P1 cf X1 cc `1 c` h1 c] p1 cZ x1 cW 1 cT 1 cQ 1 bN#1 cK 1 cH 1 cE 1 cB 1 c? 1 c< 1 c9 1 c6 1 c3 1 c0!1 c-!1 c*!1 c'!1 c$! 1 c!!01 c!81 c!@1 c!H1 c!P1 c!X1 c!`1 c !h1 c !x1  c @T  㿘`+# *` €1 c*!1 c'!1 c$!1 c!!1 c!1 c!1 c!1 c!1 c!1 c!1 c !1 c !1  c @TO  㿘 a "" !`C    ! c\a@Q !`  @c @  @* 2  &!`  !`?` '`@ * '@ @ 㿘 @a㿘 ca@QE   !# c " @>@Q5b2 `?`&`@ * &@@f 㻀 ! a' ""0  2`@?i`  ( ``" ` `2`   #8 `<#x+`   cb@P`& * & @$` ("`?`&@ ; ;* &@ ` ""@` cb@@P2`` cbP@P$ cbX@P" cb`@P! cbh@P  cbp@P @ cbx@P  cb@P  cb@P` !"`  cb@P} !?# cb @Pu  cb@Pp  c b@Pj` +" ?`& * & @  t@`  "? cb@PH? g@- c+ c) c`  @@P9耤@8 c`   @ @ $ @ `u@n c`  " `@-* @2 @P b`@8[ c`   @* @2 @O#` ` "? ?`&* & @&?<`@0 c #?c#\  1 '@ c # #\ @# @ c #8#\     c  c@OcP c@Och  c@l,#㿘w"㻈 a' @ $ O ?`&@ .* &@  .@a  c@k#㿘ǔ"㿘@  & @oG J?`."  c '  @0_c㻈 !' ֘$  @sa  c@k#?c ! a' ""'    @  "!   $ @A@ *  2 @ *  2 @  @ !`*  2 `d"!` cc@NԔ!`   ! c@ɐ! c@Nǒ#@#@N`e1#d*` €``2-%? @mٔ   '@ߒ#2'@   @ *  c2 cȔ ` @N?`&@   c#@ƒ9 6:5% c@2耢  \?`&@ \* &@ ?` &@  * & @ `*?`&@ " "* &@ nM H c@p6:5% c@2耢  \?`&@ \* &@ H?` &@  * & @ 3`*?`&@x "q " 2W c@&# cc@MԐM?`&@  * &@  L ?`&@  * &@ o  d@ @  d @M`(@ @  d@M`@@ @  d@M`X@ @  d`p@Mu@ @۰  d`@Mj@ * 2  d`@M`u @ v* 2  d`@MV   ?`X&@6UX  c#@9 6:5% c@1耢  \?`&@ \* &@ a?` &@  * & @ L`*?`&@ " "?`&@  * &@ )] "?`&@ "* &@ 9 6:5% c@1=耢  \?`&@ \* &@ ?` &@  * & @ `* "?`&@ "* &@ ɒ ?`&@ * &@  ? @ߒ#?  .@ Ւ#?` @ ̒#@ m * @ h4 * 2  d @LF`! d @L>  @L6   @L.C@ D * @ ?4` * @ :4 * 2  d `@L,?`&@  * &@ Fʔ  ?`&@  * &@ . 2`u ?`&@  * &@ @G 2E@  d`@KÐ;  8!? @j  ' @$֤  d`Д@K  * ' d ``@ "@ ?`&@ * &@ Œ,`*?`&@ ) )* &@ ?`&@&  * &@ @ o* 2  d @KN` d `@KH d` @KB?aH ✒$@g @+ d1 d`?2@K+!L?`&@  * & @ Y`@倌`?ya@ )*  @2 ! c@K" d `@K@  da @J@ "  d`@J @ @  d@JޒaH@@ "@J֐@* 2  d@JΒaP ?aH ✒$@ @"+ d1 d`?2@J!L?`&@  * & @`@倌`?a@J da@J@g daX@J?`& * & @& da`@Jr   d@f! 㿘    @ 2 2 &   2 2&㿘   2 2&   21  c!@Lے 2&!㿘   2 2&   21  c!(@L 2&!(㿘 d" 㿘 d! 㿘@"K1 f"?1 f671 fO1 81 f21 fF1 11 fA1 61 f.1 f(1 f41 '1 f/1 '1 f!1 f%1 1 f1 1 f"! !!!(!0!@!H!P!X!`!h !x !! f!@@LC (!@㿘  1  f!ha@* (!hX <  <Q < <J   !h` (`$ f! f! f@L !h$ 6r n` , d$ f! f! fȐ@K!h$ 6T P  ` , C $ f! f! fؐ@K͖!h$ 63 /` `25!h22!h 2/!h`  , `$ f! f! f@K!h$   !h  .a*a , , ?,㿘  2     ؑ* 1 jR d d f!@Kl !㿘    L* ?К  L?  bl   ` +` .*+` L? bl   ` +`L Б*L ? *  bl   ` +`LЖ +` *  ؑ*   ```@:`ؑ,` 4 * $ 㿘 l    N(кN /` lN 2.8 l  lN(ЂN (` lN 2.8 l v lN(ЈN ) N.A N l 2 N?Ѕ/ N( ( l  NЅ(N(  l  N?и lN  lN 2(82)ȇ(/` (. (. ( (/` (( (( (1 &(& (82 ( &@ &@&@ lN " lN 2#㿈''@g ' @  / /   /逢`  2 쀢 2    J@ - +`'?J@ +4`'4444 4,`J@*`А @ 'J? bl   ` J@ .2-,``'J`? bl   ` J@`?', J@ *  bl   ` ?J  ',`@*`@*`@&% bl 'J?   `   4 4 4 'J?  bl   `  :b.` bl/'J?   `    "l'J `  `  :4.`c bl/'J?   `    "l'J `  `  :.`5/.`.@.` .`.`.`.`.`.`.`.` .` .` .` .` .`㿘@ H'L &% f@Hr0    *` +` @ * @@  @  *` +` @ * @@  @  +` * @ *`@ @ @  / /ސ" ??ڐ!@  N S/ /X#V#X <'O <X <H <  W/  E/X#8#X <1 <X <* < dX d"l @#+ "ae@# "a^@# "a f#`#\#tL#d;h#p;x0###@Gΐa a̐aaƐa@㿘@e   L ." `@ &L L * 2?J?`.2 㿀'@1 gl   #\ f#`!#d p @G~㿈`B  f"   `2`*3  *2  `? /// ///ꀢ`?/@j??@j@j`?@jT` . . . .Ğ`? ///@ * `@    2`*  2+ 2  //逢`?/@j[ ?@jV?@@jQ f" `. . = . =..?㿘 H " @( e "`   `9N +`3N@R"@* .@*  `I"@@: .@@**`  ` `9"@@: .@@**`   @+"@@ .@` N  bl   ` `2N= f=B N     ; 86? "l     ` `2N=2"?N  "l   ` "?N ` @ ?0?㿘?   @`G  .&`)?0C@ @??(@`@.` , \ . \2 (@@:)?(@`(@`<   !`?( `@ &  ? ` (@!㿘@    @ 2`  `B ?@x  ;:,*`" 7*  ?@$@`$@ .񀦠\  ,  $ "? >*@*,2$? $     ? " ?` l `  ` *`P 㿘D`4 ` "' 8?, ., \" Ȑ  < ` "&`."  `?*  @ `Ц &*?J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿘N * N  .   㿘N  % ߀ ] `.`\ " N`  ߀ ] `.`. J߀](J    ( ( (*`  2 *`*@2 2 2 *`*@*`*` (P㿘`` &`` 2 @@[   "`L&?@``"  @_ ? `@?&`*@``&@`  @^ ? ! a'  "" a  " $h  ' ''| & 2 & 2 "&  5 .6. &@^Sd<*@ 'x &d g`&  @"g&`zS# g A% g g@A ;`@"X!N` '&DH" \ "NN` ` `.  $  '| N`` 쀢` NN    2 .$a@# ' gxa @" /h't#d@] g, a(@%c .O S ga0@  ( gO  #a@2CN "  " N 5 3`!@!ې g@%3a8 2.&'|a@@_  2@ gO  : gx@]k x  N    L y b f*  , `L y b f *` "`Ӱ aH@  T gO  OaP`2N "  " N À `!@!i@$ 2.N` &DH \N  `. " $   N    N   2 .$ '|aP@  2z gO  2t gp gN "  " N j h gJ ? bl   ` "*  ??  ??''!`  5@Bv' .` 2)``*@\ !*`@fF ` *`@\  *`" " " " ' "@ ah@ B   gO   ; N "  " N 퀢 뀢 ;bl `@ `  `2N N`  g@#ѐ 2NN`;瀢`N.@ Q/ h"   g`@# 0l.  bl `@ `  ` * N``;`퀢*: .@ʒ $@@@{' $@@@u'l"@  *` % @% @^%  @] X / @*` "  ####Ƞ@## ̠###.  bl `@ `  `  N``;`퀢*: & ./ @5 @  ?    4,, *,``  .ax@ L   O   ga@m@!t 4& d **` &d@6N` |@  |@" .  `@!|#`N`  &DH&H  PN  .Nd`2N @" . $ `$wN   & g@>ې!  g@a & !  g@Z! 㿐 a  "1"N x#' g% g*`:   gN "  " a@   ' @" MJK? bl   ` @ :+ad* < 0$ad@   *@    g`aȐ@ x  g`$aؐ@ n  g` (a@ d  2N` $`N   2 N  0 ???㿘 @" 㿘  ` )' 㿈  ?'  @XΚ ?? 4\Ք㿐@ ?㿈 "l, : ?   `  0   N x X    "l, :  ?   `   ,  ?Г:` ":  ?   `D , :  ?*   `  : . 􀤀E $ =? bl   ` < $:` `24"*` €?#!耢 * #?#耢 쀢`* *`  耢 쀢`*   *` * `2&@ 㿘    @  @G /"`L?㿐N  / (  g"0@  " @* @*`@ $2,@  ,@ .2 `,@ N ް   .@.`.`.` 㿀 !' @bԔ N :   N :"Nt L N  `E ?# g"@@   g"X@   ",߮ )N`:`.`2H N ΐ ˑ4, ,   6  @2h  ,!N`   8! 4, , `$   ? % **  @X  !  g@XD"p㿀@[' ?''@TJ ? * ``    Pd d`"  'L  ( " a  @   d'L% (( ` (@  @?` !' #tj  N : /@Œ / 2  gc@ 2  N /@ .   2N g# ""?N :" N /`?% g#`"?@[@[ #$@9 gcД$@$@@ . 2 _Ғ  2?3< ?? Qb 2ٰ?D`A`>`&@;` &`8`$&`5`(@`, 2&` ` 4?` ar4?``24? 2? 2?*@ +`*` `  @? *  $@ $ @&? 6``, & ` `` 6`e @*` Y`` & @` 6` gL֐`& @` E&  @``@& ` @4Y?`  `   #L@ @*`   `#L@*@ 6`!L@&`& @ ` ` gL" "` L@` "` ?` `  gL" "`L@` "`?` ` !  g@V#؁JJ Ѐ ,-+2  " JЀ   ((+ Ї8   JЀ  & "@ 㿐 ܖ $* "@*`@*`&@N :  ˖ ; *@" * @&@N :   < 2@  &@㿘N -   + ’   @ &@㿘N J M &@`* !?В &@ `   "0 N .  ` w  "$ N . `      &@` !ma 2N  / v` &`㿘 ` Ln d 2  Lh! 2  "  ""   * * "@*`" *{ ;xT!u* * "@*`" *k ?- @ g#*`@ ?* @*`" *" *  L    &@ d dL,`@*`@*`  :@``: @.`"@K  &`@ ,` +`- @* *` g   `& +` * "*"@ *` X '@X!'$4?L 0ݒĠ +? h H 2&@L 'i$ (?L  , ;  2L?Đ1'L 2L` h XL , ;j  ࠒ "?L , Ȑ "?L 2?Đ     &`&`&gL&gP&g` &gT&gd&gh`eب '9 h ĔՐϔ$ $@$@,`$@ ,,`$@ ,`  @ K, d 2  K&! . .*@ *`" *" * Ȩw&` 2?  `@e gP* *  ``gL   eؔgPgL@@6  * * ``  @1 eĄgPg\gXgL` * *  `(  `2*" %% #* * ` ``@ۘ Ė   &gL&g`&gd&`&gP&gT &gh  &`&gL &`&gP&gT&` &` ` "8?#L@@ @@y  㿘! g# # 㿘 `h ?"`h!  ؒ! !㿘! C \A \㿘 h@7̐ h # ۞`h  #h@ 5@W !@ $`h #h@,!L 2#  "  g"T"""P"L c@"0a L :aO aM㿘!  \ \㿐 !``'`  % gP@ *`` e% `    * 6 @* , 'L@@@k &  #L@@ d*" &(㿘!  \f  \㿘  `p l , " 㿘# `` `l !  "`l |`` @,`  P #&(㿘 ߔ㿘  `p | ,` " 㿘! ǔ p p㿘  ? D+ h!L!P +  2.   4  ?*      ?+    @2   @     @??ɑ+ %TI&@ T T!  ?"  `.&H. <& <H&`H  & &0'!m`&* @*`@*`@ <  do$k! <  d`$\!$$@`Ѧ`@ H d 2  H! ,  , @ , @ g#*`@&&&@`*``*`&$@ @ 6`&$& & 㿘̐@h@ "  2`㿘@ &88@"&@`` ` ` `@ ('P&@ `'H`'L'` '`'`'`'`'` '`$'`('' ' < K?В < C?  <?ܨ 4?'l .?Ԁ )!n' hw? "ؤ  ܤ  @ Gؒ d 2  GҒ! ,  , @@ `'Ԁ!n(+ hؤ  ܤ  `@ G d 2  G! ,  , $@ 'Ԑ2  Ԁ!nݢ' g"@ 'Ԁ  ''ؐ   ̰?ؤܣ*   G d 2  G~! ,  , * @Ԁ@ؒȶ 8 ?Ȁ`;8''l'4'?ŀ ?' ;'w''Ƞ 'IH!@  ! ? |,* gPP耢@2-? (, * 'LL@耢@ " L'Hǒ 2?耢@?전?줄Ϩ?C?LH  4? `?' *"@' *@'耢` ;  @' 2?'LH P"@?㿘   㿐  & `" K && ;!@  ! ? :-`* PP @2-? (,* @  L`?"@  && `2 "@  " `?&& ޢ쪅Ϩ??㿘! 1 \; a) \㿘?" 㿘;& b 㿘;& b  L*` 㿘'DDD&㿐'DސDD@'ِD"@@ `'D&@ &􀢀 ?0'D&@ 4􀢀  㿈  h * h@  p@  * h  h@  @  h 'l #\ #` #d#h@5'  㿘  `   " ǐ㿘N@ `@R\N    2N@ 2N?2J@ "J`  2J@ ?Ѐ 8?Ʌ(8㿘 `Y @:W% ' `.I`+G`/E`@ . ..EMAKEDEVFconsoleGklog`Hbpf0`I ttyJnull`Kzero`Lstdin`Mstdout`Nstderr`O memPkmem`Qksyms`Rdrum`Seeprom`Topenprom@Ufd0a`Vfd0b`Wfd0c`Xrfd0a`Yrfd0b`Zrfd0c`[sd0a`\rsd0a`]sd0b`^rsd0b`_sd0c``rsd0c`asd0d`brsd0d`csd0e`drsd0e`esd0f`frsd0f`gsd0g`hrsd0g`isd0h`jrsd0h`ksd0i`lrsd0i`msd0j`nrsd0j`osd0k`prsd0k`qsd0l`rrsd0l`ssd0m`trsd0m`usd0n`vrsd0n`wsd0o`xrsd0o`ysd0p`zrsd0p`{sd1a`|rsd1a`}sd1b`~rsd1b`sd1c`rsd1c`sd1d`rsd1d`A . ..B tmpC db8runB .A ..D tmpC .A..@ . ..EMAKEDEVFconsoleGklog`Hbpf0`I ttyJnull`Kzero`Lstdin`Mstdout`Nstderr`O memPkmem`Qksyms`Rdrum`Seeprom`Topenprom@Ufd0a`Vfd0b`Wfd0c`Xrfd0a`Yrfd0b`Zrfd0c`[sd0a`\rsd0a`]sd0b`^rsd0b`_sd0c``rsd0c`asd0d`brsd0d`csd0e`drsd0e`esd0f`frsd0f`gsd0g`hrsd0g`isd0h`jrsd0h`ksd0i`lrsd0i`msd0j`nrsd0j`osd0k`prsd0k`qsd0l`rrsd0l`ssd0m`trsd0m`usd0n`vrsd0n`wsd0o`xrsd0o`ysd0p`zrsd0p`{sd1a`|rsd1a`}sd1b`~rsd1b`sd1c`rsd1c`sd1d`rsd1d`sd1e`rsd1e`sd1f`rsd1f`sd1g`rsd1g`sd1h`rsd1h`sd1i`rsd1i`sd1j`rsd1j`sd1k`rsd1k`sd1l`rsd1l`sd1m`rsd1m`sd1n`rsd1n`sd1o`rsd1o`sd1p`rsd1p`sd2a`rsd2a`sd2b`rsd2b`sd2c`rsd2c`sd2d`rsd2d`sd2e`rsd2e`sd2f`rsd2f`sd2g`rsd2g`sd2h`rsd2h`sd2i`rsd2i`sd2j`rsd2j`sd2k`rsd2k`sd2l`rsd2l`sd2mrsd2m`sd2n`rsd2n`sd2o`rsd2o`sd2p`rsd2p`rd0a`rrd0a`rd0c`rrd0c`cd0a`rcd0a`cd0c`rcd0c`random`srandomurandom prandom arandom#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 RMlist="$RMlist $1$2? r$1$2?" [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 M r$1$2$d c $4 $(($n+$count)) 640 let count=count+1 done MKlist="$MKlist;chown root:operator $1$2? r$1$2?" } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist="rm -f" MKlist=":" mkl() { [ "${mklist[$1]}" ] && { mklist[$1]="${mklist[$1]};mknod -m $1 $2 $3 $4 $5" } || { mklist[$1]="mknod -m $1 $2 $3 $4 $5" modes="$modes $1" } } M() { RMlist="$RMlist $1" mkl ${5-666} $1 $2 $3 $4 mklist="$mklist $1" G=${6:-wheel} [ "$7" ] && { MKlist="$MKlist;chown $7:$G $1" } || { case $G in wheel)g=0;;kmem)g=2;;operator)g=5;;tty)g=4;;dialer)g=117;;_lkm)g=61;; esac [ "${grplist[$g]}" ] && { grplist[$g]="${grplist[$g]} $1" } || { groups="$groups $g" grplist[$g]="chgrp $G $1" } } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std random bpf0 R fd0 sd0 sd1 sd2 rd0 cd0 ;; std) M console c 0 0 600 M tty c 2 0 M mem c 3 0 640 kmem M kmem c 3 1 640 kmem M null c 3 2 M zero c 3 12 M stdin c 24 0 M stdout c 24 1 M stderr c 24 2 M ksyms c 122 0 640 kmem M drum c 7 0 640 kmem M klog c 16 0 600 M eeprom c 3 11 640 kmem M openprom c 70 0 640 kmem ;; xfs*) M xfs$U c 51 $U 600 ;; uk*) M uk$U c 120 $U 640 operator ;; tun*) M tun$U c 111 $U 600 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 121 $(($U*16)) 640 operator M nss$U c 121 $(($(($U*16))+1)) 640 operator M enss$U c 121 $(($(($U*16))+3)) 640 operator RMlist="$RMlist scan$U" MKlist="$MKlist;umask 77;ln -s ss$U scan$U" ;; ses*) M ses$U c 124 $U 640 operator ;; spif*) case $U in 0) offset=0 nam=j;; 1) offset=16 nam=k;; 2) offset=32 nam=l;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 8 ] do name=${nam}`hex $n` M tty$name c 102 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 103 $(($offset+0)) 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 119 $n 644 n=$(($n+1)) done ;; pf*) M pf c 59 0 600 ;; magma*) case $U in 0) offset=0 nam=m;; 1) offset=16 nam=n;; 2) offset=32 nam=o;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 16 ] do name=${nam}`hex $n` M tty$name c 100 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 101 $(($offset+0)) 600 M bpp${nam}1 c 101 $(($offset+1)) 600 ;; openprom) M openprom c 70 0 ;; lkm) M lkm c 112 0 640 _lkm ;; fd) RMlist="mkdir -p fd;$RMlist" n=0 while [ $n -lt 64 ];do M fd/$n c 24 $n;n=$(($n+1));done MKlist="$MKlist;chmod 555 fd" ;; bpp*) M bpp$U c 104 $U 600 ;; bpf*) M bpf$U c 105 $U 600 ;; audio*) M sound$U c 69 $U M mixer$U c 69 $(($U+16)) M audio$U c 69 $(($U+128)) M audioctl$U c 69 $(($U+192)) MKlist="$MKlist;[ -e audio ] || ln -s audio$U audio" MKlist="$MKlist;[ -e mixer ] || ln -s mixer$U mixer" MKlist="$MKlist;[ -e sound ] || ln -s sound$U sound" MKlist="$MKlist;[ -e audioctl ] || ln -s audioctl$U audioctl" ;; wsmouse*) M wsmouse$U c 80 $U 600 ;; wsmux|wsmouse|wskbd) M wsmouse c 81 0 600 M wskbd c 81 1 600 ;; wskbd*) M wskbd$U c 79 $U 600 ;; tty[C-F]*) U=${i##tty[C-F]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; esac case $U in [0-9a-f]) M tty$n$U c 78 $(( 16#$U + $m )) 600;; cfg) M tty${n}cfg c 78 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyFcfg ttyF0 ttyF1 ttyF2 ttyF3 ttyF4 ttyF5 R ttyF6 ttyF7 ttyF8 ttyF9 ttyFa ttyFb ttyEcfg ttyE0 ttyE1 R ttyE2 ttyE3 ttyE4 ttyE5 ttyE6 ttyE7 ttyE8 ttyE9 ttyEa ttyEb R ttyDcfg ttyD0 ttyD1 ttyD2 ttyD3 ttyD4 ttyD5 ttyD6 ttyD7 R ttyD8 ttyD9 ttyDa ttyDb ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 R ttyC4 ttyC5 ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A tbl p q r s t u v w x y z P Q R S T name=${tbl[$U]} n=0 while [ $n -lt 16 ] do nam=$name$(hex $n) off=$(($U*16)) M tty$nam c 20 $(($off+$n)) M pty$nam c 21 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 125 0 666 ;; tty[a-z]) u=${i#tty*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown tty device $i ;; esac M tty$u c 12 $n 660 dialer uucp ;; cua[a-z]) u=${i#cua*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown cua device $i ;; esac M cua$u c 12 $(($n+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 11 $n 660 operator M ${pre}rst$U c 18 $n 660 operator n=$(($n+1)) done ;; ch*) M ch$U c 19 $U 660 operator ;; vnd*) dodisk vnd $U 8 110 $U 0 dodisk svnd $U 8 110 $U 2048 ;; rd*) dodisk2 rd $U 17 106 $U 0 ;; fd*) typnam=$U${i#fd[01]*} case $typnam in 0|1) typnum=0;; # no type specified, assume A *A) typnum=0; typnam=0;; *B) typnum=1;; *C) typnum=2;; *D) typnum=3;; *E) typnum=4;; *F) typnum=5;; *G) typnum=6;; *H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $U in 0|1) blk=16; chr=54;; *) echo bad unit $U for $i; exit 1;; esac nam=fd${typnam} n=$(($(($U*128))+$(($typnum*16)))) M ${nam}a b $blk $n 640 operator M ${nam}b b $blk $(($n+1)) 640 operator M ${nam}c b $blk $(($n+2)) 640 operator M r${nam}a c $chr $n 640 operator M r${nam}b c $chr $(($n+1)) 640 operator M r${nam}c c $chr $(($n+2)) 640 operator ;; cd*) dodisk2 cd $U 18 58 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R presto0 bpp0 ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 R sd1 sd2 sd3 sd4 cd0 cd1 rd0 xy0 xy1 xy2 xy3 tun0 tun1 tun2 R tun3 bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 R pty1 pty2 fd1 fd1B fd1C fd1D fd1E fd1F fd1G fd1H fd0 fd0B R fd0C fd0D fd0E fd0F fd0G fd0H xfs0 ss0 ss1 ch0 ses0 cuaa R cuab cuac cuad ttya ttyb ttyc ttyd ptm local wscons audio0 R uk0 random lkm pf systrace xd0 xd1 xd2 xd3 raid0 raid1 raid2 R raid3 std st0 st1 fd ;; presto*|xd*|xy*|sd*|raid*|ccd*) case $i in presto*) dodisk presto $U 26 25 $U 0;; xd*) dodisk xd $U 10 42 $U 0;; xy*) dodisk xy $U 3 9 $U 0;; sd*) dodisk sd $U 7 17 $U 0;; raid*) dodisk raid $U 25 123 $U 0;; ccd*) dodisk ccd $U 9 23 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" list="$RMlist" for mode in $modes; do list="$list;${mklist[$mode]}" done for group in $groups; do list="$list;${grplist[$group]}" done list="$list;$MKlist" if [ "$eo" = "echo" ]; then $eo "$list" else echo "$list" | sh fi  (@haB   @@haB,C( @@=@@<@`dT U@haL@@?(0pLl @A @haL3B@haLv@haLv  A@haC X@haC X@haC X NC@haC X@haH.}@haH.} EA@haC X@haC X@haC X B@haH.}@haH.}@haH.}/tmpY@haL#*@haH8C@haH8C8I!@haJ'V@haJ'V@haJ'VCM!@haJ'c@haJ'c@haJ'cGԳ!@haJ(@haJ(@haJ(is!@haJ)'@haJ)'@haJ)'޷!@haJ*Q@haJ*Q@haJ*Q!@haJ*T@haJ*T@haJ*T .!@haJ+@haJ+@haJ+0!@haJ,@haJ,@haJ,\!@haJ-L@haJ-L@haJ-Lu!@haJ-D@haJ-D@haLt!@haJ/q@haJ/q@haLtH^l!@haJ/@haJ/@haLtz<"!@haJ0G@haJ0G@haLt !@haJ05@haJ05@haLt ?W!@haJ2b@haJ2b@haLtFw](oa@haJ2@haJ2@haL%w'a@haJ3B@haJ3B@haL ?#a@haJ3%@haJ3%@haL&-C!@haJ5 R@haJ5 R@haL6T3R!@haJ5@haJ5@haL6_!@haJ6=@haJ6=@haL6a@haJ7n@haJ7n@haL(r`!@haJ8C@haJ8C@haL(;a@haJ8ـ@haJ8ـ@haL(jc!@haJ98p@haJ98p@haL(ba@haJ:i@haJ:i@haL(S`!@haJ;3@haJ;3@haL(O_a@haK@haK@haL(id!@haK@haK@haL(6la@haKÀ@haKÀ@haL(Ri!@haKbZ@haKbZ@haL(MKa@haK@haK@haL(p!@haK,@haK,@haL(ІIa@haKĴ@haKĴ@haL(_!@haK]J@haK]J@haL(ma@haKw@haKw@haL( Oh!@haK'@haK'@haL(vݗa@haK@haK@haL(d%~!@haKX;@haKX;@haL( a@haK h@haK h@haL( x!S!@haK !@haK !@haL( ea@haK @haK @haL(  !@haK S+@haK S+@haL( a@haK X@haK X@haL( !@haK @haK @haL( نa@haK @haK @haL( sE!@haK沀@haK沀@haL( ^a@haKI@haKI@haL( t5!@haK߀@haK߀@haL( .a@haKv@haKv@haL(-!@haK@haK@haL([a@haKz9@haKz9@haL(T!@haK@haK@haL(wYa@haKf@haKf@haL UI#!@haKܓ@haKܓ@haL!`cma@haKu*@haKu*@haL UR!@haK @haK @haL!`Oa@haK>@haK>@haL UtJ l@  `  x*  R  ?l  `D `", Đ  ۰  x*  R  l@  `D "  ,  .@`` ` @ `.   4  6%* . @ 0 07( @ ` 07(*& @*  x(P㿈' `1 ` h#\ `#`@4+ #㿘    @  @1 /"`L x !  h p '#\@4    "`L @na  h@Mϐ#0 !  '????  4 :`*`$*`#@ * * # ?''  ?,` ?'' ' ?@$'''', ?@''? ?'P ?# :/ h @ 2: :Z ,2 :Q ,, ,  , , @$ 7 @P@$@3A㐀 #6(   @    @ :,  ",  "`L @!  h@L#   h      @ ` " h @ @ @`  @ # 2 @ 㿐 J#` @    #&@O#`?㿘 &J#` # @ ! # #& 㿈  ?'  @K] ?? 2J  J@ `2J 㿐b "h @  c؀        6 2 E  Dc$$ $ $ $ $  $ $$c  " \$  U$ ' &$ " $  G $$  $ @L$  @L    @^   0 @ T $   "`  $ 㿐! #؀  (  & #'@ H#؀ "  2 @0 2 @U 2 @$  2  X  N "g @O5 @`"` N@ "\ @O* @$'O '@@ΒĀ  F "h Ė ?'''?'''' ` #\ ` P P, П!     i`@ܒaĐ?"`h@谒 a`i'@ ' @K@@*@a@ #@āP\ `N "w @NĐ @`"p N@ "l @N @$$a '$@'@@]  V "h  ?''?'?'''' ` #\ ` P P, П     i`@jb?"`h@;ఒ !`'@ ' @Kn@@*@`$@ $ @K_@@*@@ @}@ !' i'D"h&  ? `  ? `L # DR D "l? #  ` " @Ɛ 2 `%c`$l&@D * @N  $# D@Ւ  2 2 hy l   @T l?& \& h  h 2> hD i i␒$ @0& ?"- hx L #  '''Ē '@TĒ@ D0& hD,lD("̰ ZȰ     ?   ??//'a'b  @ 2  i@ː"" 5 #    @" % "h'''' #\@POx" DЀ  "    iD"@-Wb `€ ?f& h @ `* @7 `/# 2 & H"W S   & L. H. I& P& T ` . J ` . KԔ A. L `. M `. N ` J. O6 X& h@?D "h'̑2`@:`' ` ? @& \a''b H k \ & ` i@8"& h \ a ? i@"c&%c`2&@   i@Ik#㿘 ` @?& \& `㿘z 㿘 #  @  2 ` @`$@$]0  ̝㿘1 #܀ 2#!&##܁㿈 !i ``€@p i!`@/" ! @L$ 耢`:E!ȓ*` €@ i@/h3 i i@." @ @,$ @얒  i@. i i@. i i@.ڔx  i i@.є ic. @ !0 j @.Œ 㿘  j"@,`  j j"h * 㿘  i"@+c㿘`  ,  䀢`   䀢`ې  jԐ @0 j@.~!  Ő  j@.s! ,`,`㿘ː  j"@+`  j * 㿘 @c`'  " d 2   k`(@+" `L  ""` 2@ *` 26 .,y  6#$   qR &@  Ք     L  "``"?O AK $ $$ $  $   L$  $  8`$ @-o' ''''Đ 0 @5 @ 2  P  # A `€ P$ H``H@HH b@ "|$@$$    h 'H'P\ L 0'L'T  @$ `$ T   @ 2 `   0&@$ $%`  H ``€H " $ € PL€   $  $ $@ƒ q $@’  $ $h 2@d   ` %  $ $Y % P!&@'`'`''@\'耢 F@  $ "'0<Ȁ2' @D $ $ 2&  T  $ $$ (€   $ ؐ $ $؀  &@@P $"  $  @ 2g&@ $ $"@("`,"`㿘  " L L@` `"  `"  " " "  "  "" " " "  㿘   " P@~ P `@ Lp2 ~  * $, ,  '7#6 Ю"@%  ܒ L6 "@'"`'ܐ@? ؖ"@ 'В"`'Ԑ@?В#* $, ,  $ `" & $`L(?   $L" $LL  & (& $?< 2  6 & $& (?L & $& (㿘#  ?&`L?$ $$ ( @㿀!  2  < @Oђ @ 2$ +  < '    &  b&  && &  &  & @3 (@1 @. @& <  `@㿘    ` (<   ' &&&''㿘@ϒ  ``@ !㿘@Ĕ 㿘 @` " `    ``€ @`  @`㿘@ " @   @`  @`@{` 㿘@ @m` " ` 2   ` Ⱂ`@ۘ  㿘 &`&` 2 @f @J` @\`  @W` @R`  I8*  "@ "@ "@  "@ "@"@ "`"@"`     "@ "@"`"@"`㿘    &@  "&@ @ ڒ@ &`@ "  " 0 " 0 &` &`&` &``"  " " " "    " " "   "@   "     # d? *(#d d*`  *` *`d#@ #  #"@d 0#d*@  *` *` *` "  #㿘  " $ @D  @$  㿘 @ "@$  @D}  @$    "    @ " "        " "   㿘@㾀 !'`2`!'a쀢?2`Y?@M̒     '`  '  ."`LC? '` ' ) .`*  .@ '䰒 +!Ș  $a !   L!  &$ La@  쀢 &$ L a  k@Ch!p  o6 c?c!'''#\ab7ڐ ! / #'#`Q''''' K#\P  ڀ    "` ``  ڀ 2   "` @܀?"6 =6 ځ㿘@/ @*`  @%` @ `  㿘 D   k"@&ea05@ @$ <@ $ @  $   k"@&Qa0 $   2 $    $ 8c(& & $$ $ $ $ ,$ ($ $ $ $ $$ 0$ 4㿐 4 ,0"  @&@4, ", "4@%   &@ 㿘    &  & & @- 2  & @ "㿘   4   8 2 @b 󀦠 8@: & 4"$ 4@㿘!    " 8 @B & @@$  @$ @  2  㿘`   @A  ?@  "  , ?  "  0" &㿘 ?&"   0  "    $  , 4 "  0   ( "@ $ 4$ ,    " 40 @  @  ,0 # , 4㿘  㿘 @ "  8  & 4@ 2 4   4 4 4 8 " 4& 8 㿘 @ "  8  & 4@ 2 4  4 4 4 8 " 4 0 , `?㿘`       * "@   # ? " `""㿘 ` " @? ?"   "     `$ $ 㿘 0 (  $ "  ?" & ,& 0 㿘$  0 ,     4@A ,&@& ,@㿐    2 & 8& 4  㿘`$  0 ,  @ ` 4 & ,&@  c(/  ?p !Ф' " N "  @D='$  kb ''ܠ `L@5@D/$$   k" $:$$ r   k@@"㿘  7G  0?,  7:  0,㿘 k @"X  T .  k#  @6@ # ? k` @)@ Đ@X   "`L# `L@$`L㿘?   "`L ?"  n 㿘?   = L @ @7   @.@08/`(@ @ @?@4@08/`(@р 6`6`@؆@< <i 9?2???#@   && ̐?㿘 `"@ J@ "@ 2N@@Bl  @ *@`N &*@㿘@& " @  2  @’`@`㿘@  `@   㿘@㿘@B&  @?$0 㿐/3  ?&㿘@  @` @(` 㿘@c @㿘@\ @㿘@/  @"` @`  㿘`@ܖ$㿘@ @` 㿘`@Ɩ$㿘@㿀 ' 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿘`"   `  0  `@€ 㿘`"   `  0  `@€ 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 V@ €'@€  6@  㿐`"  ` 0 @ €'@€  6@  㿐`"  ` 0 V@ €'@€  6@  㿐`"  ` 0 @ €'@€  6@  㿐N@'Ȓ  .@ 㿐@'ڒ  .@ 㿐 "    0@  @ '€@€    @ &@  㿘Ȓ㿘$ "         `2      2     `А`?㿘@l "2  2+ "   0"   _&@    o"@Ӓ`    s&@㿘`–$㿘 "   @ "  2    €㿐 @   "7 @?' -8+ `  ` 0!  2&@    o"@f` ,1&@  㿘?KKKKKKKKKKK  R4(             㿘 ` @@  ` `` @ ` @㿐@c   3  `" ` 2`22  @ @&`L   (+  2 2 " 2+J " ?㿘`6 "@"&&@;+, @<_ `"&&@;&@`", 4@ ހ" ,㿘# {a! @G  @L `  @A   20 `` @3 `@E 2` @/{eᬁ㿘  !a{]  / 㿘! "  o o!@a$"@? `"`㿘! " " @$" " 㿐 b    o o!@a $@  J?` 2'#! !@:, L@ #@\ # 2, o  "  @Za  o,@`L@L@ "` "`a@I ,@Y  J ?#* ! 2"` "`"` @&ᘠ "&$@,  "!$@L  `*`:    @$@`@ ᘠ " $@,  "$@L  $@! 㿘 H* D  @ "?& H& D 㿘 4@֐ 2F&@ @;  $&@ @ "$4 4$  @;  $@Ò D@:7$"@$@`P $@D@:&@ ئ&@D&@ 㿐@V &   K! 6  #``6 6 & $& ,& (& &    @8 㿘 @R   6 " L8 !`(` K  ? B ; > @:: @2P  @ ? 2 ?  : @ 0d < :@  d  " : @ DE      "`L2 @6Ɛ h €d `@2 T & ' 2  <   (4 ؐ$$L4 2T  Ȫ@B 2#0 @" P  @ ? : @ 0d "< :@ d0 " :@ D8<" @d  "@@d   @2'L4$L@@@D 4%@2L@%@&0$  $@"$0 $0  ?T4 L  :  @ @?2"$0` $@@"$0z $0 @ ?04 @8  @ "@$"$@92 ?@?20?0`@@"$0M $0 $ ?4 $ 㿘 ;   J   J H ? 2H  J  㿘 "l @?`  ` `2 @ - +L@  L@` 0 L@ x XL` ` 0   ) #.ax $ $   "l  / ) "J" &? ? %Le"  #?%L e  @`?   ` `?Π?   ` `?   ` `??`&@ 㿐@$    "  2 @ 2  @y   "`Lx   ?''D'''  ܘ @5      ܮ  ܘ @5 ܚq  h   2c  ^ T`  T ` ?@` ` L`D/ 2 ` @@:>  : `   * @"   ?     + "    ? 2@`2@@+ * @ ,`D "0ɐ"* x ? @@ܢ @    2  1 2  ) T %` %` @6͒ \ . %`  T@6ð T   ?@`` ?%` @6 D`%@ h`Df / 2 ` @?"Y  T`` %`` %`%`  *  @"   ?    .  @"'   ? "%` "%`" %`  @?@@6P@Ց.%@ܨ *a 䀥@ D%@"" 㿘ېJ@   J@J`  㿘 "l @?`  ` `2 @ - +L@  L@` 0 L@ x XL` ` 0  wi??r "l  - : "   "%L?? c`  @`?   ` `?ޠ?   ` `?   ` `??Ǡ4 `2&@ 㿘 I@8   @ @o@ @8zo @ @o  "`L ?Y" " " " " "   а  ? ' ' ''''''!  ! @   "  "& `& . ``& i& &`D9 ' L  @40 ?#` ` L 2``o   &  oc@ f&  @"& j j"L&  S   & x 2K5 @ o !& hlZikmh!bX!cԄX& & & & & & &  @R "'5 `  2   "` @ؔ @Ԕ !  )€??5 0  "`L5 L@`"&L-&L 㿘  `"" @ & " ( " "`L?@F: '|'d 'h'`'l't'x'p ?"@  t  'lt  |hx `'th! 'x| "'||hh a  't'l'x'd'`'|'p| ဢ@d[ "$ \ @="$?$a| $$a$at$ax$b$a J$`&& & & & & & & & aib  $b ia\]_ei `|Ԗ("\` |& & & & & & & && ` "       b  $b   $aaА`  @`?$ab  $b aВ Jޔ ?`ah `̀@wawT  •  L!b@b ?F$b \ $b X'\ T/ P/ L/\'X/ H/ / /X'T/ `/ `/ `T//'P///P'L////L'H/ / / H//L!b@   O?"@~ _2z 'pb  $b $a$bp `؀!'p"'pp@ 8'p` b  $b b $aԐ $b $bp$ad p?*  'dpd* @ *'ddaزtlt|??* 2``4aܐ 4aaЖa@ +$@b ]^ a @@3?b  $b  b  $b @b  $b     O"`L` ` "acaЀ?,&[ 㿐 @=    2 2   @  "`L+ `L 2+? "`L@ "@  `2? $4 $ $ !ڒ 4 $ !ؒ @<@  @ 0?㻈# a 'Nj 2 o@#  p  o$@?'@;q @?q @;e a  p@1  㿘  `"" @H & "  !А "`L?㿈  `@3 $   "`L'?@  ?  @@ 0#\  @ 8!Ȱ" @ @ @0@$ P" `2@0' ` ` `.' .. . .' . .  .. '... . .. 7...7  `?2 .O.* 2   ܄ؚԘБ.`2 7 **  '. ***'**** ' `* `* `**' * * **`*`2  ² 0ki* 2  e ΰȞĆ.`2 @7 **@  '  . * **' * * ** 1'****'****' `* `* `**' * * **`*`2   P" `2@0 ? ``U2 * 2  Ģ+ 2 @  '``. +``+`+``@' +@ +` +`+`` @ `@' +@ +` +`+``@'+@+`+`+`@ 7 + 2`*@ *t`Ģk* 2  f ܰ؞ԆЄ̪ʑ+ 2   '``. +``+`+``@'`+@`+``+`+`` @1`@' +@ +` +`+``@' +@ +` +`+``@'+@+`+`+``@'+@+`+`+`2  7 `+ ʒ@2*` *`' . . .'. `. `. `.'. . .  . . ' . . .7. .7. ..t#tp * d * #p* l t`*  * (` (` ph(`  #l  * (` (` l(`  #h * (` (` h(`  #d  * (` (` d(`  #` ` `* (` `(` `(`#` !' ``"b @@ $`b   "`(    `    "`L?`aܐ : (`@È? ''ؐ @8 `@8 `aܐ @+̀?Ր ''А @8ޔ @8ڔ `aܐ ΐ2 a@ @` "?(`  @Ȩ 2 @Ȩ ?  Ȁ @@!  Ȁ "b "@t?2 @@  ?`@   ?  " #\@9ϐ doᜐ,* 2 2`   , "*@8i  ,  6 "@6  2  ` &  $ ,@ `@8R`@8M`(@ @@ 2 a`@2a`  4`a䀢 2@  2  5`?2 ?@2@ $a 4a쀢 2 @`2@ $a4a$a@@  2b @ b   $b   p@- Ё㿘 @!袒 2!I&!& 6 `@`` ` " ` *7!䀢 2`` 2/*2 2`?@2' @ &  6!6 6!쀢 2* 2 @ 46!쀠 `?&&!@*  㿐  `"" @ $ "  I   B @K@   6 " =  @k /'`?2  2  @/ 2*?  @L`?2     @  ?`?@   "`L? "  $" 㿐@ @@ " @@`"g@ ,@   @ "ް ` ?2 ? =@ !?&! 2"- 2 `@@  ! "!2! @u&!@ݔ  @g @ϔ 2 @! "!2`! &!@@`2@ y@D @ "y @ i`e ,@/   @ "c   A@  !?&! 2""- 2 `@@  @ @n `!"!2`2!  &!@ @U 2@  ?@ !"!2`! &!@"`2@͔  @5&@`?㿐 @ 2z x? 2  @n`?  @P 2&` @ 2M" `?2  2 @S <?0L@ H ? 2 @ ئ ` ?2  @" ?#@Ӕ?"%    4 @  " `?2  @U  @M  ?@H ?@ ?㿘?r# @  ` - @  @ + ?"u`?2  2@@   4`!ڐ 4`H$` @ 2q?@ > "D!i?`` @ ?$ @5`?@4`*2  ?#  2*`2  `?2 "?* `+ 2  *2*` `?4`@ ̔ @! ,@&! 2@  @   @  ?@6  @ ג  㿘 (@   @  .@r 2m?.@  `` @ |` ?"^?` " `@` @ p@ ?2`P?@   ?&@ @4@6*?#2@   3*`2   ?2 "?* `+`2   *3*`  @?6 ( @ @2    2  ?6  㿈  ` ,`" `  `  #\'7 @( 2 7'@ 2 ` W,`?2 ?7'@  ` C,`2`"@ < %' 2`7@n 2 `" @  ?2 ?2('`"$'@  /?'7@M 2 ` ,`@   $@4`@  '7 `#\  @  `  ,`㿘``"`@ ݔ  `"@ i ``" @ Δ 2`? "@ X  XXP  㿈 ``"@@ : $``d#ē*` € `( @@&  "`L? @b#\a@0ab  @ @ 0$`㿐`]d#*` €     "`LL?@F    @ @ ? "7??2  "  "&@)6` @  %   * @  @  @  "??2 `" &@?2 ?6` 㿐  `  @WS @   D "" `D6` ` ` *?2`2 @5  @ m  @ Ӕ " &6`   `,`&@` 6`` ? @ O 2 @  2??2 ?6`&@ 㿐@ 2~ "[" 2s' '@   @  ' ' 7  2&  +@ @   @ k 2$@2D? @  >??2 4  4 @ @ @ ٔ  !& ?2 @2 @ ǔ `2 @ + 2$?4  & &㿘  " (-& &  (&   . (6 㿘 ,&! @  2& l  2`*`    , 2 @6 @,   "@!&P, `?, 2   +" 2$&-`    @Y 20 4 ?2 @2&  @# 2 &6  , 2!,2"!2`! &!   @ ,㿐 @ ` ' 7@Ô  @  0 @   & & & 㿐 @ k` '  ?2 ?7@  @  0 @   & & & 㿘@`* @\7    @P 2n?$`2" @@    Q "T?&& @1-&& && "B  `   @` 4?0@`2 " @"$  `  (@ ͐   2'@?  '`@`  @0  ' @'  ' 㿐    2    * @  2   * @    ' '   !@!̀ "!?'!€ `8 @  " ` `` @ @    ``@㿘` `@ؔ $ @& ?2" ?$ "" 2?" ( @@"!  " 2?@?"?p `` @ $` 2 @ |  t 2 €??"k?  @%} @2c?$ '' "آ   24$$lx䀢 G   "$$  ? ''o ` '   $$?  @%.  ? @Ȕ  ? *@$  ?㿘 ``@@ $`@0 ?"+?@@?2`$? "a$` $`a "a$a$aaȀ "ax$a$aasq8  ?㿘  ``@ޔ $ `  "`L?" `  `@? ?@ " ?$" 㿀 @& L" !ؐ!b!Ԕ " ?'''' @//@  ?㿘T    "`L+?` @%ސ `" @  &? " 0  0` @@"$ 0 $ 0 D "$ $ D$ 4 $ 㿘% p  ` 3 ? ɔ @0 `  7㿘  `@B $  @`2"  "`L)?@ " )" !€ @|  ? @> "   @@0@$ 㿐̀ Ȁ V `2B?$$'3'Ƞ `? "`@ @  "@?2,?2,` @.5@ ̀?*   !$ 㿐bK ba#a̐@ 9?D?2.a̤!!a$à &  2 $a. a`? "`@aa@  "@?׀aȀ?&''`Ő?*aȀ b  !$b 㿐bà aȀ  `2 b6?b  !1$b $a$aab'b'b$b b a* 2" b@- @ Ѡ  ဦ$b 㿐bb  b%b*'b  !$b   2 &'@Ж  ? ߰ $b  TT TT(T 㿈  `"" @͔ $ " "-" "*8T !̀ :!Ȁ  V`?"$!$!@-1!!" "@-" !'"''' (k!. € (    $!"@"  @ "@  " R   "`LM? 5" )2 "!€???" %" "" '" '"'@, " "'@( #?"`" "@  "$ $"  $"  @G p !' @ܔ܀?/ܒ ?' ' @  @Q  "@@?2 @ J?`   "@ @,`2 #\@- 4 /$,`* 2`2 @  .` "*@,=  .`  4 "@4  2   $  * @,* $ $@    p@!#㿘  `@ $  $ @`" "@@% (  " 2 $ @  $?$ $ "`L ? "  @$" 㿘@ 2@?`@ @9  @4 㿘`. @   " @& ?2I?``@ ?& @+. ``@ " @: ?6`?* c2  @ 3@*`2  ``? ? @" : ?* `+ 2 ` *3@*` `` 6`b?$b㿘@  ? ?$  @`$㿘  @" 㿘 !`  $ 2 0   " L@4 G?"  @! @? $  ?4 $   4 ` @@" <   <$ 0 $  8 &$  2 @ m@!!  $  $  ?Ȑ*@$  4 2 @ 4 4 $   X<`㿘  `"@H $ `.m#*` €@% (" ( #  $    ( " "  $?2"G " )2"!€??<?"  "`L5?" " )2 "!€ $" ـ8 @P   ( , ($ $@"   @@0@$ 㿘'L!Ā ! ' n `; &!&!!L@*J  &!& "@ @`* @   !@3!̀ 2.?&!" @"#!̲ @ !Ȁ 5`2&!? &!!Ȓ@*' !'''  㿐@) ` @)& :!  `$?&'!?@' @ 8@)˔@? "@`' 㿐` !@?@@j %? $$ $ $ 4 @4  @) $@ &ۦ@  㿐@) `@)  @` 2` ? "!@   ? @N "'`'@ @ 㿘&`!Ԓ&`"  @&!@&" 㿘!Ԁ`@'   !&@" `$" $!@ 㿘 ,&!  @  J  $@& 6 m   ?2  !*`2 @`*+@   @( !2 !&! В*2 ?@    ?*2 ?@    # @[ @V  L' ,` *`  ? *`   #  @< !?&! ` @@ ߀$L 8 # <    "`L  @(c$(  &&   ""  -&$ &$&$&$"$$"$"$ 㿘$?  q`@Ő"@'@. , $ &$@"&@" &$   *   * "" 2 "" "" " @2 &" & 㿘  *  䀢@ ""`@ "@@ & "`  @"@"`  㿘@O ?`  *  @ `"`"` ,@"@$`$@` 2@"`" "@`@` & "` ` @`"`$` $` @2 &" &  ` `T,`&"@@ 2$I K $`@$  ?  `@'   "`L$` ,`` `  `*  ,`  $@$`` 2 "`" "@$` $` @2 &" & $"`$$``` `*` *` 㿘 @ & "`  @ &"`f 2` 㿘   @f?2  ? 2 a$  ?㿘dd @*;d@"7d  2/  @A?<    *  @@  ""` @ "@ @ $`"`  @ "`, $@"2 dՐ    d@& $ , d $d 㿘$ "$$$``$`Jΐ `$@'<$ "$ ?"`$$``` .``("   2 2  㿘'L'P'T'X@ɔL㿐@5  4  ``  @  "`L  " 3  `!3 #``3 # $# ,# (#  # Jr  wa           &  " L J+b  J +    "@  4 8 / #8#8*"@ J=2#8"  J JJ 2 J=ې    㿐ƒ㿐@3 ?㿐 @' ?㿘  @  㿘  @   㿘8`  "`LL 2 $?  "`L\L`X/  0,\ɒ ? L X `L X`?#@  X 4GA,? `L X` ``%<'+  L/2?,a _, `X%`L8L`*!  &@K , A, a,  L`< " !   L`.   `L $`? a L` `Z" , l `@ `  `ő*:  z p  n  %'' ! ` ,`'l  l @ ?`[ $"? .` `.   _ @.  ` , ,  . @㿘 !`  ᬐ *@? #!**ᬁ㿘 !`  aa? *a ` `,  @, ` - - ,㿘 !` [ b  ᬞᬐ (ᬖ   ` + *  *ᬔ  (ᬄ ,   ` + *  *ᬔ  (ᬢ +` +  *  *ᬘ (ᬔ ( + *  *   *  *  + @+ ` 㿐#\#`  @%E  @'P'T`'X#?"77'P`''''@`*pٌٔژڐڤݘݘ܌ݘݘݘܔܜ8ܸ|||||||||||,@|Th|||||||D dLT $$\`㿘` @e&`&`&` 8 a    ? ,$ 7'''7'''''@ @ 2? @  @4   q@!㼀 !'H'@' ` ` 2 ` @#   "`L/?`   HW` H!H4''0 ''P'X'T'' @  4 %'' $$XT@ 'X 'TiP '   '''?/J@`'?`Xt#*` €O  /  L ?Ѐ 0, L** ?Г:`  L $ 0  '0H0@,0 .' '.'  '  +/J  *?'L ? 0, L** ?Г:`  L $ 0  '0H0@k,0 .'.?&g?f?Ѐ  , * ?РJ@`?Ѐ ' $?&S?R?K  , * ?РJ?Ѐ ' $2?'0 7'0H0@,/, * @J l2% '! 0`.@/   ''0 @ `.@*  : `.@:  6q  -/`k ? g   G  "  0`.@''?`".@''?@  q"  q -/ q! @  q! (#`!#\'@8 g G  ?@$ g g E e e f' `@s'( @ (`  O'`@ @  O'``4  $@ O' D  -A/  0`.@:`:  `.@ " @ 0`.@2`.@"   'x'|x 0 @ `.@  `.@  0`.@ qa '  q x0`.@ q!   @f "@$/@   'p'tp 0 @ `.@  `.@ /  q! q!  ''h'lh  0 @ `.@  `.@   2 / '?쀔`S "  7 qF!ب  4`,  `4 0 , 806 03,  @ `0, 0  ` `0, , 4`  ` 4  ,@  %@ / / @''O `' '􀥠4O" . 3 ax $$XT` 'X 'TDP ? ax$$XT@ 'X 'T.P O   $$XT`  0//  $$XT` 'X 'T P 4" . -  $$XT` 'X 'TP e? 4$$$XT@ 'X 'T֒P O" - -  $$XT` 'X 'TP 5? 4$$$XT@ 'X 'TP ! e$$XT@ F q BV  q! $$XT` 'X 'TP  (@  $ $XT` 'X 'TfP ߤ(?  -  $$XT` 'X 'TLP Ť? 4$$$XT@^ ``( q! $$XT` 'X 'T(P $ $XT` 'X 'TP   - -  $$XT` 'X 'TP u? 4$$$XT@ 'X 'TP _$($XT(@R$($XT( @ 'X 'TɒP B ("@ - -  $$XT` 'X 'TP '? 4$$$XT@ 'X 'TP   q" $$XT`  $XT  @ 'X 'TyP    q" $$XT` 'X 'TcP ܤ$ (" $( X" T@ t ( 4 R   .//  $$XT` 'X 'T6P  q B($(?$XT( .@ ? 4 -  $$XT` 'X 'T P ? 4$$$XT@$$XT` 'X 'TP f`$$XT @ 'X 'TْP R 1" , 3 ax $$XT` 'X 'TP 5? 4$ax$$XT`'X`'TP !0 & 'X P 0'TX P 0'T0耢,v4 '0` @?   q@o" ! ?X'/*`\ * \ *`\ * \*`\* \*`N%2   N `Xu!4*` €N ?X %L* @ L*`ДЀ @LN*6 N ?X  L* @ L*`ДЀ @L $@  @ \@X\ *@`@4 \@ X\ *@`@4NЀ NЀ   +  * ?И NЀ  $ @ X@\@ڒX\ *@`@4qpN X@\@ȒX\ *@`@4_^N@\@X\ *@`@4ONN@X@\@X\ *@`@4>=N@\@X\ *@`@40/NX@\@X\ *@`@4N@\@zX\ *@`@4N X@\@iX\ *@`@4N@\@YX\ *@`@4N@X@\@HX\ *@`@4ߦN@\@:X\ *@`@4ѦN X@\@(X\ *@`@4N@\@X\ *@`@4N@X@\@X\ *@`@4N@\@X\ *@`@4NX@\@X\ *@`@4NX@\@ےX\ *@`@4rqN X@\@ɒX\ *@`@4`_N@\@X\ *@`@4PON@X@\@X\ *@`@4?>N@\@X\ *@`@410N X@\@X\ *@`@4 N@\@yX\ *@`@4N@X@\@hX\ *@`@4N@\@ZX\ *@`@4N2N* &#\   @i?& )\+ " \ `u *` €`@?``@? ``@?``@?`` $\ !s'\!  q@" 㿐@ *  #\  @?&@@|#\ ? @  @@s@& @  @͔$@ &@㿀?"\ f#   e E   q"8 9/ -/?#\  ?@耤 g G f# fJ 02 @ qb8 B  '@@ q"8 B3'@   0`*@@ '`" "@ X !'`, -,   +,  쀦`   0.P ` `0..    0. `0. &  q@-"@00HtLx㿘 ".  ` @ " ,, z  "`"`"`"`   `⼅("@ 㿘? #  = @=4`4  *  $ 2  ,   * @M ː, " & 㿘 P  *`   "`"``   N      &N    ?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘&  " " 㿀 `@6  `  ` . ' , `,`% *%@  ''@ L@ @`'?c '? c< @  < 4`4 444 4  $@? #; 4 4;4 @   4 $@  $'  "' 㿘`  !*  >``#! "```"q$" $@ 2^$@"`" >`U>``2@㿘>`@ *  Z `` "? * ` " * " 2@ ` " " ?& C`(` " ?8 㿘     H     ` * `@ (? # @  "  22: "  33 ` :`@  ?# @  : 2`@ 33  :`  ? 2 ?   ?0  :  4?8      ( ;``"##㿐  * ? " &@ " 4  ? "@ ,2   ? " 3 ,  ? " 4+ @ ?"#㿐T ?. . 6  `''`'   " *@ $ 2 '$   $   $ ΐ $ $   ` 5͐@& "@ Γ. @&. "@&㿐v? o ?`  " * " *#??ā`@='H  q @ #' @ "l `  2`M@ - + '2M@`M@` @`0 *  `M@`0 @`O* : + '     -*   ?4`+  *  ?Ъ`M@ /9뀥 :`E` =M@0Ϫ`M@0`π 6e ' `(``   -*  4+  *   -*    +  *    M@Ѐ Ӓ`e EI 2 `2"ڪ`M@+ -І `M@Ѐ .0Ϫ`M@0"`π !Ъ`M@ *  `M@?Ѐ/9*%@ "" 2     `H &@  ' q#B?   q?b* @ $'%H  q#BD? >'@ 2:%`"_H%`   q".` ?$%% B"@ $% qb*@?$&@ .`% B@?$% B  q"*` ?$% ?*%@P  q"* ?$% B?4$ : "(  ""`L䀢 H   qH + @?$% B?: + H?,$ ?%( B?   $(#a?_]   q"* ?$% ?K:4 q  qcp + ?$% B?: + cp@?" q## D(?)F!?()BD F? q#  ""`L䀢`|H 4?@?r  4'''o  0[5 # @  I ?   ?  2:?8 ? q ?#! B0&  q#!+' q  qc&1'?  q" q q#!c q# q qc#B'cB &'??@?Ѐ B- %?,??? @'cD?   #" D? q#  qcB B?f?? @D?   F#' € q? q q#ȁ  qcЁ 0#؁ ``` *@ v` ܒ `       $@  ?3 6" @   4`% & $@    4`( "w & X  ?H 2"?"쀢 #㿘 t -    `Jd `1?#  6l @6h4`4    "@ @2 @:`"44 3`: ('  "'  0?#`  - @4   4` " 2 @:`"44 3`:  ('  "' h "'L'P'T ? " *@  "" ""Ȁ`6'@ '@ * ' % r T#"@̀ q?  qP  q q###\`N    \" B T "\ rհ` "  /Ȼ2g Ⱥ| ?* &' d2`   @Ȑ"̒*2   ̐"*@'  r B?{͔ ? '? r  r' r`0 D r( rHFBL ' B# ' q", $ȇ%)'#?    '% 'L 8'LL` 'L L "'!* €?'? 'P'P`P 'PP' 'P``'   ` ""  ,  `"⸪ "b ` Ⱥ  '  q b* @<"  # qȠ #h  ?Ȁ  q#H /`@ &' B<  `ȅ!?Ȳ q`b* @>`$Ȁ %B? q#H  /`@ $ȇ%B?ȡ<  `耢  r`8 9' 쀢  r`@ B ?' rȀF H?0D'@'& r P  '$% ?ȅ)  P?䀢 I qb* @`$ r% X ȑȍB'`0-@ȍ…&' Y?ȉ" r 8#ā) 0 @6T? r @ȑ DDB?ȅ'`0.Ȱ …&' 7?ȅƁ)} 0`@4?Ȑ* b@ $ r% B @Ȁ@B'`0.Ȱ ? r XD-Y 0ȉ&' 9?Ȱ?N 0"? Ⱥ`D??Ȥ  ZX q", "P #     r`P Bȁ  1-@ Ȁ@̍B'`0 L.Ȱ  ?ȉ"#B  ?ȅ$%L` 0?N 92?-@ .  r @ B r? D`'Ԁ ! L ؀d3 6" &$' %  ` @4%%&@䀢`` 8 } t L̀ 2'?@2 '   ''  *` s '@ `` "```@m g耢`    ٔ 쀥L  ˔ }  1Pɤ8 1-@`Ĥ``,܀'  Ը* @     Ԁ   ' 'Ԑ  `Ԣ 06L  *f` L` ̀ `9+ 4`f.& ``L`̀ `ƒ  4`2N.`"K.``:  9E. `9` 9., ;..@   ( ` 0.@  Β 4 ??`N  1?N 9  .-@`N 0"?   Ԁ`@ ߐ2. 0-@` .T"\2"+dd r0`(# t$  "Ć       $((()(*(+ (,!(-"(.#(/"t x  " "` "`"x㿘` ` ` 2 @@   "`L?@`  ` `, $$ ڤ`" $&`ְ `s "` `@  @2` :` ``#. ` *. n` ``&@$`$`$@$`` "`*@@`@"@$`$@.@` @@@@$@ 2` `` `,` $u` ` @o`@"@$`$@`" $&`b   `  ` @  "@  `@ ` `@ @ @5@@@$@ +0@ `,` 0   @`@"@$`$@2`@t   `" $&` ` ? @4` 㿘 !`2 u  2  " "  0` @@"& 0m & 0 &   ?6 &  6   2  " @b?@   &  &   &  㿐  C & & '&@%m+    C  & 6 & &@ `& & & @V  2` 6 8T  &&<  &<  ؐ`?`&$&@( "&@$ L ( ( `@"$㿐  @`     6  @ <   6? 2& ! #Ԁ l l$##\   @?? 2$  $ $ 2 $ $$  * "  $ @   ? 㿐  @<`6 0`    ! #Ԁ lq l$##\   @??2  $ $ $$@ ̔  $ @ Ĕ 㿈 #0`#0   '?   @ ?#0?#067777(70787\7@7L7L7L7L7L7L7L7L7T7\㿘 @ U  N `2J    < ; <" rbH@ ) <9    1 ",  ?`#!*` €#?###    (",&  &  "`L?㿈'XX#d#h#\#` @  Ł㿘T Dה  P > B< P ?Đ*@4 㿘 ! V  @-  ?Ē* 6 V G:㿘T   @?  2  ?Đ*@4   4 < P㿘ZV 㿐' r  f 0 ?? #\ @  ǰ − f 4` !'# r  bf ,  @ 8@ b fz .  r@*"ȁ㿈 a     % ?'      @ r ?2`  * , * * 8 ! '?''Ė  r'''''bД @a?' @  lɐ @ '''  א A f (V $OpenBSD: bzero.S,v 1.3 2003/06/02 20:18:32 millert Exp $ `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*㿘 `ܪ㿘 2 @7"P    @  "`L?㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`, 㿘 "h ? T` "??`X2"  `  ?2  㿐@H 'T # @ T 0.?T2 7耦(7耢 2: " 4`444`4`4`ؑ45 'ē45 5 5  `A'? 7' `@r`;`*  @h;`*  @^;`*  @TT` ;T :-`-2 ,`- ͓2`   ` `" `` 8   đ. ?2@ Đ" * c'Ā@ '.` @ '  @ @ @?   '/ @   7@', ?;: '+. 2, @ ( ?#   ?#/@..  ?+'$$66`% @"6``4@  *. ?  @26`@4@Ā2T`#@  " . @?* :@ @2. 4@*  *`T@ :̑* Τ Г*`@  +    ?( 8 2 + ( 2X@V+  2     " *@ `2 "@ `2 *@ `0* @  "2 2  "? *@2 ?"@? *@;`` (` `?#;```0  ?2 `2 # "  J` ? `   ?J@"J@@  " *   J@"`   `(*`  $OpenBSD: strlen.S,v 1.3 2003/06/02 20:18:32 millert Exp $ J " 8`    "`L@q!ܢ  ?$a$a,?$a  L   aژ   ̀@`@  ` @ N   " $a #$a a@i!?!  Lp! 2 O@!a@2 O`?   sa  € H`@ "` OX! `(=e $a@ 2V ` `D* a8` `*@ :@ *`$a@   `@$a0@@$a0  a @ ?$a$$a4f $ !  L@֐"$ L#a!H` & & & & & & & &  &`af$ L 㿘 ?@ fې " ? ?   L?8 #` ! @$ $ $ $ $ $ 4$! $ 8$  D @  Ē @ @` B, :  @$ $ - " @ *@@@ $ $  2$ 4 2$!  2  ဢ@ d"$   "`L  $ @  㿘 4<  & @  *  D# *#  * ,& $& `@` " ?!.`2 ? & ,& < & 0?ͥ? ?J?   ( O ! @ @    ""`L?? ?F<@ B    bl   ` `ͦ bl   ` ` bl   ` `  `  '$Ƅ a@$ʄ a@$J a@x@\  7ސ@' @ 2 ? ޒ"@6 * 2 b    & , @ & $ , sn@ Y`,b  @ ?Ք V@:?``,Ba @1 W  7  "  "  0= 9 ; 07   5 ?  a `( ?  *   2`*`2  (" ` ? ? @ @ ` '' '@' ?:    <  "   @q @   * ޓ2   * "@ *Ґ    6   "  "  0 @ e0 ޔ"6 *`3 ޒ*  }$  ޔ"6 *`2 ހ*  & &  $   ,   `[  @ݐ? 0Sހ ? * @      @` @ؐ$@$  ޔ"6 *6 ޓ*`@ &,$  ? * @      @` `?2 $@$  ޔ"6 *`6  * 2`&  $ o "@@ 2@b @Ӓ?@?@Տ @Ջ a?$a  @{ @ w0@r @n  @i?@ e`㿐ӛ a  4`$@4``$`@$`` $` ```?2 @  &`4`7&&C]ؠ 20 8  ` @`$` @ ``$ $ 4 4 $  ԃ 2@] &   @Ɩؐ"]|&&㿐1 ,   $@$@$`$ $ $`4 4`!ڒ4 4``  $ $` @&&㿘!ڐ?6`6`*  2 `@?2 @$$ `6`6`*` 2` @ ?2 @$ $ ` 6` `&` ԙ  㿘!ڐ?* 6`6`2`&@ @ &.`  ' 6  ` " 6`6` * 2 &@@&.   `"`  @C?2`  ? ` " *2 @ 6`6`ڐ&`   ? 6`&` C  x`!ڐ?2 7'T*`* 2`'X2`     -'7  ''`'-`2 2` X6  "-  -0*  -0$2 @ @ `  2 @ @ ` `  ? `-2  @   2  @ @   ?-`2 7   /`2   :/*`2 -2`@ $* "6 2  'ܐGܒ`@*`2     -`-2  `-` 2  @6    - @@-`-2 @ `22@:# # "2-`- <#T@"2@ *H`--@2 <``  "*  *0  *0@ @ `  @ @ `   ?*  @ @ @ ` -`"2`64 *` `-`2 -@6 6㿘 ҋ     "   ?` (0 `*`0`@*`0  㿘,` ``$, @2 `t,`2`6 $, 2 i`,`2`,``2 6**`@6$ 2`2`㿘`. `@C"?. "  ,"* *`@`2 `" @ 2@4.`22@22*   @4 248?$8``.`㿈      2 j?- .`3 3`@c Y  - `  -`@<`` , @ '2$'(2%* "@ , 2 $ @ @ "@44 @ '" ('`@ʴ@ "* 2``**`4@@% 2`@* 2   - ` ?-`p?*2`@   ?* 2   #\@* 2?܀؀*,`2 ` 2%`# + 2**4' 2*`* 2 2`Ԗ c  @T   l  i,`,`2  ' %@ '`' `# 't`2#  * @  `@  @Ӑ "w #. * @  `@ c@ 2"?U .`* 2`@  *` `8,`,`2  *F @ْ 㿘`- *2  "3  * @ *2  `%*2   @ ` N @ ?! "\?``"    ϖ*``ˑ*  *  @  `@ `@= 7 `  *  @  `@  Ҕ`@< "`?@Ҕ`  .` 8` & 8 (/V` 4 $ ;?㿘 4@@ `2  & 4 & 4``@V.`,`2 `  &` ` *`*2*  2224`㿐!  6@  ?6` z6`  <?*  D@ 6  *@  <?   ?*  D@  @>  ӣ? J?  O"`LB?6@`2  @ 2  6@ ?6` 26` ဢ@-`"@ :  &@?'  .@ .`.`.`` 7.`.@@  `@?7 .@.`` 㿐!? @ 2h?  ဢ@,! "@ :  $'++ + +    @ 7 **  <]?*  D@ 6  *@  <  K ?*  D@  @> c?   O"`L?㿘W !!<   , &! ϐ " ɐ?* $ ĕ.2 !8.`" $      (㿘 D, `$* : ?=@ 1 8. @@e À2 * ?  $* ? @  :  ? ?e` *` Ց. ,D@  %$@   "@ * $@ g$  s% *` ,$   ?$   * ?2% ``m s, Y  2l ` g $Z s% * ,$  , ?$   :** %  * @% , ;V  :**$   * @%  *` $ ?%$  D D .  4  ?* D@$@ g s. .  6 c 2k 1  "`L 㿘`2 ` '*  D@  $&& $ !8 : +`*`   @  :**$   * *# 㻈# a '  2 sϚ#P  s#h s$Xэ?' ϗ?&!+!    ! ?a  sP#p㿘,``$4, @2 `c`$ 6, 2 Z64`4`` *`$ @2`* 2 㿘!@6 V .`!8$ .`     9  2V"  ?*@    2@* *@ 㿘`*  m* 2 *`*  4`$ , 2   +  +  42*`4$ 2+ * 2 4 `|%0+   &@2 @ ,$@,`4 2 4 5?%@*"@2* 2  2` `.`*`@`?`*  H* 2 @ @"**  4 $@ ,`2 w +  +  42*`4$@ 2@*  2 +  4 2 2`?+  4 `` .`*`@`? 㿘`  * 2  ( `*  ` * ?`*` .`2` ?`   +  ?  `22`$`%?$`?2  + *`2 "  2 ` *`@ 2` ` ,`   8 ?$ 8㿘`,  " *`2 (  `$*, 2  & W $@``" *2   **2  ?,   ??㿘 @+  ? * "    +  @  `+ &@  㿘`.  `2.*  ?  "s?`  .  `*  ?  ]` ?* @   2  "?Җ -,`D?  &" !&  * !$  &!(&!$&!  ? (&!  &!(`@ 2" !$&!  &!$ ,`2 @?&   ! ! & "`L?㿘`   "@(`! SS @&!, &!( * ?g /&!  `,!$&!  &!$* R Ĕ $?,` 2 @  ! `@ 0 "`L?㿘@  ?&! &?㿘```? * 2 "@ ` ! StSG /$!  ,%?@*  ΐ ,` 2 @  !``K@ 0 "`L?㿈\'P 2d?@ P* 2`` 4 Pﺖ $ L?$  `"`` *``/`` *` 2`6 *2 *62`6@2`* 2 P$$  `` *` *  *` 262*`@2`P  ?6P"$ $ 㿠%s: %s not compiled in instbinUsage: %s ..., where is one of: %shostnamedmesgexprmvsleep-shshkshsedmkdirmtrmnewfsinitfsckfsck_ffschownchgrpchmodgzcatgunzipgzipcpedhaltrebootdhclientmount_ffsftprouteinstallbootmknodumountfgrepegrepgrepmount_nfsmorelessping6rtsollsifconfigcatpingcpiotarpaxdisklabellnsttyrestoresyncmountdfmount_cd9660dd" " $" 8" @" l@@" " " " "x @@"p skipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qd" "@"" "@" "@"""x"h "@"X "@"P "@"H"@"8"0"(unblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination%s%s: illegal numeric value%s: %s%s: short input record    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxstdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffer%s: end of device%s: short write on character device%s: short write on tape device%u+%u records in %u+%u records out %u odd length swab %s blockblocks%u truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryA.%sskip reached end of input"""""""""""" "updateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rrealpath %scd9660%s: Filesystem not supported by kernel%s on %smainusage: mount_cd9660 [-egjR] [-o options] special node ,-o %s: option not supportedhiklnPt:only one -t option may be specified.-i is incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file systemempty type list %lld %6s%-*.*s %*u %8u %8d %5.0f%% %7u %7u %5.0f%% %s A@Y Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s @Y df: %qd: %s usage: %s [-hiklnP] [-t type] [file | file_system ...] ffsext2fsunionsoftdepsyncsynchronousroot file systemroread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasyncasynchronousffsAadfo:rwt:uvforceonly one -t option may be specified.updaterwrqnoautogetmntinforealpath %sunknown special file or file system %s.root_devicecan't find fstab entry for %s.malloc%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountdmain,/usr/sbin/sbin/statfs %s%s on %s type %.*s: %s already mountedexec: mount_%s %s fork%s/mount_%sexec %s for %sno mount helper program found for %swaitpid%s: %smountfs%s on %s type %.*s%s%s (, %sunknown flag%s %#xs, ctime=%sv3v2udptcpsofthardintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadmfs%s%s=%lu %ssizeadosfs%s%s=%u, %s=%uuidgid%s%s=0%omaskmsdosshortlongnowin95gemdirexeccd9660norripgensextattprocfsversion %dlinux) prmountempty type list%s,%s-ousage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special node[-Aadfruvw] [-t ffs | external_type][-dfruvw] special | nodeufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %s,-o %s: option not supported$OpenBSD: main.c,v 1.14 2003/07/28 06:13:26 tedu Exp $./restoresymtableTAPE/dev/rst0TMPDIR/tmp/b:cdf:himNRrs:tvxyillegal blocksize -- %sblock size must be greater than 0%c and %c options are mutually exclusiveillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specified.Begin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure mainusage: %s -i [-chmvy] [-b blocksize] [-f file] [-s fileno] %s -R [-cvy] [-b blocksize] [-f file] [-s fileno] %s -r [-cvy] [-b blocksize] [-f file] [-s fileno] %s -t [-chvy] [-b blocksize] [-f file] [-s fileno] [file ...] %s -x [-chmvy] [-b blocksize] [-f file] [-s fileno] [file ...] option requires an argument -- %c$OpenBSD: interactive.c,v 1.19 2003/07/28 06:13:26 tedu Exp $/addcd%s: not a directory delete%s: not on extraction list extracthelp%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of files to be extracted delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list If no `arg' is supplied, the current directory is used lspwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help runcmdshell%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! getcmdcommand lines cannot be continued missing %c ../..ls: out of memory directory reopen failed %s: %s/%s%s: name exceeds %d char printlistWarning: undefined file type %d %*d %srestore interrupted, continue$OpenBSD: restore.c,v 1.12 2003/07/29 18:38:36 deraadt Exp $%sleafdir %10d %s %s: not on the tape ./%uaddfileMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %d) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state |NIL|ONTAPE|INOFND|NAMEFND|MODECHGFind unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %d: bad first %s: not found on tape expected next file %d, got %d unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links createlinksCheck the symbol table. incomplete operationsWarning: missing name %s missing inumber %d type should be LEAF$OpenBSD: dirs.c,v 1.26 2003/08/25 23:28:16 tedu Exp $Extract directories from tape %s/rstdir%d-XXXXXXXXXXwcannot create directory temporary %s%s/rstmode%dcannot create modefile %sopendirfileRoot directory is not on tape extractdirs%s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %d char treescan/pathsearchlsMangled directory: reclen not multiple of 4 reclen less than DIRSIZ (%d < %d) reclen name too big (%d > %d) putdirbad seek pointer to rst_seekdir %ld error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopencannot open mode file %s set owner/mode for '.'cannot find directory inode %d error setting directory modes Cannot find directory inode %d named %s %s: cannot create filewrite error extracting inode %d, name %sreadwrite error extracting inode %d, name %s writegenliteraldirno memory directory table $OpenBSD: symtab.c,v 1.13 2003/11/08 19:17:28 jmc Exp $addino: out of range %d duplicate inumdeleteino: out of range %d deleteino: %d not found lookupname%s is not a directory %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTcannot find entry in parent listbad name no space for string table Check pointing the restore wfopencannot create save file %s for symbol table fwriteoutput error to file %s writing symbol table Initialize symbol table. no memory for entry table .opencannot open symbol table file %s statcannot stat symbol table file %s cannot allocate space for symbol table readcannot read symbol table file %s Incremental tape too %slowhighinitsymtable called from command %c $OpenBSD: tape.c,v 1.27 2003/07/29 18:38:36 deraadt Exp $-/dev/ttyrcannot open %s/dev/nullCannot allocate space for tape bufferVerify tape and initialize maps %sTape is not a dump tapeConverting to new file system format. .cannot stat .bad block size %ldTape is not volume 1 of the dumpheader read failed at %ld blocks no header after volume mark! Cannot find file removal listmaxino = %d no memory for active inode map Cannot find file dump listno memory for file dump list Changing volumes on pipe input? %s%s%s%s%sYou have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. You have read volumes: %s%ld, Specify next volume #: Volume numbers are positive numerics Mount tape volume %ld Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) noneCannot open %s tape is not dump tape Wrong volume (%d) Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %d Skipping %ld duplicate record%s. sactive file into volume 1 getvolWarning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe inputioctl MTFSFDump date: %sDumped from: %sthe epoch Level %d dump of %s on %s:%s Label: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special fileextract fifo %s %s: cannot create fifo%s: cannot create fileran off end of tape not at beginning of a file Missing address (header) block for %s at %ld blocks getfilewrite error extracting inode %d, name %s writeseek error extracting inode %d, name %s lseeksymbolic link name: %s->%s%s; too long %dunallocated block in symbolic link %shole in map mid-media short read error. partial block read: %ld should be %ld Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %d continuecontinuation failedEnd-of-tape encountered partial block read: %d should be %d tape read errorTape block size (%ld) is not a multiple of dump block size (%d)Tape block size is %ld Note: Doing Byte swapping 8l4s31l528b1l192b2lNote: Doing Quad swapping gethead: unknown inode type %d getheadVolume header (%s inode format) oldnewbegins with record %dDumped inodes map headerUsed inodes map headerFile header, ino %dFile continuation header, ino %dEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks findinodeChecksum error %o, inode %d file %s l$OpenBSD: utilities.c,v 1.13 2003/07/28 06:13:26 tedu Exp $mktempname: called with TMPNAMEmktempnamenot on ino list%s%ld%dRSTTMPcannot rename %s to %srename %s to %s newnode: not a node%sMake node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s cannot create symbolic link %s->%scannot create hard link %s->%slinkit: unknown type %d Create %s link %s->%s symbolichardcannot create whiteout %sCreate whiteout %s delwhiteout: not a leafcannot delete whiteout %sDelete whiteout %s bad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s NODELEAFinode number: %d flags: %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump core$OpenBSD: dumprmt.c,v 1.22 2003/07/28 06:13:26 tedu Exp $Lost connection to remote host.shelltcpshell/tcp: unknown servicewho are you?malloc/etc/rmtinvalid user name: %sO%s %d rmtopencloseC R%d readrmtreadW%d writermtwritermtwrite0L%d %d seekrmtseekstatusS I%d %d ioctlrmtioctl%s: %sProtocol to remote tape server botched (code "%s"). rmtreplyProtocol to remote tape server botched. (rmtgets got "%s"). "" "x"p"h"`"X"P"H"@"8 "0"( " " " ""werasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscard"""rprntflushbrkoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d :%lxcflagiflagispeed%ldlflagoflagospeedttyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingekdeccookedcolumnscolscbreakallillegal option -- -%soption requires an argument -- %s%d %d %d TIOCSETDTIOCSTARTTIOCSTOP""""""""""" " "#"x3"p#"h3"`2"X3"P3"H#"@@"8@"0@"(@" """""-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5""""""x"p"h"`"X"P "H "@@"8@"0"(" """""""""""""""" " -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk"""""""""""""""x"h"`"X"P"H"@@"0@"(@"@" " " " """""츀""@"@""" " "xC$"pC"hC$"`C"P"@"0" ""-xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho"""""""x "p "h"`"X"P"H@"@@"8"0"(" ""-onoeotonoeot-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostoposttablet disc; slip disc; ppp disc; strip disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-xcaseiflags-istrip-icrnl-inlcr-igncr-iuclc-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-onocr-onlret-olcuc-oxtabs-onoeotcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s print%s: %s %s %s%d-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZmainusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.10 2003/06/02 23:32:08 millert Exp $Ffhns.%s%s: is a directory%s/%slinkitusage: %s [-fhns] file1 file2 ln [-fs] file ... directory @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.86 2003/12/20 09:29:27 jmc Exp $RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedntfsadoscd9660lfsmsdosffsBEFf:NRWb:cdenp:rs:tvwbckmg%srioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.ioctl DIOCSDINFOwriting label to block %lld (0x%qx) lseekwriteioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskreading label from block %lld, offset %lld disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%lxioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFOBootstrap doesn't leave room for disk label\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%d:%sil#%d:%ssk#%d:%scs#%d:%shs#%u:%sts#%u:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u: %c: %*u %*u %c: %*.1f%c %*.1f%c %8.8s%8d %5d %5d %5.5s %5d %5d %5d %22.22s # %s # (Cyl. %4d- %uA# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # microseconds track-to-track seek: %ld # microseconds drivedata: %d %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffsetw # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: editsh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/sh # line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sgetasciilabelsector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0this architecture requires partition 'a' to start at sector 0partition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %dcmplabel usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)usageRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedntfsadoscd9660lfsmsdosffsout of memoryYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically. Initial label editor (enter '?' for help at any prompt)> unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lesswunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?yunable to write labelRecalculated free space.FilenameName of the file to save label into.cannot open %sNothing to undo!Last change undone.%s expert mode EnteringExitingUnknown option: %c ('?' for help) editorNo space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Partition '%c' already exists. Partition must be between 'a' and '%c'. Please re-enter an offset and size for partition %c. editor_addpartition to nameThe letter of the partition to name, a - p.Command aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to modifyThe letter of the partition to modify, a - p.Warning, need %u sectors but there are only %u free. Setting size to %u. Please re-enter an offset and sizepartition to deleteThe letter of the partition to delete, a - p, or '*'.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. device: %s type: %s disk: %.*s label: %.*s bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld free sectors: %u rpm: %ld %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffsetpartition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk %s: [%s] %s: [%u] %dRounding to nearest cylinder: %u getuint@YAA? Error, partitions %c and %c overlap: size offset fstype [fsize bsize cpg]Disable which one? (^D to abort) [%c %c] has_overlapChanging device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).IDE"%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Numer of sectors per track.tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %u sectors (only %u sectors left) rpmThe rotational speed of the disk in revolutions per minute.interleaveThe physical sector interleave, set when formatting. Almost always 1.edit_parmsfailed to sort partition tablesdrzwdfdFLOPPYxdxyhdCCDVNDsvnd#x# (## (##(#### @## @## # ## ###0123456789Possible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'x' command exits the label editor without saving any changes to the on-disk label. The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [b|d|u] - use [b]ios, [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help./dev/%s%s%s%c %s %s rw 1 %d mpsaveStarting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. This architecture requires that partition 'a' start at sector 0. Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors fragment sizeSize of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeblock sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).mount pointWhere to mount this filesystem (ie: / /var /usr)noneMount points must start with '/' Can't stat deviceioctl DIOCGDINFO[d]isk, [b]ios, or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.dBIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd', 'b', or 'u'. $OpenBSD: ar_io.c,v 1.34 2003/09/08 20:19:51 tedu Exp $Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocksget_physUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again ar_nextcould not pipecould not fork-c-dccould not exec$OpenBSD: ar_subs.c,v 1.26 2004/03/15 22:18:15 djm Exp $listCannot chdir to %sCan't fchdir to starting directoryextractUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...done. appendarchivedirectory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %scopyPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.$OpenBSD: buf_subs.c,v 1.18 2003/10/20 06:22:27 jmc Exp $Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache table%lu$OpenBSD: cpio.c,v 1.16 2003/06/26 00:10:17 deraadt Exp $TRAILER!!!cpio_endwrCpio file name length %d is out of rangeCpio file name in header is corruptedCpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt070707File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %scpio_wr070701070702File is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %svcpio_wrFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sbcpio_wr$OpenBSD: file_subs.c,v 1.25 2003/10/20 06:22:27 jmc Exp $Unable to create %sUnable to close file descriptor on %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfUnable to link file %s to itselfUnable to remove %sCould not link to %s from %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)node_creatUnable to remove directory %sCould not unlink %sUnable to obtain file stats %sAccess/modification time set failed on: %spaxUnable to set file uid/gid of %sCould not set permissions on %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %sset_crc$OpenBSD: ftree.c,v 1.24 2003/10/20 06:22:27 jmc Exp $Unable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s Can't fchdir to starting directoryCan't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %s$OpenBSD: gen_subs.c,v 1.17 2003/06/13 17:51:14 millert Exp $%b %e %Y%b %e %H:%M%s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == => ls_list%s%s %s ls_tty$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $%s: unknown option %c %s: %c argument missing $OpenBSD: options.c,v 1.60 2003/11/30 16:58:24 millert Exp $ustartarsv4crcsv4cpiocpiobcpiopaxab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZ0Invalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578Unable to allocate space for option listcompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8-I-rUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPE/%sabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-cdnvzO] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvzDOYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvzHLOPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-o options] ... [-U user] ...[-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-diklntuvDHLOPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory usage: tar [-]{crtux}[-befhmopqsvwzHLOPXZ014578] [blocksize] [archive] [replstr] [-C directory] [-I file] [file ...] usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list $OpenBSD: pat_rep.c,v 1.25 2003/06/02 23:32:08 millert Exp $Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %srep_addEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistentRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s tty_renameFile name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s rep_name@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.26 2004/01/20 14:08:45 otto Exp $.Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal maskUnable to set up signal handler$OpenBSD: sel_subs.c,v 1.17 2003/10/20 06:22:27 jmc Exp $Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]$OpenBSD: tables.c,v 1.21 2003/08/16 17:31:55 deraadt Exp $Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memorychk_ftimeCannot allocate memory for interactive rename tableNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to create temporary file for directory times: %sUnable to store mode and times for directory: %sUnable to store mode and times for created directory: %sUnable to set mode and times for created directoriesproc_dir$OpenBSD: tar.c,v 1.31 2003/06/26 00:10:18 deraadt Exp $ustarwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %star_wrUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %sustar_wr$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $/dev/ttywrFatal error, cannot open %s%s: : %s@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.65 2004/03/21 20:00:55 markus Exp $socketDI:LRS:c:dfh:i:l:np:qrs:T:t:vw:number of packets to transmit%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload valuepacket sizetos valuettl valuemaxwait valueunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommainA??zG{A.ping: sendtoping: wrote %s %d chars, ret=%d pingerpacket too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %x --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet loss round-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms summaryA@YEcho Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Desination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host bad %s: %s%s too small: %s%s too large: %sbenstuvusage: %s [-benstuv] [-] [file ...] stdoutstdin-r%s%6d buffer@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ifconfig.c,v 1.93 2004/03/18 20:52:13 mcbride Exp $###Ә#pӘ#h#`#X#P#H#@#8#0Ҕ#(P# #L###d#d##Ҹ##X####x#p(#hD#`0#X#P#@T#0p#(0# 0#0#0#70######L#####@#М#М#X#x\#p#h#` #X#P@#H#@#0# ##@Ӱinstinstance-mediaoptmediaoptmedia-link2link2-link1link1-link0link0destroydeletetunneltunnelgiftunnel-syncifmaxupdsyncifstatevhidpassadvskewadvbase-vlandevvlandevvlanEtherIIsnap802.3802.2tr802.2nsellengthsnpaoffsetphaserangeeui64vltimepltime-tentativetentative-anycastanycastprefixlenipdstbroadcastpowersavesleep-powersavepowersave-nwkeynwkeynwidmtumetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownup#, i@i{~{}P#P  ixi{~({l#hT i@i{}{}# i@i{~{}#0 i@i{~{}#H0iti{{Pisoipxnsatalkinet6inet-a-A-ma-am-mA-Am-minterface name '%s' too long-Ccreateextra address not accepted'%s' requires argument'%s' requires 2 arguments64encapsulation routingSIOCDIFADDRSIOCAIFADDRmainsocketSIOCGIFFLAGSSIOCGIFMETRICgetifaddrsstrdup%s: no such interface SIOCIFCREATESIOCIFDESTROYSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for names%serror in parsing address string: %ssource and destination address families do not matchinvalid sockaddrSIOCSLIFPHYADDRsettunnelSIOCDIFPHYADDRNote: trailers are no longer sent, but always received SIOCSIFFLAGSsetifflagsinvalid %s%s not allowed for the AFinterface index is already filledcould not determine link local address%s: invalid metricSIOCSIFMETRIC%s: invalid mtuSIOCSIFMTUbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xSIOCS80211NWIDsetifnwidpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYsetifnwkeySIOCG80211POWERSIOCS80211POWERsetifpowersavesetifpowersavesleep nwid nwkey %d: powersave on (%dms sleep) offieee80211_statusSGIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mediaopt' commandsonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'invalid media instance: %s #x #p@#`@#X`#P#@IEEE802.11FDDItokenTokenRingetherEthernet#0#(# #########$#$#$#$#%#%#%#%#&#&#'#x'#p(#`(#X)#H)#@*#0*#(+#+#,#,#,#-#-#-#.#.#/#/#0#0#0#x0#p1#`1#XC#HC#@D#0D#(E#E#F#F#c#c#d#d#e#e#######DS11DS5DS2DS1FH2FH1CDDIMMFMulti-modeSMFSingle-mode16UTPUTP/16Mbit4UTPUTP/4Mbit16STPDB9/16Mbit4STPDB9/4MbitHPNA1HomePNA11000TX1000baseTX1000T1000baseT1000CX1000baseCX1000LX1000baseLX10FLFL10baseFL10STPSTP10baseSTP1000SX1000baseSX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTnonemanualautoautoselect## # #######@#@#x@#h@#`@#P@#H`#8`#0#(# ###monitoribss-masteribsshostapadhocdasdual-attachALLRAllRoutesSRCRTSourceRoutingETREarlyTokenReleaseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplexunknown %s media subtype: %sunknown %s media option: %s%s %s%smedia %smediaopt instance %d6 physical address inet%s %s --> %s phys_status ##`##p@##p#`#no networkinsertedno ringactiveno carrier%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu address: %s %s: no media types?mallocSIOCGIFMEDIA media: status: , unknown supported media: status inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime 0infty vltime in6_aliasSIOCGIFADDR AppleTalk %d.%d range %d-%d phase %d--> %d.%d broadcast %d.%dat_status ns %s ipx %s SNAPframe %s SIOCGIFADDR_ISO iso %s SIOCGIFNETMASK_ISO netmask %s SIOCGIFDSTADDR_ISOiso_status%s: bad value%s=%o%s=%x%s: %sAppleTalk does not use netmasks%u.%u%s: illegal address%hu-%hu%s: illegal net range: %u-%u12%s: illegal phase atalk %d.%d range %d-%d phase %d AppleTalk address is not in rangeAttempt to set XNS netmask will be ineffectual Attempt to set IPX netmask will be ineffectual negative NSEL length is absurdsetting NSEL length valid only for isousage: ifconfig [ -m ] [ -a ] [ -A ] [ interface ] [ [af] [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [ media media_type ] [ mediaopt media_option ] [ metric n ] [ mtu n ] [ nwid network_id ] [ nwkey network_key | -nwkey ] [ powersave | -powersave ] [ powersavesleep duration ] [ [af] tunnel srcaddress dstaddress ] [ deletetunnel ] [ vlan n vlandev interface ] [ arp | -arp ] [ anycast | -anycast ] [ deprecated | -deprecated ] [ tentative | -tentative ] [ pltime n ] [ vltime n ] [ eui64 ] [ -802.2 | -802.3 | -802.2tr | -snap | -EtherII ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig [-a | -A | -am | -Am] [ af ] ifconfig -m interface [af] ifconfig -C ifconfig interface create ifconfig interface destroy vlan: %d parent interface: %s vlan_statusSIOCGETVLANSIOCSETVLANsetvlantagmust specify both vlan tag and devicesetvlandevunsetvlandevMASTERBACKUPINIT carp: %s vhid %d advbase %d advskew %d carp_statusSIOCGVHSIOCSVHsetcarp_passwdvhid must be greater than 0setcarp_vhidsetcarp_advskewsetcarp_advbasesetcarp_stateSIOCGETPFSYNCSIOCSETPFSYNCsetpfsync_syncifunsetpfsync_syncifsetpfsync_maxupd pfsync: syncif: %s maxupd: %d pfsync_status%dd%dh%dm%ds%luCOLUMNS1ACFLRSTWacdfghiklmnopqrstux %s: %s: %s: directory causes a cycle%s: %sfts_read%u-%lu%qudisplaytotal %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd printlongtotal %llu %s%s/%s ls: %s: %s -> printlink%*s usage: %s [-1ACFLRSTWacdfhiklmnopqrstux] [file ...] adDFadDfFm1kernel is configured not to accept RAskernel is configured as a router, not a hostmainfailed to open a socketfailed to initilizatoin interfacesfailed to initialize %sfailed to setup for probing routersselect: %sifconfigfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedmake_packetlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %srtsol_check_timertimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %ld:%08ldrtsol_timer_updateillegal interface state(%d) on %sstop timer for %sset timer for %s to %d:%dusage: rtsol [-dDF] interfaces... usage: rtsol [-dDF] -a usage: rtsold [-adDfFm1] interfaces... usage: rtsold [-dDfFm1] -a <%s> %swarnmsgmultiple interfaces foundreallocstrdupprobing %ssockopenmalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %ssocket: %sIPV6_PKTINFO: %sIPV6_HOPLIMIT: %ssetsockopt(ICMP6_FILTER): %ssendpacketsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketrtsol_inputrecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%d) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpeced IF(%s)received RA from %s on %s, state is %drtsol_inputinterface_upioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...get_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedinterface_upinterface_statusioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sinterface_statuslladdropt_fillunsupported link type(%d)get_llflagsocket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflagprobe_initmalloc failedsocket: %sshutdown: %sdefrouter_probelo0ioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)defrouter_probesendprobeprobe a router %s on %ssendmsg on %s: %ssendprobea:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwWinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-%c is not supported on this platform-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dtoo many intermediate hops%sgetaddrinfo failedsocketbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_HOPOPTS)setsockopt(IPV6_DSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(ICMP6_FILTER)setsockopt(IPV6_RTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't set the last flagUDP socketUDP setsockopt(IPV6_PKTOPTIONS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_PKTINFO)setsockopt(IPV6_HOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> %s pollrecvmsgnew path MTU (%d) is notified main?A.@@sendmsgping6: wrote %s %d chars, ret=%d .%c\%03odnsdecodeinvalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%g ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%x%d bytes from %s: refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOP???%s%s, (refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%lupr_pack@@ HbH Options: Dst Options: Routing: -%u %uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap truncated no address ? %s(TTL=infty)(TTL=%u)pr_nodeaddr --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's duplicating packets!%.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms @YIPv4 addressDNS labelIPv6 addressUnknownRefusedSuccessNo Route to Destination Destination Administratively Unreachable Destination Unreachable Beyond Scope Destination Host Unreachable Destination Port Unreachable Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceeded Frag reassembly time exceeded Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirect Destination: %s New Target: %sNode Information Query, NOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(%s)(invalid), invalidNode Information Reply, %sBad ICMP type: %dpr_icmphVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESP TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ... patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02x ff02::2:0000:0000nigroupusage: ping6 [-dfHnNqtvwW] [-a [aAclsg]] [-b sockbufsiz] [-c count] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-h hoplimit] [hops...] [-g gateway] host LESSSECUREmore-E-G-L-mMORELESS--WARNING: terminal is not fully functionalCannot allocate memoryraw_modeLESS_TERMCAP_ltget_envLINESliCOLUMNScokrklkukdkPkNkh@7kDTERMunknownhcamxndadbutsgpcksketitececdcl cmsoseusuemdmembvbbsbcho|^ll alsrget_termNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread error%sch_ungetchar overrunseek error to 0%cESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off /?_-(P)+! [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found:%s helpCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar-%s"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%s/HOMEbin_fileSHELLr%s %s %s%s LESSOPEN-LESSCLOSE-c...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSm%*s plinenum~ Calculating line numbers! /dev/ttySHELL%s %s %ssh (press RETURN)Invalid mark letterCannot seek to end of fileMark not setMark not in current filelLine number is required after -l/%sless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops ,%d and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for help%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeDon't use keypad modeUse keypad modeHorizontal shift %d positionsHorizontal shift: Show tildes after end of fileDon't show tildes after end of filequotes: Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminal0123456789,Tab stops: Highlight first unread line after any forward movementHighlight first unread line after forward-screenDon't highlight first unread linePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modeChop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters directly, processing ANSI sequencesDisplay control characters directlyDisplay control characters as ^XNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptUse the LESSOPEN filterDon't use the LESSOPEN filterDisplay a status columnDon't display a status columnPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesQuit if end-of-file on first screenDon't quit if end-of-file on first screenOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileAssume dumb terminalAssume intelligent terminalRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffersMax buffer space per file: %dKMax buffer space per file (K): Search skips displayed screenSearch includes displayed screenBe less helpful in promptsBe helpful in prompts%s: %spostoalinenumtoainttoaiprint_intiprint_linenum?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataap_posap_linenumap_int?-fileNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned off/dev/tty######޸#ް#ި#ޠ#ޘ #ސ#ވ#ހ#x#h#`#X #H@#@#0#(# # #@#####acdirmaxacdirminacregmaxacregminacnfsv2porttcpsoftresvportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforceunionrdonlysuidexecdevautorwrogroupquotauserquota23a:bcdD:g:I:iL:lo:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sconflicting version optionsport=acregmin=acregmax=acdirmin=acdirmax=illegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %srealpath %snfs%s: Filesystem not supported by kernel%smainhostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCnqnfs 2/can't access %s: %susage: mount_nfs %s %s %s %s [-23PTUbcdilqs] [-a maxreadahead] [-D deadthresh] [-I readdirsize] [-g maxgroups] [-L leaseterm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node,-o %s: option not supportedbin_file(standard input)(fd %d)%sinvalid file typeusage: %s [-AB num] [-CEFGHILPRSUVabchilnoqsvwx] [--context[=num]] [--binary-files=value] [-e pattern] [-f file] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxyunix-byte-offsetsline-regexpword-regexprevert-matchno-messagesrecursivesilentquietline-numberfiles-with-matchesfiles-without-matchignore-caseno-filenamefileregexpcountbyte-offsettextversionbinarybasic-regexpfixed-stringsextended-regexpdevicescontextbefore-contextafter-contextmmaphelpbinary-files%s[[:<:]]%.*s[[:>:]]%s^$r%scontext out of rangegrep version %u.%u without-matchUnknown binary-files option%s: %s(standard input)r%s%s:%u %s Binary file %s matches -- [[:<:]][[:>:]]mallocrealloc%d%lldaFfh:t:vonly one -t option may be specified.nfs/%s: not currently mounted%s: not a directory or special device%s: unmount from %s %sCannot MNT PRCBad MNT RPCumountfsgetmntinfoempty type listusage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]mkfifom:invalid file mode.node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%susage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p _block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrapnlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x %s: devread: lseek%s: devread: readstatfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect block@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.63 2004/01/18 12:26:16 markus Exp $route: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] keywords: get, add, change, delete, show, flush, monitor. route: %s: %s nqdtv/dev/nullsocketmust be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) route: write to routing socket: %s got only %d for rlen %-20.20s done defaultinvalidiso %s(%d) %sroutenameaf %d: %snetname0%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway %s %s %shostnet: gateway %s (%s) not in tableentry in userouting table overflow: %s 64128inet6_makenetandmaskInternal Error%s: bad value %s: resolved to multiple values route: %s: bad value prefixlen is not supported with af %d *.**.0x%xany*0x%02x%02x%02x%02x%02x%02x.0x%x0x%x.%s%sns_print*.0x%XH%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sactual retrieval of interface tablegot message of size %d on %smonitoruwriting to routing socketroute: read from routing socket: %s RTM_IFANNOUNCE: iface arrival/departureRTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routeunknownrouting message version %d not understood %s: len %d, if# %d, downuplink: %s, flags:metric %d, flags:if# %d, name %s, what: arrivaldeparture#%dpid: %ld, seq %d, errno %d, flags: route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: locks: inits: sockaddrs: %s%s: link %s; %s: iso %s; %s: inet %s; %s: inet6 %s; %s: xns %s; %s: ipx %s; sodump$OpenBSD: show.c,v 1.26 2003/08/26 08:33:12 itojun Exp $UGHRBD M@dmCXLS1@2 3croute-sysctl-estimateout of space sysctl of routing tableRouting tables %-*.*s %-*.*s %-6.6s DestinationGatewayFlags%-6.6s InternetInternet6XNSIPXISOX.25AppleTalk %s: Protocol Family %d: link#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s p_sockaddrp_flagsxresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1prefixlenosinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoipxinet6inetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpiredstdeletecloningchangeblackholeadd/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.typeWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPElocal-filesusage: %s local-files Continue withmput%s: not foundmputr+wwusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files mgetmgetonoffConnected %sto %s. and logged inNot connected. Connected for proxy commands to %s. No proxy connection. Gate ftp: %s, server %s, port %s. (none)Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. Use of EPSV/EPRT cmds for IPv4: %s%s. (disabled for this connection)Macros: %s usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdusage: %s remote-file DELE %smdeletefrom-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:usage: %s remote-files local-file SHELL/bin/shsh-c%sTry again latershellusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. userPWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1modefile-nameusage: %s mode file-name SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. filenameusage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". PAGERmore|%sCan't allocate memory for $PAGER?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenameregetrecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitepsv4disconnectdirdeletedebugcrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. domacroExtra `@' characters in usernames and passwords should be encoded as %%40unknownCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %s-Can't open %sCan't allocate memory for transfer bufferWriting %sReading from fileSuccessfully retrieved file. host %s, port %s, path %s, save as %s. %d%s: %s(unknown)Trying %s... socketconnect%sr+Requesting %s (via %s) GET %s HTTP/1.0 %s User-Agent: OpenBSD ftpRequesting %s Can't allocate memory.80GET /%s HTTP/1.0 Host: [%s]:%s %s GET /%s HTTP/1.0 Host: [%s] %s GET /%s HTTP/1.0 Host: %s:%s %s GET /%s HTTP/1.0 Host: %s %s Writing HTTP requestReceiving HTTP replyreceived '%s' 301302200Error retrieving file: %sContent-Length: Location: Redirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}cdRetrieving %s/%s %s/%sgetmgetauto_fetchCan't allocate memory for URL decoding:/unknownftp%dftpgatehttp%s: bad port number `%s'%s: %sTrying %s... socket(unknown)connect to address %sconnect%sgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopthookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT%c%c%c421 Service not available, remote server has closed connection. %s:getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s -local: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetoutsendrequest receive aborted waiting for remote to finish abort. receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)bindlistenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnSTOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s abortresetrunique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteftphttpFTPSERVERPORTftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssu46Aadegimno:pP:r:tvV--r requires numeric argumentRetrying... mainftp> sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. !$%sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadegimnptVv] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] macdefmachineaccountpasswdpasswordlogindefaultHOME%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %sruserpassstringlistAlready connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamfile8binarySYSTRemote system type is %s. 215 UNIX Type: L8Using %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. anonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$initftp_loginsorry, arguments too long. (%s) TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.remglob%s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! confirm%s: not foundSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. KMGTP %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterA.%lld byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d ptransferA.>?P$,$,$,$,$,$,$,$,$,x$,p$,h$,` $,X@$,P$,H$,@$,8$,0softdepforcereloadupdatesyncasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:realpath %sffsmount table fullspecified device does not match mounted devicefilesystem not supported by kernelfilesystem must be mounted read-only; you may need to run fsck%s on %s: %smainusage: mount_ffs [-o options] special node ,-o %s: option not supported/etc/dhclient.conf/var/db/dhclient.leases/var/run/dhclient.pidFAILalias_routehandler-pbinding to user-specified port %d-d-D-cf-pf-lf-q-u-1specified_interfaceInsufficient memory to %s %srecord interface%s %s2.0pl5-OpenBSDdhcpcudpcan't open and lock %s: %mNBINo broadcast interfaces found - exiting.PREINITAF_ROUTE%sUsage: %s [-c1u] [-p ] [-lf lease-file] [-pf pidfile] [interface]ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.BOOTREPLY from %s rejected.DHCPOFFERDHCPNACKDHCPACK%s from %s rejected.BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.dhcpoffer: no memory for option %dInvalid lease option - ignoring offerdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.DHCPNAK from %sDHCPNAK with no active lease. No valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %dDHCPRELEASE on %s to %s port %dwcan't create %s: %mlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } script_init: no memory for environment initializationPATH=/usr/bin:/usr/sbin:/bin:/sbininterfacemediumreasonip_addressnetwork_numberbroadcast_addressfilenameserver_nameno space to %s %sprepend optionappend option%dexpiryscript_write_paramsREASON=NBIfork: %mwait: %mexecve (%s, ...): %mscript_goscript_set_env: no memory for variablescript_set_env: no memory for variable assignment%s%s=%sCan't fork daemon: %mCan't create %s: %mCan't fdopen %s: %m%ld Invalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xoption_as_string: bad code %d \%03odhcp option too largerno memory for client state.no memory for client config.Corrupt lease file - possible data loss!hardware address parameter %snot allowed here.nested interface declaration.expecting a statement.semicolon expected.expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal dataexpected option name.%s: unexpected option name.%s: too many options.expecting semicolon.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.Insufficient memory to record interface %sno memory for state on %s no memory for config for %s no memory for lease. unterminated lease declaration.expecting lease declaration.expecting identifier after option keyword.no memory for vendor information.expecting identifier after '.'no vendor named %s.no option named %sno option named %s for vendor %sexpecting string.option data buffer %soverflowexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.parse_option_declExpecting media options.parse tmpno memory for string list entry.expecting IP address.no memory for reject list!parse_reject_statementNo memory for %s.dfree %s: free on null pointer.unable to allocate tree cache for %s.getifaddrs faileddiscover_interfacesInsufficient memory to %s %srecord interfaceno space to remember ifp.Multiple %s %s: %s %sinterfaces match thesame subnetInterface %s matches %smultiple shared networkssame shared network%s: not foundNo subnet declaration for %s (%s).Please write a subnet declaratio . ..chowndmesgfsck_ffs*Vfsckreboothaltifconfig*Vdhclient*Vinitpmknod\mountL mount_cd96602`( mount_ffsV mount_nfsVnewfspingping6rtsolrouteumountdhclient-script disklabelV`restore .A..#!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet alias $alias_ip_address netmask $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -n -a | sed -n -e 's/^.*(\(.*\)) at .*$/arp -d \1/p' | sh >/dev/null 2>&1 } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do route add default $router >/dev/null 2>&1 break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium ifconfig $interface inet -alias 0.0.0.0 $medium >/dev/null 2>&1 sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface inet 0.0.0.0 netmask 0.0.0.0 broadcast 255.255.255.255 up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || \ [ "$reason" = REBOOT ] || \ [ -z "$old_ip_address" ] || \ [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet -alias $new_ip_address $medium delete_old_routes exit 1 ;; esac exit 0  (@haB   @@haB,C( @@=@@<@`dT U@haL@@(?(0pLl A@haC@ham8C@ham8CpA@haC X@haC X@haC X SGW@haG8@haG"@haH (;1!@haKׄ@haKׄ@haL!`5^ua@haKp@haKp@haL UK!@haK@haK@haL!`oa@haK9@haK9@haL U[5!@haKt@haKt@haL!`1/N a@haKk @haKk @haL UL!@haK8@haK8@haL!`ȡa@haK4΀@haK4΀@haL!`ϾA!@haKe@haKe@haL!`Ga@haKe@haKe@haL!`f!@haK(@haK(@haL!`Oa@haK /@haK /@haL!`h>!@haK U@haK U@haL!`]na@haK!@haK!@haL!`YF!@haK"@haK"@haL!`Q*ja@haK#*@haK#*@haL!`D!@haK#F@haK#F@haL!`/a@haK$s@haK$s@haL!``GL!@haK% @haK% @haL!`w\$a@haK&%@haK&%@haL!`KN!@haK'V@haK'V@haL!`9aa@haK'c@haK'c@haL!`i!@haK(@haK(@haL!``P9a@haK) @haK) @haL!`Z!@haK*Q@haK*Q@haL!`&&۷a@haK*T@haK*T@haL!`.yG!@haK+@haK+@haL!`!#/Ta@haK,@haK,@haL" Ħ1!@haK-L@haK-L@haL" Wa@haK-D@haK-D@haL"!1]!@haK.}@haK.}@haL"!?w&a@haK/@haK/@haL""-(!@haK0G@haK0G@haL""Sa@haK05@haK05@haL"#'!@haK2b@haK2b@haL"#a@haK2@haK2@haL"$@U0#!@haK3B@haK3B@haL"$a@haK4s@haK4s@haL"%蟥!@haK5 R@haK5 R@haL"%Z Ua@haK5@haK5@haL"&ck!@haK6=@haK6=@haL"&̉a@haK7n@haK7n@haL"'14!@haK8C@haK8C@haL"'֚a@haK8ـ@haK8ـ@haL"(@0^!@haK9@haK9@haL"(.a@haK:i@haK:i@haL")<!@haK;3@haK;3@haL")a@haL@haL@haL"*m2!!@haL1-@haL1-@haL"*_7Ya@haLÀ@haLÀ@haL"+S!@haLbZ@haLbZ@haL"+'wa@haL@haL@haL",!@haL]J@haL]J@haL",z(a@haL@haL@haL"-,Sn!@haLw@haLw@haL"-da@haL@haL@haL".H8!@haLX;@haLX;@haL".o8!,a@haLр@haLр@haL"/J!@haL !@haL !@haL"/a@haL @haL @haL(G!@haL S+@haL S+@haLjan in your %sdhcpd.conf file for thenetwork segment to which interface %s %sis attached.discover_interfacesInsufficient memory to record fallback interface.fallbackparse_statementNo memory for shared subnetfallback-netCan't allocate poll structures.No live interfaces to poll on - exiting.poll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %minterface_statuslocate_networkCan't allocate timeout structure!can't allocate protocol struct for %snew_hashadd_hashCan't add %s to hash table.delete_hash_entryfind_host_for_networkNo shared network for network %s (%s)Address range %s to %s, netmask %s spans %s!multiple subnetsAddress range %s to %s not on net %s/%s!new_address_rangeNo memory for address range %s-%s.No hostname for %sno memory for hostname %s.new_address_range%ssubnet %s/%d conflicts with subnet %s/%dWarning: subnet_inner_thanenter_leaseNo memory for lease %s Lease conflict at %scorrupt lease uid.Released lease for IP address %srelease_leaseAbandoning IP address %s for %d seconds: %sabandon_leaseadd_class%s: can't allocate new groupCan't rewrite lease databaseCan't commit leases to new database: %mSubnets: Subnet %s netmask %sShared networks: %s Last Lease:%02x Lease %s%Y/%m/%d %H:%M:%S start %s end %s stamp %s hardware addr = %s host %s print_leasepacket length %dop = %d htype = %d hlen = %d hops = %dxid = %x secs = %d flags = %xciaddr = %syiaddr = %ssiaddr = %sgiaddr = %schaddr = %02x:%02x:%02x:%02x:%02x:%02xfilename = %sserver_name = %s %s = %s%s%03x: %02xdump_rawhash bucket %d:/dev/bpf%dNo bpf devices.%s%s%s Please read the README section for your operating system.Can't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfSending on BPF/%s/%s%s%s/Can't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mListening on BPF/%s/%s%s%sfallbacksend_packet: %msend_packetattempted to reinitialize icmp protocolicmpunable to create icmp socket: %mUnable to disable SO_DONTROUTE on ICMP socket: %mattempt to use ICMP protocol before initialization.icmp_echorequest %s: %micmp_echorequesticmp_echoreply: %micmp_echoreplycScoption %s (%d) %s.larger than bufferMany bogus options seen in offers.Taking this offer in spite of bogusoptions - hope for the best!rejecting bogus offer.parse_option_bufferCan't allocate storage for option %s.Can't expand storage for option %s.cons_optionspretty_print_option: bad code %d %s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of array\%03o%ld%d%xtruefalseUnexpected format code %cdhcp option too largepretty_print_optionDiscarding packet with invalid hlen.do_packetdo_packetconsno memory for cons.tree_cachetree_host_lookupNo memory for host lookup tree node.enter_dns_hostCan't allocate space for new host.tree_constNo memory for constant data tree node.tree_concatNo memory to concatenate constants.No memory for data tree concatenation node.tree_limittree_evaluateBad node id in tree: %d.%s: host unknown.%s: temporary name server failure%s: name server failed%s: no A record associated with addressdo_host_lookupeof in string constantstring constant larger than internal buffernumeric token larger than internal buffertoken larger than internal bufferlways-reply-rfc1048ppendllowliasbandoneduthoritativeackoff-cutoffootpootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefault-lease-timeynamic-bootp-lease-cutoff-lease-lengththernetndsxpireilenameixed-addressddiroupet-lease-hostnamesostardwareostnamenitial-intervalnterfaceeaseax-lease-timeediaumameserveretmaskext-serverotptionne-lease-per-clientrependacketangeequestequireetryenewebindebootejectearchtartsubnethared-networkerver-nameerver-identifierelect-timeoutendcriptupersedeimestampimeoutoken-ringser-class-host-decl-names-lease-addr-for-default-routeidnknown-clientsendor-class%s exiting.exiting. %s line %d: %s%s^^ subnet_numberip_addrbroadcast_addrhost_addr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetsCan't create dhcp socket: %mCan't set SO_REUSEADDR option on dhcp socket: %mCan't set SO_REUSEPORT option on dhcp socket: %mCan't set SO_BROADCAST option on dhcp socket: %mCan't bind to dhcp address: %mCan't bypass auth IPsec on dhcp socket: %mCan't bypass ESP transport on dhcp socket: %mCan't bypass ESP network on dhcp socket: %mif_register_socketSending on Socket/%s%s%s/send_fallback: %msend_fallback: please consult README file %sregarding broadcast address.fallback_discard: %mfallback_discardeoption-endoption-254option-253option-252option-251option-250option-249option-248option-247option-246option-245option-244option-243option-242option-241option-240option-239option-238option-237option-236option-235option-234option-233option-232option-231option-230option-229option-228option-227option-226option-225option-224option-223option-222option-221option-220option-219option-218option-217option-216option-215option-214option-213option-212option-211option-210option-209option-208option-207option-206option-205option-204option-203option-202option-201option-200option-199option-198option-197option-196option-195option-194option-193option-192option-191option-190option-189option-188option-187option-186option-185option-184option-183option-182option-181option-180option-179option-178option-177option-176option-175option-174option-173option-172option-171option-170option-169option-168option-167option-166option-165option-164option-163option-162option-161option-160option-159option-158option-157option-156option-155option-154option-153option-152option-151option-150option-149option-148option-147option-146option-145option-144option-143option-142option-141option-140option-139option-138option-137option-136option-135option-134option-133option-132option-131option-130option-129option-128option-127option-126option-125option-124option-123option-122option-121option-120option-119option-118option-117option-116option-115option-114option-113option-112option-111option-110option-109option-108option-107option-106option-105option-104option-103option-102option-101option-100option-99option-98option-97option-96option-95option-94option-93option-92option-91option-90option-89option-88nds-contextnds-tree-namends-serversoption-84option-83option-82option-81option-80option-79option-78user-classstreettalk-directory-assistance-serverstreettalk-serverirc-serverfinger-serverwww-servernntp-serverpop-serversmtp-servermobile-ip-home-agentbootfile-nametftp-server-namenisplus-serversnisplus-domainoption-63option-62dhcp-client-identifierdhcp-class-identifierdhcp-rebinding-timedhcp-renewal-timedhcp-max-message-sizedhcp-messageBAdhcp-parameter-request-listdhcp-server-identifierdhcp-message-typedhcp-option-overloaddhcp-lease-timedhcp-requested-addressx-display-managerfont-serversnetbios-scopenetbios-node-typenetbios-dd-servernetbios-name-serversvendor-encapsulated-optionsntp-serversnis-serversnis-domaintcp-keepalive-garbagetcp-keepalive-intervaldefault-tcp-ttlieee802-3-encapsulationarp-cache-timeouttrailer-encapsulationstatic-routesrouter-solicitation-addressrouter-discoverymask-supplierperform-mask-discoverybroadcast-addressall-subnets-localinterface-mtuSApath-mtu-plateau-tableLpath-mtu-aging-timeoutBdefault-ip-ttlmax-dgram-reassemblyIIApolicy-filternon-local-source-routingfip-forwardingextensions-pathroot-pathswap-serverdomain-nametmerit-dumpSboot-sizeXhost-nameresource-location-serversimpress-serverslpr-serverscookie-serverslog-serversdomain-name-serversien116-name-serverstime-serversIAroutersltime-offsetIsubnet-maskpadunknown-255unknown-254unknown-253unknown-252unknown-251unknown-250unknown-249unknown-248unknown-247unknown-246unknown-245unknown-244unknown-243unknown-242unknown-241unknown-240unknown-239unknown-238unknown-237unknown-236unknown-235unknown-234unknown-233unknown-232unknown-231unknown-230unknown-229unknown-228unknown-227unknown-226unknown-225unknown-224unknown-223unknown-222unknown-221unknown-220unknown-219unknown-218unknown-217unknown-216unknown-215unknown-214unknown-213unknown-212unknown-211unknown-210unknown-209unknown-208unknown-207unknown-206unknown-205unknown-204unknown-203unknown-202unknown-201unknown-200unknown-199unknown-198unknown-197unknown-196unknown-195unknown-194unknown-193unknown-192unknown-191unknown-190unknown-189unknown-188unknown-187unknown-186unknown-185unknown-184unknown-183unknown-182unknown-181unknown-180unknown-179unknown-178unknown-177unknown-176unknown-175unknown-174unknown-173unknown-172unknown-171unknown-170unknown-169unknown-168unknown-167unknown-166unknown-165unknown-164unknown-163unknown-162unknown-161unknown-160unknown-159unknown-158unknown-157unknown-156unknown-155unknown-154unknown-153unknown-152unknown-151unknown-150unknown-149unknown-148unknown-147unknown-146unknown-145unknown-144unknown-143unknown-142unknown-141unknown-140unknown-139unknown-138unknown-137unknown-136unknown-135unknown-134unknown-133unknown-132unknown-131unknown-130unknown-129unknown-128unknown-127unknown-126unknown-125unknown-124unknown-123unknown-122unknown-121unknown-120unknown-119unknown-118unknown-117unknown-116unknown-115unknown-114unknown-113unknown-112unknown-111unknown-110unknown-109unknown-108unknown-107unknown-106unknown-105unknown-104unknown-103unknown-102unknown-101unknown-100unknown-99unknown-98unknown-97unknown-96unknown-95unknown-94unknown-93unknown-92unknown-91unknown-90unknown-89unknown-88unknown-87unknown-86unknown-85unknown-84unknown-83unknown-82unknown-81unknown-80unknown-79unknown-78unknown-77unknown-76unknown-75unknown-74unknown-73unknown-72unknown-71unknown-70unknown-69unknown-68unknown-67unknown-66unknown-65unknown-64unknown-63unknown-62unknown-61unknown-60unknown-59unknown-58unknown-57unknown-56unknown-55unknown-54unknown-53unknown-52unknown-51unknown-50unknown-49unknown-48unknown-47unknown-46unknown-45unknown-44unknown-43unknown-42unknown-41unknown-40unknown-39unknown-38unknown-37unknown-36unknown-35unknown-34unknown-33unknown-32unknown-31unknown-30unknown-29unknown-28unknown-27unknown-26unknown-25unknown-24unknown-23unknown-22unknown-21unknown-20unknown-19unknown-18unknown-17unknown-16unknown-15unknown-14unknown-13unknown-12unknown-11unknown-10unknown-9fddiunknown-7token-ringunknown-5unknown-4unknown-3unknown-2ethernetunknown-0dhcpCan't allocate dhcp option hash table.semicolon expected.filename must be a stringno memory for string %s.expecting an identifier in hostnamecan't allocate temp space for hostname.can't allocate space for hostname.expecting a network hardware typehardware address too longexpecting semicolon.Expecting numeric lease timecan't allocate space for numeric aggregatetoo few numbers.unexpected end of fileexpecting numeric value.no temp space for number.can't allocate space for numeric aggregate.Bogus number: %s.Bogus number: %s: digit %d not in base %dvalue %s%o exceeds max (%d) for precision.-value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dnumeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.haltdlnpq%sreboot???halted (with powerdown) by %shalted by %srebooted by %s~shutdownSIGTSTP init/etc/rc/dev/consolerevokesetsidopen/bin/shshSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): mainusage: %s [-dlnpq] cannot seek temp fileout of memorycannot read temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read filecbc_decodeinvalid pattern delimiter p unexpected end-of-file& no previous commandout of memoryrcannot open input filecannot close input file%lu newline inserted newline appended out of memorycannot read input filewcannot open output filecannot close output filecannot write fileunexpected end-of-filestdincannot read stdin%d \  \abfnrtv\@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] HOMEp:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-filenumber out of rangeinvalid addressinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%d ! unknown commandno matchfilename too longout of memoryshell access restrictedno previous command invalid mark charactered.hup/ed.huphandle_hup..invalid pattern delimiterno previous patternout of memoryunbalanced brackets ([])trailing backslash (\)number out of rangeno previous substitutionout of memoryno matchinfinite substitution loop out of memorynothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_read%soverwrite %s? readlink: %sunlink: %ssymlink: %scopy_linkmkfifo: %smknod: %sutimes: %schown: %schflags: %slchown: %susage: %s [-R [-H | -L | -P]] [-fip] src target %s [-R [-H | -L | -P]] [-fip] src1 ... srcN directory $0$($ H.gzdeflatezcatzipcompressunknown program nameGZIP GZIP is too long123456789ab:cdfghlLnNOo:qrS:tvVoption -a is ignored on this systemillegal bit count -- %s-o argument is too long/dev/stdin-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored%s%s%s: %s%s not a regular file%s: unchanged%s already has %s suffix -- unchanged/dev/stdout%s: unknown suffix: ignored%s%s: name too long%s: input: %soutput: %smain%s%s: won't write compressed data to terminalwfile would grow; left unmodified docompress%s: won't read compressed data from terminal%s: unrecognized file formatrcrc errordodecompressutimes: %schown: %schflags: %soverwrite %s? .-_taztgzzgzZmethod crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) @YOK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out @Yusage: %s [-cdfghOqrtvV] [-b bits] [-S suffix] [-[1-9]] [file ...] 1.2.1put_header `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     error inflate 1.2.1 Copyright 1995-2003 Mark Adler  #+3;CScsLB !1Aa  0@`@@$ $$$$$$$$$incompatible versionbuffer errorinsufficient memorydata errorstream errorfile errorstream endneed dictionary1.2.1HLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sinvalid file mode: %s%s: %s%sfts_read%s: invalid user name%s: invalid group nameusage: %s [-R [-H | -L | -P]] %s file ... modeflagsusage: %s [-R [-H | -L | -P]] [-f] [-h] %s file ... [owner][:group]group$OpenBSD: dir.c,v 1.16 2003/08/25 23:28:15 tedu Exp $lost+foundwrong type to dirscan %d dirscanDIRECTORY CORRUPTED%s NAME=%s %s=%s DIRFILEfileerrorUNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUSTmkentryUNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u linkupmakeentryNO SPACE LEFT IN %s (EXPANDED) EXPANDexpanddir$OpenBSD: inode.c,v 1.26 2003/10/11 01:43:45 tedu Exp $DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS ckinodePARTIALLY TRUNCATED INODE I=%uiblockblk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot allocate memory for inode cache cannot increase directory listcannot find inode %d %s %sDIRFILECLEAR (CLEARED) I=%u OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%u BAD STATE %d TO BLKERR CG %d: BAD MAGIC NUMBER @(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.25 2003/06/02 20:06:15 millert Exp $dfpnNyYb:c:l:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o usage: %s -p [-f] [-m mode] %s [-f] [-b block#] [-c level] [-y] [-n] [-m mode] [filesystem] ... -%c flag requires a %s ufsffsrwrostarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) %d files missing %d blocks missing The following duplicate blocks remain: %d, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** / ***** REBOOT NOW ***** checkfilesys$OpenBSD: pass1.c,v 1.15 2003/10/11 01:43:45 tedu Exp $phase 1, inode %d/%dPARTIALLY ALLOCATED INODE I=%uCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:cannot read symlink convert symlink %d(%s) of size %llu bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%ucheckinodeBADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.$OpenBSD: pass1b.c,v 1.9 2003/08/25 23:28:15 tedu Exp $phase 1b, inode %d/%dDUP$OpenBSD: pass2.c,v 1.19 2003/10/11 01:43:45 tedu Exp $phase 2, directory %d/%dphase 2, parent directory %d/%dROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORT%s %s: LENGTH %ld NOT MULTIPLE of %dDIRECTORY%s %s: LENGTH %ld NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..'pass2.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (REMOVED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d pass2check$OpenBSD: pass3.c,v 1.8 2003/06/02 20:06:15 millert Exp $phase 3, directory %d/%ld$OpenBSD: pass4.c,v 1.10 2003/10/11 01:43:45 tedu Exp $phase 4, inode %d/%dUNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d $OpenBSD: pass5.c,v 1.17 2003/10/11 01:43:45 tedu Exp $phase 5, cg %d/%dDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ld FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSpass5$OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $%s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s (%s)/r/Can't stat root Can't stat %s %s is not a character device malloc failedrealloc failedstrdup failed$OpenBSD: setup.c,v 1.21 2003/09/25 04:19:39 deraadt Exp $RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedntfsadoscd9660lfsmsdosffsCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for cylinder group summary area BAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead setupMAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATE%s: BAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) ioctl (GCINFO): %s %s: can't read disk label $OpenBSD: utilities.c,v 1.20 2003/08/25 23:28:15 tedu Exp $bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] cannot allocate buffer pool deadlocked buffer pool WRITING %sZERO'ED BLOCK %d TO DISK PARTIALLY CANNOT %s: BLK %dProgram terminated UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) SEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:CG %d: BAD MAGIC NUMBER /?..returning to single-user after filesystem check catchquit%s (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d /dev/tty: catchinfoffs_isblockffs_clrblockffs_setblockffs_isfreeblock?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@init: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/bin/sh-sh/dev/consolePATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingsingle_usersh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode~rebootsession database close: %ssession database open: %sinsert %d: %sdelete %d: %s %s%s/dev/%s %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %d shutdowncan't exec %s for %s %s: %msome processes would not die; ps axl advised ,-o %s: option not supportedupdateasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dT:a:b:c:d:e:f:i:m:o:s:NOS:T:a:b:c:d:e:f:g:h:i:k:l:m:n:o:p:qr:s:t:u:x:z:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracksffs%s: bad sectors/track%s: bad spare sectors per cylindernewfs_%s%s/newfs_%s/sbin/usr/sbin%s not foundswap%sr%s/dev/%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% %s (%d) %s (%lu) Warning: calculated sectors per cylinderdisagrees with disk labelNumber of cylinders restricts cylinders per group to %d. mfs:%dstatfs %swaitpid%s: mount: %sabnormal termination/mainioctl (GDINFO)ioctl (WDINFO)%s: can't rewrite disk label-z tracks/cylinder-x spare sectors per cylinder-u sectors/track-t file system type-s file system size (sectors)-r revolutions/minute-p spare sectors per track-o optimization preference (`space' or `time')-n number of distinguished rotational positions-m minimum free space %%-l hardware sector interleave-k sector 0 skew, per track-i number of bytes per inode-h average files per directory-g average file size-f frag size-e maximum blocks per file in a cylinder group-d rotational delay between contiguous blocks-c cylinders/group-b block size-a maximum contiguous blocks-T disktype-S sector size-O create a 4.3BSD format filesystem-N do not create file system, just print out parametersusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s callocmmappreposterous size %dpreposterous ntrak %dpreposterous nsect %dillegal expected average file size %dillegal expected number of files per directory %dblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %dno block size to support this diskWith a block size of %d %s %ld minimum bytes per inode isMinimum bytes per inode is %ld With %d bytes per inode, minimum cylinders per group is %ld With %d sectors per cylinder, %s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment size%s groups must have a multiple of %ld cylinders CylinderWarning: cylinderpanic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders!mapcramped && !inodecrampedBlock size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder (not %d)%s %s %d %s %d.%sWarning: insufficient space in super block for rotational layout tables with nsectand ntrak File system performance may be impaired. inode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increasedfilesystem must have at least %d sectorsWarning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cg summary%s: %d sectors in %d %s of %d tracks, %d sectors cylinders %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %ld, %smkfs>panic: cylinder group too bigcg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 cg 0: bad magic number (0x%06x != 0x%06x)fsinit: inode value %d out of rangerdfs: read error on block %dwtfs: write error on block %disblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d COLUMNSdfiPRrW%s: %s%sfts_read%s: is a directory%s (inode %u): not overwritten due to multiple linksmallocrm_overwriteremove %s? override %s%s%s/%s for %s? check"." and ".." may not be removedusage: %s [-dfiPRrW] file ... weofretensionstatusrewofflrewindofflinefsrfsferaseeomeofdensitybsrbsfblocksizeejectTAPE/dev/rst0f:%s: unknown command%s%s: illegal count%s: %sioctl MTIOCGET76543210WriteProtectMountedSCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) %s=%o%s=%xusage: %s [-f] device usage: %s [-f device] command [ count ] Lost connection to remote host.shelltcpshell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sO%s %d rmtopencloseC statusS I%d %d ioctlrmtioctl%s: %sProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pinvalid file mode: %s%s/%s: %susage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.17 2004/02/17 16:13:33 otto Exp $unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %sread commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])RE error: %scompile_re123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'compile_flagstransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthcompile_trcompile_textunterminated regular expressionexpected context addresswhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'$OpenBSD: main.c,v 1.9 2003/06/10 22:20:50 deraadt Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %sr%s: %s"%s" ..."stdin$OpenBSD: misc.c,v 1.5 2003/06/03 02:56:16 millert Exp $%ssed: %lu: %s: $OpenBSD: process.c,v 1.12 2003/11/07 02:58:23 tedu Exp $%s %s: %s%lu \%d not defined in the RErstdout: %sflush_appendsCOLUMNS\ \ \abfnrtv%03ofirst RE may not be emptyRE error: %sunable to allocate memoryLPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s can't get current directory - %sRnprsu,ne-p: %s-u: %s: %spvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*L#R#UZ#fi#lprtuxponly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s exportreadonly%s[%d]=dprtUx$$-taunaliasalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzbgjob control not enabled%%%*d %*s %s%*d %*d %sbad signal `%s'--ls:Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %d %s%s%s: arguments must be jobs or process IDs%s: %smissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGlm$` |$X $H ,$@ L$0 @$( ($ $ |$ $ $ L$ $ @$ @$ |$ $ $ $ bind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+alias%s: bad numbernothing to shiftSugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad maskc_umask%s: %snot foundprsu,-p: %s-u: %s: %sREPLY%s%s is read onlytrap -- %s bad signal %s%s: bad value%s: cannot %s%s: can only %s %d level(s)$$-setfvShell: %8ss user %8ss system Kids: %8ss user real %8s %8ss real user %8s %8ss user sys %8s :ptime: -%s unknown optiontime: -%s requires an argument$0 l$( L$ $ $ ($ $ $ ڄ$ $ L$ $ |$ d$ ֬$ А$ $ x$ $ L$ $x <$p Ռ*=unset+umaskulimit+truetest+read+=wait*=trap=times*=shift*=set*=return+false*=exit*=exec*=eval*=continue=builtin*=break[*=:*=.-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]-tinternal error: unknown opunexpected operator/operandmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator$$$$x$p)(!-a-o1%s: %s%s$8t$(f$c$d$s$l$m$n$pprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)ulimit: %ctoo many argumentsunlimitedinvalid limit: %s%-20s unlimited %ld exceeds allowable limitbad limit: %sCOLUMNSLINESx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'`\ #% % -% -t%x -D%h p%P %8 %  % $ P$ $ |$ -\$ p$ #T$  $ $ P$ $x +$h -,$X -$H \$@ p$0 $  "$ ,$ 4$ $ $ $ $ @$ $ ($x - $p $` 3$P $0 $ $ +$ #$ #h$ `$ ,H$ ,$ !$ -$ -$x 6<$h 6($X 6$H 2l$@ 3$$8commentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD I-search: x_search_hist nothing to yank yank something first%s%s = %s '%s' cannot bind, not a tty%s: no such functionCPOSIXsubstituteexpand(NULL)%S%s: bad substitution%s: %sparameter null or not set%s: parameter not setfunny $() command: %s%R%s: cannot open $() input.*+?@! HOMEPWDOLDPWD%sPS4%s%scoprocess already exists%s: %s_builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not foundEXECSHELL/bin/sh%s: %s: %sshcomexec: %sFPATH%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %s%%%REPLY-rreadPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %smissing )zero divisormissing :missing ]e:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %ssubstitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrink%s: internal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againbad file descriptorfd not open for readingfd not open for writingillegal file descriptor nameno coprocess/tmp%s/shXXXXXXXX6(% X% H% argument must be %job or process idambiguousno such jobj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlexchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last procwaitlast: no last jobwaitlast: not startedjw:waitlast%s: %sjw:waitforjob not job-controlled[%d] %s%s| 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumeYou have %s%s%s jobs stopped and runningjobsnotifyasyncj_async: job not startedj_async: bad nzombie (%d)zombiej_waitj: tcsetpgrp(%d, %d) failed: %scheck_job: job started (flags 0x%x)checkjob%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%sj_printremove_job: job not found (%s)no closing quote here document `%s' unclosed PS1%dPS2missing ] MAIL_%s you have mail in $_IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }KSH_VERSION%%%x%p%h%%`%`%%X%P%%X%@%8%%%%%%%p%X%H%0% %%%%%%%%%%%%%%%%%%x%p%h%`%X%Pwhovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUlogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliastypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"evalOPTIND=1PPID-i-rHOMEPATHSHELL-xtypesetpdksh/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin/sh-shPWD.RANDOM$ # PS1-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENV%%`%p%%xinclude: %dshell: %dUse `exit' to leave ksh alloc: %s0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%a%%c%%%e%%%i%k%l%X%m%C%xn%pf%h%`%Xb%Pu%@%8%(p%r%%s%h%v%%%%%%xxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacs-usemetaemacsbgnicebraceexpandallexport%-*s %sonoffCurrent option settings set -o %sgetoptionso:A:o;s%s: bad optionparse_args: `%c'%s: is not an identifier%s: bad numbergmatch*+?@! %s%s-%c: unknown option: %s%s-`%c' requires argument%s'\''%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: flags %xshf_read: bsize %dshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: flags %xshf_putchar: no fdshf_write: flags %xshf_write: nbytes %dshf_snprintf: buf %lx, bsize %d0123456789ABCDEF0123456789abcdef(null %s)shf_vfprintftoo many <<'s too many redirections let%s: bad identifier forselect%s: invalid function name %%%%x%p%h %` % % %X %P%H%@%8%(% %{%}%%%%%%%% newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenifunexpectedunmatchedsyntax error: unexpected EOF %S%R?%dsyntax error: `%s' %s aliasexportreadonlytypeset||&&!()%0%8%@%H%P]]<>Error handlerERRUser defined signal 2USR2User defined signal 1USR1Information requestINFOWindow size changeWINCHProfiling timer expiredPROFVirtual timer expiredVTALRMFile size limit exceededXFSZCPU time limit exceededXCPUI/O possibleIOStopped (tty output)TTOUStopped (tty input)TTINChild exitedCHLDContinuedCONTStoppedTSTPStopped (signal)STOPUrgent I/O conditionURGTerminatedTERMAlarm clockALRMBroken pipePIPEBad system callSYSMemory faultSEGVBus errorBUSKilledKILLFloating point exceptionFPEEMT trapEMTAbortABRTTrace trapTRAPIllegal instructionILLQuitQUITInterruptINTHangupHUPSignal 0EXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T%s< <<- << >> >| > <> <&>&%s wdscan: unknown char 0x%x (carrying on)/dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s6(%'8 %'0%'(%' %'%'%& %& %& %& %&%&%&%&%&%&%&LINENOTMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS%s: subscript out of rangebad substitution0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyz%s: bad number%s: is read onlysetstr: %s=%s: assigning to self%0*s%.*s%*s%.*s%-*.*sENVSHELL%s: restricted @(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QB/?^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-usage: %s seconds if%s: destination pathname too longmain%soverwrite %s? override %s%s%s/%s for %s? rename %s to %scannot resolve %s: %scannot rename a mount pointcan't remove %sdo_move%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set times/bin/cpmv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fi] source target %s [-fi] source ... directory %d|&=<>+-*/%:()syntax error%seval5non-numeric argumentdivision by zero%d %s _msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUF%susage: dmesg [-M core] [-N system] ssethostnamegethostname%s mainusage: %s [-s] [name-of-host] $Id: logout.c,v 1.6 2003/06/02 20:18:42 millert Exp $/var/run/utmplogoutRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedntfsadoscd9660lfsmsdosffs%s%sr%s/dev/%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labelreadlabelfs$Id: login_tty.c,v 1.5 2003/06/02 20:18:42 millert Exp $r%s%s%s%c/dev/%s%s%s$NetBSD: getrawpartition.c,v 1.1 1996/05/16 07:03:33 thorpej Exp $/etc/fbtabr /dev/%o%s: bad entry: %s(null):%s: %s: %m/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...login_protect$OpenBSD: fmt_scaled.c,v 1.2 2003/12/27 19:49:51 otto Exp $0B%lld%c%lld.%1lld%c$Id: logwtmp.c,v 1.6 2003/06/02 20:18:42 millert Exp $/var/log/wtmplogwtmp$NetBSD: getmaxpartitions.c,v 1.1 1996/05/16 07:03:31 thorpej Exp $$OpenBSD: fparseln.c,v 1.4 2002/06/09 22:18:43 fgsch Exp $\\#TERMCAP/usr/share/misc/termcapTERMPATHHOME%s/%s.termcap /usr/share/misc/termcaptgetentOOPS?nYacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error ynynfyn: DOMAIN error lgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10log10flog10: SING error log10: DOMAIN error powpowfpow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanhatanhfatanh: DOMAIN error atanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error G??C00=A@A : xxswufsswap ,rwrqrofstabscan/etc/fstabrfstab: : $OpenBSD: strtok.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: rand.c,v 1.7 2003/06/02 20:18:38 millert Exp $$OpenBSD: auth_unix.c,v 1.16 2003/09/20 00:39:39 deraadt Exp $authunix_create: out of memory authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problem$OpenBSD: nice.c,v 1.6 2003/06/02 20:18:34 millert Exp $$OpenBSD: strncat.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $%s: $OpenBSD: bsearch.c,v 1.4 2003/06/02 20:18:37 millert Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىy$1$%s%.*s$md5crypt$OpenBSD: readpassphrase.c,v 1.16 2003/06/17 21:56:23 millert Exp $/dev/tty readpassphrasetcsetattr./%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethersr+ ethers.byaddrether_ntohostethers.bynameether_hostton longjmp botch. IN-ADDR.ARPAgetnetanswerbf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpagetnetbyaddrgetnetbyname/etc/networksr $OpenBSD: strtofflags.c,v 1.3 2003/06/25 21:15:40 deraadt Exp $%U%U%U%T%T%T%T%T%T%T%T%T%Tx%Thnoopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd ,$OpenBSD: swab.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: authunix_prot.c,v 1.4 2001/09/15 13:51:00 deraadt Exp $$OpenBSD: xdr_array.c,v 1.6 2002/08/01 01:05:24 deraadt Exp $xdr_array: out of memory $OpenBSD: rpc_commondata.c,v 1.4 2003/12/31 03:27:23 millert Exp $$OpenBSD: strmode.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: heapsort.c,v 1.6 2003/09/08 16:24:05 deraadt Exp $$OpenBSD: rcmd.c,v 1.48 2003/09/25 21:14:46 millert Exp $RSHshelltcp%urcmd: socket: All ports in use rcmd: socket: %s (invalid)connect to address %s: Trying %s... %s: %s %drcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s rcmd_af0iruserok/etc/hosts.equivr%s/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owneriruserok_sa__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloop$OpenBSD: rcmdsh.c,v 1.8 2003/05/05 22:13:03 millert Exp $/usr/bin/rshrcmdsh: unknown user: %s localhostrcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: setuid(%u): %s /bin/sh-c-lrcmdsh rcmdsh: execvp %s failed: %s No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): Resolver internal errorUnknown resolver error$OpenBSD: rresvport.c,v 1.6 2003/06/03 02:11:35 deraadt Exp $rresvport_af$OpenBSD: setenv.c,v 1.6 2003/06/02 20:18:38 millert Exp $ *** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%xregerror0%d$OpenBSD: system.c,v 1.6 2003/06/02 20:18:38 millert Exp $sh-c/bin/shno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failuresystem errorinvalid value for hintsresolved protocol is unknownunknown/invalid error...$OpenBSD: realpath.c,v 1.10 2003/08/01 21:04:59 millert Exp $./realpath/$OpenBSD: strtoll.c,v 1.2 2003/06/02 20:18:38 millert Exp $//dev/nullMD5Final$OpenBSD: strspn.c,v 1.4 2003/06/11 21:08:29 deraadt Exp $0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL[:<:]][:>:]]%x.0.%x%02x%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%uHOMEglob3.g_opendirg_lstatg_statns_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dipx_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3d__svfscanfRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedntfsadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx$OpenBSD: getcap.c,v 1.21 2003/06/02 20:18:34 millert Exp $%s.dbtcgetentr|:cgetnext$OpenBSD: strcspn.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: random.c,v 1.12 2003/06/02 20:18:38 millert Exp $/dev/arandom$OpenBSD: div.c,v 1.3 2003/06/02 20:18:37 millert Exp $$OpenBSD: strsignal.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: __strsignal.c,v 1.8 2003/06/02 20:18:38 millert Exp $libcUnknown signal: %r%r%r%r%r%r%r%rp%rP%rH%r8%r %r%r%q%q%q%q%q%q%q%qh%qP%q@%q(%q%p%p%p%p%p%pUser defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0LC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLPATH_LOCALE/usr/share/locale%s/%s/%s/%s/%s/%sCPOSIX%s/%s/%sloadlocaleLANG$OpenBSD: strcoll.c,v 1.4 2003/06/11 21:08:29 deraadt Exp $$OpenBSD: strncpy.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $offonsecurelocalrtsctssoftcarmdmbufwindow/etc/ttysr$OpenBSD: rindex.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $/usr/src/lib/libc/gen/closedir.cunion__opendir2$OpenBSD: qsort.c,v 1.8 2003/06/02 20:18:38 millert Exp $/usr/src/lib/libc/gen/readdir.cBLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks__elf_fdnlist%u/etc/grouprgroup.byname%ugroup.bygid: grscan: master.passwd.bynamepasswd.byname__YP!+__has_yppwgetpwnam%umaster.passwd.byuidpasswd.byuidgetpwuid/etc/spwd.db/etc/pwd.db%s: %m$OpenBSD: getnetgrent.c,v 1.14 2003/09/29 15:52:28 deraadt Exp $*netgroup: %mnetgroup: db getnetgroupnetgroup.byusernetgroup.byhostnetgroup: Syntax error `%s'netgroup: Cycle in group `%s'%s.%s(%s,%s,%s) ,/etc/netgroup.db+%s: : %s %s: : %s %s: $OpenBSD: yp_first.c,v 1.7 2003/06/02 03:48:42 deraadt Exp $yp_first: clnt_call$OpenBSD: xdr_ypreq_nokey.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: getopt_long.c,v 1.16 2004/02/04 18:17:25 millert Exp $option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sPOSIXLY_CORRECT/etc/protocolsr $OpenBSD: killpg.c,v 1.5 2003/06/02 20:18:33 millert Exp $/bin/shsh-cexeclexecleexeclpPATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin:.execvp: : path too long sh/bin/shexecvp$OpenBSD: strsep.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: creat.c,v 1.5 2003/06/02 20:18:33 millert Exp $%%~%~%~%~%~%~%~%~x%~p%~`%~H%~8%~(%~%~%}%}%}%}%}%}%}x%}h%}P%}8%} %}%|%|%|%|User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0%%~%~%~%~%~%~%~%~x%~p%~`%~H%~8%~(%~%~%}%}%}%}%}%}%}x%}h%}P%}8%} %}%|%|%|%| error: warning: /etc/malloc.confMALLOC_OPTIONSunknown char in MALLOC_OPTIONS mmap(2) failed, check limits malloc_initallocation failed malloc() has never been called junk pointer, too low to make sense junk pointer, too high to make sense modified (page-) pointer modified (chunk-) pointer chunk is already free pointer to wrong page page is already free freelist is destroyed recursive call in malloc():out of memory in free(): in realloc():$OpenBSD: exit.c,v 1.9 2003/06/02 20:18:37 millert Exp $syslog: unknown facility/priority: %xsyslog_r: unknown facility/priority: %x<%d>%h %e %T %s[%ld]Error %d /dev/console vsyslog_r/dev/logconnectlog_r$OpenBSD: strftime.c,v 1.13 2003/06/04 21:47:58 deraadt Exp $%X%P%H%@%8%0%(% %%%%%%%%%8%%%%%%%%%x%p%h%`%X%P%H%@%8%(%%%%%%%%%%a %b %e %H:%M:%S %Z %YPMAM%a %b %e %T %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJan%c?%02d%2d%Y-%m-%d%03d %H:%M%I:%M:%S %p%ld%lu %d%04d%e-%b-%Y-+_fmt_conv$OpenBSD: getdtablesize.c,v 1.3 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: clnt_udp.c,v 1.20 2003/12/31 03:27:23 millert Exp $clntudp_create: out of memory clntudp_call%%%%% %% %% %tcpudpfbfexplore_numericgethostby*.getanswer: asked for "%s", got "%s"gethostby*.getanswer: asked for "%s %s %s", got type "%s"getanswer/etc/hostsr# _gethtenthosts.bynameipnodes.byname%s.%sres_querydomainNudptcp%ugetnameinfoip6_parsenumeric$OpenBSD: gethostnamadr.c,v 1.59 2003/10/06 19:18:09 millert Exp $gethostby*.getanswer: asked for "%s", got "%s"-_/gethostby*.getanswer: asked for "%s %s %s", got type "%s"getanswerbf%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.arpaip6.intgethostbyaddr/etc/hostsr %u.%u.%u.%uhosts.byaddr_yp_gethtbyaddrhosts.bynameres_query%.*s.%.*sres_querydomainHOSTALIASESr__hostalias __res_nameinquery__res_queriesmatch__res_sendrjeechodiscardsystatdaytimenetstatqotdchargenftp-dataftptelnetsmtptimerlpnamewhoisdomainaptsapfsbootpsbootpctftpfingerlinksupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srv%dicmpigmpggpsttcpuclegpigpnvp-IIpupchaosudp%s;; res options: %s;; ->>HEADER<<- opcode: %s, status: %s, id: %u; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %u, Ans: %u, Auth: %u, Addit: %u;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed __fp_nquery__p_cdnname.__p_fqname %lu %s %s ; proto %u, port %u " "\"?" ;; *** Warning *** OS-type missing ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %u %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 ; LABELS WRONG (%d should be %d) ( %s %u ?%d?;; packet size error (found %ld, dlen was %d) __p_rr%%%%%ANYHESIODHSCHAOSIN%%%%%%%%%%x%p%X%P%H%@%( % % %% %% %% %%%%x%p%`%X%P%H%0%(%%%%%%%%%%%%%%%%x%`%X%0%(%%%%%%% %%!%x%`"%X%8%0%%%%%%%d%%e%x%`f%X%@#%8% %%"any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressAinitdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2inet6edns0?0x%lx?0 secs%d day%ss%d hour%s%d min%s%d sec%s%ld.%.2ld?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %sm%04d%02d%02d%02d%02d%02dABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&fLOCALDOMAIN/etc/resolv.confrbf;#domain lookupsearchnameserver%usortlistoptionsconfRES_OPTIONSenvres_initndots:debuginet6insecure1insecure2edns0$OpenBSD: atoi.c,v 1.3 2003/06/02 20:18:37 millert Exp $01234567890123456789abcdef0123456789ABCDEFinet_pton6ZONEREFZONEINITUPDATEMAUPDATEMUPDATEDAUPDATEDUPDATEA8765NOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14131211109REFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERRORGMT../etc/localtime/usr/share/zoneinfo/tzloadmnposixrules,M4.1.0,M10.5.0TZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d $OpenBSD: strstr.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: strncmp.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~%u.%u.%u.%u%u.%u.%u.%uinet_ntop4%xinet_ntop6$OpenBSD: strcasecmp.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~$OpenBSD: _yp_check.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: yp_get_default_domain.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: bcmp.c,v 1.5 2003/06/02 20:18:38 millert Exp $$OpenBSD: ypmatch_cache.c,v 1.11 2003/06/25 21:51:56 marc Exp $yp_match: clnt_callyp_next: clnt_call$OpenBSD: yp_bind.c,v 1.14 2003/06/02 03:48:42 deraadt Exp $/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFD_yp_dobind$OpenBSD: clnt_perror.c,v 1.15 2002/09/10 05:39:07 deraadt Exp $%s: %s; errno = %s ; low version = %u, high version = %u ; why = %s (unknown authentication error - %d) ; s1 = %u, s2 = %u ... %s%X%8%%%%%%%p%P%0%%%%%%p%XRPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code)%s: %s - %s %s: %s %%p%P%8%%%%Failed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OK$OpenBSD: strerror.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: clnt_tcp.c,v 1.19 2003/12/31 03:27:23 millert Exp $clnttcp_create: out of memory $OpenBSD: auth_none.c,v 1.7 2001/09/15 13:51:00 deraadt Exp $$OpenBSD: rpc_prot.c,v 1.7 2001/09/15 13:51:01 deraadt Exp $$OpenBSD: xdr_mem.c,v 1.9 2002/12/11 22:55:39 millert Exp $bindresvport_sa$OpenBSD: pmap_getport.c,v 1.7 2001/09/15 13:51:01 deraadt Exp $$OpenBSD: pmap_prot.c,v 1.4 2002/02/13 22:36:52 deraadt Exp $$OpenBSD: xdr_rec.c,v 1.9 2002/02/16 21:27:24 millert Exp $xdrrec_create: out of memory : perror$OpenBSD: __strerror.c,v 1.10 2003/06/02 20:18:38 millert Exp $libcUnknown error: NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC_catopen$OpenBSD: errlist.c,v 1.7 2003/06/02 20:18:34 millert Exp $%%%%%%%h%P%8% %%%%%%%%p%X%0% %%%%%%%%h%X%@%0% %%%%%x%X%8% %%%%%%x%H%0%%%%%%x%X%8% %%%%%x%`%P%8% %%%%%%%p%X%@% %%%%%%p%XAttribute not foundIPsec processing failureNeed authenticatorAuthentication errorInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisk quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$OpenBSD: strlcat.c,v 1.11 2003/06/17 21:56:24 millert Exp $$OpenBSD: xdr_ypbind_resp.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypbind_binding.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypbind_resptype.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: strdup.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: xdr_ypreq_key.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_domainname.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_mapname.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypresp_key_val.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_keydat.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypresp_val.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_valdat.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypstat.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr.c,v 1.6 2001/09/15 13:51:01 deraadt Exp $xdr_bytes: out of memory xdr_string: out of memory $OpenBSD: ypprot_err.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: strlcpy.c,v 1.8 2003/06/17 21:56:24 millert Exp $/etc/servicesr ,/$OpenBSD: fgetln.c,v 1.4 2003/06/02 20:18:37 millert Exp $$OpenBSD: index.c,v 1.4 2003/06/02 20:18:38 millert Exp $$OpenBSD: strpbrk.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: strtol.c,v 1.5 2003/06/02 20:18:38 millert Exp $$OpenBSD: strcmp.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: strtoul.c,v 1.5 2003/06/02 20:18:38 millert Exp $$OpenBSD: db.c,v 1.8 2003/06/25 21:15:04 deraadt Exp $$OpenBSD: rec_open.c,v 1.9 2003/06/02 20:18:34 millert Exp $r$OpenBSD: bt_open.c,v 1.11 2003/06/02 20:18:33 millert Exp $TMPDIR%s/bt.XXXXXX/tmptmp$OpenBSD: bt_get.c,v 1.6 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_conv.c,v 1.7 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_put.c,v 1.9 2003/06/02 20:18:33 millert Exp $__bt_put$OpenBSD: bt_delete.c,v 1.8 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_seq.c,v 1.8 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_search.c,v 1.7 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_utils.c,v 1.6 2003/06/02 20:18:33 millert Exp $$OpenBSD: rec_close.c,v 1.9 2003/06/02 20:18:34 millert Exp $$OpenBSD: bt_close.c,v 1.7 2003/06/02 20:18:33 millert Exp $/usr/src/lib/libc/sys/ftruncate.c$OpenBSD: rec_get.c,v 1.8 2003/06/02 20:18:34 millert Exp $$OpenBSD: rec_put.c,v 1.7 2003/06/02 20:18:34 millert Exp $__rec_iput$OpenBSD: rec_delete.c,v 1.7 2003/06/02 20:18:34 millert Exp $$OpenBSD: rec_seq.c,v 1.6 2003/06/02 20:18:34 millert Exp $$OpenBSD: rec_utils.c,v 1.5 2003/06/02 20:18:34 millert Exp $$OpenBSD: bt_overflow.c,v 1.7 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_page.c,v 1.7 2003/06/02 20:18:33 millert Exp $$OpenBSD: rec_search.c,v 1.7 2003/06/02 20:18:34 millert Exp $$OpenBSD: mpool.c,v 1.12 2003/06/02 20:18:34 millert Exp $mpool_new: page allocation overflow. $OpenBSD: getenv.c,v 1.6 2003/06/02 20:18:37 millert Exp $$OpenBSD: vfprintf.c,v 1.20 2003/06/02 20:18:37 millert Exp $__sbprintfInfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.vfprintf__find_argumentsexponent$OpenBSD: strtod.c,v 1.19 2004/02/03 16:52:11 drahn Exp $?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doCA@???5?55?5InfInfinityNaN0A??҇coCa?Ɗ(`ȳ?DPy?@$@@? ((((( AAAAAABBBBBB ((((( $OpenBSD: localeconv.c,v 1.3 1997/07/23 21:14:40 kstailey Exp $%%%%%%%%%%.$OpenBSD: atexit.c,v 1.7 2002/09/14 22:03:14 dhartmei Exp $/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin/usr/src/lib/libc/sys/lseek.c/usr/src/lib/libc/gen/isatty.cisattystack overflow in function %s__stack_smash_handler$OpenBSD: bcopy.c,v 1.3 2003/06/02 20:18:38 millert Exp $$OpenBSD: memchr.c,v 1.6 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: bcopy.c,v 1.3 2003/06/02 20:18:38 millert Exp $$OpenBSD: multibyte.c,v 1.4 2003/06/02 20:18:38 millert Exp $$OpenBSD: hash.c,v 1.16 2003/06/02 20:18:33 millert Exp $%$sniglet^&$OpenBSD: hash_buf.c,v 1.12 2003/06/02 20:18:33 millert Exp $$OpenBSD: hash_func.c,v 1.8 2003/06/02 20:18:33 millert Exp $$OpenBSD: hash_log2.c,v 1.7 2003/06/25 21:15:05 deraadt Exp $$OpenBSD: abort.c,v 1.13 2004/01/20 19:35:17 millert Exp $$OpenBSD: calloc.c,v 1.8 2003/06/02 20:18:37 millert Exp $$OpenBSD: memset.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: memcmp.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: bcopy.c,v 1.3 2003/06/02 20:18:38 millert Exp $$OpenBSD: strtoull.c,v 1.2 2003/06/02 20:18:38 millert Exp $$OpenBSD: bt_split.c,v 1.11 2003/06/02 20:18:33 millert Exp $$OpenBSD: hash_page.c,v 1.14 2003/06/02 20:18:34 millert Exp $HASH: Out of overflow pages. Increase page size TMPDIR%s/_hash.XXXXXX/tmpopen_temp$OpenBSD: hash_bigkey.c,v 1.13 2003/08/06 21:08:05 millert Exp $"@"`"&")"; "Xl"X""x"hL"`"X"P"H"@`"0"(" DX"l"""""""<""""J";">"%D"%D"x*"pD"h"`"X"P "H "@ "0 !"( !" " " 5" C$" Q " T<" " " " " " )" 5p" 8"`$OpenBSD: args.c,v 1.14 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: conv.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: conv_tab.c,v 1.4 2003/06/02 23:32:07 millert Exp $@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.14 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: misc.c,v 1.13 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: position.c,v 1.7 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.16 2003/07/03 22:41:40 tedu Exp $$OpenBSD: getmntopts.c,v 1.5 2003/06/11 06:22:13 deraadt Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.37 2003/07/29 00:24:15 deraadt Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.35 2004/03/16 21:27:47 otto Exp $@"""""""""p""X""P""H"H"8""0"0"("(" " """"@"""""" """""`"P$OpenBSD: getmntopts.c,v 1.5 2003/06/11 06:22:13 deraadt Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.5 2003/06/02 23:32:09 millert Exp $@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. ##.$OpenBSD: cchar.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: gfmt.c,v 1.6 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: key.c,v 1.12 2003/06/11 23:42:12 deraadt Exp $" ","""""""$"|""" ""x`"p"h"`"X"P"HP"@p"8$OpenBSD: modes.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: print.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $"""""""x"p"h"`"X"P"H"@"8"P"H"8"(" """"""""""""""P"8""""""""""x"p"""h""`""""""X/tmp/EdDk.aXXXXXXXXXXy6$OpenBSD: dkcksum.c,v 1.6 2003/07/02 21:22:10 deraadt Exp $$OpenBSD: editor.c,v 1.93 2003/12/29 19:51:34 millert Exp $# H# @# 8# 0# (# # # # # # # # # # # # # # # # # # # # # H# # # x# p# h# `# X# # # P# (# (# (# (# (# (# (# # # # (# (# # (# # (# (# X# (# (# DISKLABEL(8) OpenBSD System Manager's Manual DISKLABEL(8) NNAAMMEE ddiisskkllaabbeell - read and write disk pack label SSYYNNOOPPSSIISS ddiisskkllaabbeell [--cc | --dd | --rr | --tt] [--vv] [--pp _u_n_i_t] _d_i_s_k ddiisskkllaabbeell --ww [--cc | --dd | --rr] [--nnvv] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --ee [--cc | --dd | --rr] [--nnvv] _d_i_s_k ddiisskkllaabbeell --EE [--cc | --dd | --rr] [--nnvv] [--ff _t_e_m_p_f_i_l_e] _d_i_s_k ddiisskkllaabbeell --RR [--nnrrvv] _d_i_s_k _p_r_o_t_o_f_i_l_e ddiisskkllaabbeell --NN | --WW [--nnvv] _d_i_s_k ddiisskkllaabbeell --BB [--nnvv] [--bb _b_o_o_t_1] [--ss _b_o_o_t_2] _d_i_s_k [_d_i_s_k_t_y_p_e] ddiisskkllaabbeell --BBww [--nnvv] [--bb _b_o_o_t_1] [--ss _b_o_o_t_2] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --BBRR [--nnvv] [--bb _b_o_o_t_1] [--ss _b_o_o_t_2] _d_i_s_k _p_r_o_t_o_f_i_l_e [_d_i_s_k_t_y_p_e] DDEESSCCRRIIPPTTIIOONN The ddiisskkllaabbeell utility can be used to install, examine, or modify the la- bel on a disk drive or pack. The disk label contains information about disk characteristics (size, type, etc.) and the partition layout, stored on the disk itself. It is used by the operating system to optimize disk I/O and locate the filesystems resident on the disk. The options are as follows: --BB Install bootstrap code. The --rr flag is implied by --BB and never needs to be specified. --bb Specify the single level boot program, or the primary boot pro- gram, depending on the system boot architecture (single or two-level). --cc Clear the system's in-core copy of the label and update it based on the on-disk label. May not be used in conjunction with the --rr flag. --dd Use the _d_e_f_a_u_l_t label. This ignores any existing OpenBSD parti- tions on the disk. Note that this option will only work for disks that are capable of reporting their geometry, such as SCSI, IDE, and ESDI. May not be used in conjunction with the --rr flag. --EE Use a simple initial label editor, using the command-driven built-in editor described below. --ee Edit an existing disk label using the editor specified in the EDITOR environment variable, or vi(1) if none is specified. --ff _t_e_m_p_f_i_l_e Write entries to _t_e_m_p_f_i_l_e in fstab(5) format for any partitions for which mount point information has been specified. The --ff flag is only valid when used in conjunction with the --EE flag. If _t_e_m_p_f_i_l_e already exists, it will be overwritten. --NN Disallow writing of the pack label area on the selected disk. --nn Make no permanent changes to the disklabel (useful for debugging purposes). --pp _u_n_i_t Print partition sizes and offsets in _u_n_i_t instead of sectors. Valid units are b(ytes), c(ylinders), k(ilobytes), m(egabytes) and g(igabytes). For operations other than displaying a parti- tion the `%' (percent of total) and `&' (percent of free) units are also accepted. --RR Restore a disk label that was formatted in a prior operation and saved in an ASCII file. --rr Causes the label to be read from or written to the disk directly, rather than going through the system's in-core copy of the label. This option may allow a label to be installed on a disk without kernel support for a label, such as when labels are first in- stalled on a system. This flag does not work on a number of ar- chitectures, thus it is not considered the right way to put a new label on a disk. Its use is discouraged. --ss On machines with a two-level bootstrap (such as i386-based systems), specify the secondary boot program. --tt Format the label as a disktab(5) entry. --vv Print additional information during operation (verbose mode). --WW Allow writing of the pack label area on the selected disk. --ww Write a standard label on the designated drive. _d_i_s_k Specify the _d_i_s_k to operate on. It can be specified either by its full pathname or an abbreviated disk form. In its abbreviat- ed form, the path to the device, the `r' donating "raw device", and the slice, can all be omitted. For example, the first IDE disk can be specified as either _/_d_e_v_/_r_w_d_0_c, _/_d_e_v_/_w_d_0_c, or _w_d_0. _d_i_s_k_t_y_p_e Specify a _d_i_s_k_t_y_p_e entry from the disktab(5) database. _p_a_c_k_i_d Specify a pack identification string for the device (see below). _p_r_o_t_o_f_i_l_e Used with the restore option (--RR) to specify a file to read an ASCII label from. The first form of the command (read) is used to examine the label on the named disk drive. It will display all of the parameters associated with the drive and its partition layout. Unless the --rr flag is given, the kernel's in-core copy of the label is displayed; if the disk has no la- bel, or the partition types on the disk are incorrect, the kernel may have constructed or modified the label. The second form of the command (write) is used to write a standard label on the designated drive. The drive parameters and partitions are taken from that file. If different disks of the same physical type are to have different partitions, it will be necessary to have separate disktab en- tries describing each, or to edit the label after installation as de- scribed below. The optional argument is a pack identification string, up to 16 characters long. The pack ID must be quoted if it contains blanks. If the --rr flag is given, the disk sectors containing the label and boot- strap will be written directly. A side-effect of this is that any exist- ing bootstrap code will be overwritten and the disk rendered unbootable. If --rr is not specified, the existing label will be updated via the in- core copy and any bootstrap code will be unaffected. If the disk does not already have a label, the --rr flag must be used. In either case, the kernel's in-core label is replaced. In the third form of the command (edit), the label is read from the in- core kernel copy, or directly from the disk if the --rr flag is also given. The label is formatted and then supplied to an editor for changes. If no editor is specified in an EDITOR environment variable, vi(1) is used. When the editor terminates, the formatted label is reread and used to rewrite the disk label. Existing bootstrap code is unchanged regardless of whether --rr was specified. The initial label editor mode (fourth form) is only intended for new disks as it will move partitions around as necessary to maintain a con- tiguous pool of free blocks. Some commands or prompts take an optional unit. Available units are `b' for bytes, `c' for cylinders, `k' for kilobytes, `m' for megabytes, and `g' for gigabytes. Quantities will be rounded to the nearest cylinder when units are specified for sizes (or offsets). Commands may be aborted by entering `^D' (Control-D). Enter- ing `^D' at the main `>' prompt will exit the editor. At prompts that request a size, `*' may be entered to indicate the rest of the available space. The editor commands are as follows: ?? [_c_o_m_m_a_n_d] Display help message with all available commands. A _c_o_m_m_a_n_d may be specified to get more detailed help. There is also (simple) context-sensitive help available at most prompts. aa [_p_a_r_t] Add new partition. This option adds a new BSD partition. If no partition letter is specified (a-p), the user will be prompted for one. bb Set OpenBSD disk boundaries. This option tells ddiisskkllaabbeell which parts of the disk it is allowed to modify. This option is probably only useful for ports with fdisk(8) partition ta- bles where the ending sector in the MBR is incorrect. The us- er may enter `*' at the ``Size'' prompt to indicate the entire size of the disk (minus the starting sector). This is useful for disks larger than 8 gigabytes where the fdisk partition table is incapable of storing the real size. cc [_p_a_r_t] Change the size of an existing partition. If no partition is specified, the user will be prompted for one. The new size may be in terms of the aforementioned units and may also be prefixed with `+' or `-' to change the size by a relative amount. DD Sets the disk label to the default values as reported by the kernel. This simulates the case where there is no disk label. dd [_p_a_r_t] Delete an existing partition (or `*' to delete all parti- tions). If no partition is specified, the user will be prompted for one. The `c' partition cannot be deleted. ee Edit drive parameters. This option is used to set the follow- ing parameters: disk type, a descriptive label string, sec- tors/track, tracks/cylinder, sectors/cylinder, number of cylinders, total sectors, rpm, and interleave. gg [_b|_d|_u] Set disk geometry based on what the _B_I_O_S, _d_i_s_k, or _u_s_e_r thinks (the _u_s_e_r geometry is simply what the label said before ddiisskkllaabbeell made any changes). MM Display this manual page. mm [_p_a_r_t] Modify parameters for an existing partition. If no partition is specified, the user will be prompted for one. This option allows the user to change the filesystem type, starting off- set, partition size, and mount point for the specified parti- tion. If expert mode is enabled (see XX below), then block fragment size, block size, and cylinders per group can also be modified. Note that not all parameters are configurable for non-BSD partitions. nn [_p_a_r_t] Name the mount point for an existing partition. If no parti- tion is specified, the user will be prompted for one. This option is only valid if ddiisskkllaabbeell was invoked with the --ff flag. pp [_u_n_i_t] Print the current disk label. If a _u_n_i_t is given, the size and offsets are displayed in terms of the specified unit. qq Quit the editor. If any changes have been made, the user will be asked whether or not to save the changes to the on-disk la- bel. rr Recalculate free space. This option should really not be nec- essary under normal circumstances. ss [_p_a_t_h] Save the label to a file in ASCII format (suitable for loading via the --RR option). If no path is specified, the user will be prompted for one. uu Undo (or redo) last change. Entering _u once will undo the last change. Entering it again will restore the change. ww Write the label to disk. This option will commit any changes to the on-disk label. XX Toggle ``expert mode''. By default, some settings are re- served for experts only (such as the block and fragment size on ffs partitions). xx Exit the editor without saving any changes to the label. zz Zeroes out the existing partition table, leaving only the `c' partition. The drive parameters are not changed. In the restore form of the command (fifth form), the prototype file used to create the label should be in the same format as that produced when reading or editing a label. Comments are delimited by _# and newline. As with --ww, any existing bootstrap code will be clobbered if --rr is specified and will be unaffected otherwise. The sixth form of the command (protect) is used to control write access to the label area of a disk so that the label cannot be inadvertently overwritten. The --NN and --WW options are only available on architectures that support this feature, such as vax, hp300 and some sparc models. The final three forms of ddiisskkllaabbeell are used to install bootstrap code on machines where the bootstrap is part of the label. The bootstrap code is comprised of one or two boot programs, depending on the machine. When installing bootstrap code with the --BB flag, if the names are not ex- plicitly given, standard boot programs will be used. The boot programs are located in _/_u_s_r_/_m_d_e_c. The names of the programs are taken from the ``b0'' and ``b1'' parameters of the disktab(5) entry for the disk if _d_i_s_k_t_y_p_e was given and its disktab entry exists and includes those param- eters. Otherwise, boot program names are derived from the name of the disk. These names are of the form _b_a_s_e_n_a_m_eboot for the primary (or only) bootstrap, and boot_b_a_s_e_n_a_m_e for the secondary bootstrap; for example, _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d if the disk device is _s_d_0. The first of the three boot-installation forms is used to install boot- strap code without changing the existing label. It is essentially a read command with respect to the disk label itself and all options are related to the specification of the boot program as described previously. The final two forms are analogous to the basic write and restore versions ex- cept that they will install bootstrap code in addition to a new label. Note that when a disk has no real BSD disklabel, the kernel creates a de- fault label so that the disk can be used. This default label will in- clude other partitions found on the disk if they are supported on your architecture. For example, on systems that support fdisk(8) partitions the default label will also include DOS and Linux partitions. However, these entries are not dynamic, they are fixed at the time ddiisskkllaabbeell is run. That means that subsequent changes that affect non-OpenBSD parti- tions will not be present in the default label, though they may be updat- ed by hand. To see the default label, run ddiisskkllaabbeell with the --dd flag. ddiisskkllaabbeell can then be run with the --ee flag and any entries pasted as de- sired from the default label into the real one. FFIILLEESS /etc/disklabels Directory for backup labels. /etc/disktab Disk description file. /usr/mdec/_x_xboot Primary bootstrap. /usr/mdec/boot_x_x Secondary bootstrap. EEXXAAMMPPLLEESS Display the in-core label for sd0 as obtained via _/_d_e_v_/_r_s_d_0_c: # disklabel sd0 Create a label for sd0 based on information for ``sd2212'' found in _/_e_t_c_/_d_i_s_k_t_a_b. Any existing bootstrap code will be clobbered. (Normally you do not want to use the --rr flag though.) # disklabel -w -r /dev/rsd0c sd2212 foo Read the on-disk label for sd0, edit it and reinstall in-core as well as on-disk. (Normally you do not want to use the --rr flag though.) Existing bootstrap code is unaffected. # disklabel -e -r sd0 Restore the on-disk and in-core label for sd0 from information in _m_y_l_a_b_e_l. Existing bootstrap code is unaffected. # disklabel -R sd0 mylabel Install a new bootstrap on sd0. The boot code comes from _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and possibly _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d. On-disk and in-core la- bels are unchanged, but on some systems other information may be de- stroyed. Use with care. # disklabel -B sd0 Install a new label and bootstrap. The label is derived from disktab in- formation for ``sd2212'' and installed both in-core and on-disk. The bootstrap code comes from the file _/_u_s_r_/_m_d_e_c_/_n_e_w_b_o_o_t. # disklabel -w -B /dev/rsd0c -b newboot sd2212 DDIIAAGGNNOOSSTTIICCSS The kernel device drivers will not allow the size of a disk partition to be decreased or the offset of a partition to be changed while it is open. Some device drivers create a label containing only a single large parti- tion if a disk is unlabeled; thus, the label must be written to the `a' partition of the disk while it is open. This sometimes requires the de- sired label to be set in two steps, the first one creating at least one other partition, and the second setting the label on the new partition while shrinking the `a' partition. On some machines the bootstrap code may not fit entirely in the area al- located for it by some filesystems. As a result, it may not be possible to have filesystems on some partitions of a ``bootable'' disk. When in- stalling bootstrap code, ddiisskkllaabbeell checks for these cases. If the in- stalled boot code would overlap a partition of type FS_UNUSED it is marked as type FS_BOOT. The newfs(8) utility will disallow creation of filesystems on FS_BOOT partitions. Conversely, if a partition has a type other than FS_UNUSED or FS_BOOT, ddiisskkllaabbeell will not install bootstrap code that overlaps it. SSEEEE AALLSSOO disklabel(5), disktab(5), scan_ffs(8) CCAAVVEEAATTSS On i386 machines, installboot(8) is normally used to install boot code. The --BB option to ddiisskkllaabbeell can still be used to install old style boot code, but this usage is deprecated. On some machines, such as the sparc, partition tables may not exhibit the full functionality that is described above. ddiisskkllaabbeell only supports up to a maximum of 15 partitions, `a' through `p', excluding `c'. The `c' partition is reserved for the entire physi- cal disk. By convention, the `a' partition of the boot disk is the root partition, and the `b' partition of the boot disk is the swap partition, but all other letters can be used in any order for any other partitions as desired. BBUUGGSS When a disk name is given without a full pathname, the constructed device name uses the `a' partition on the tahoe, the `c' partition on all oth- ers. In --EE mode, ddiisskkllaabbeell is far too quick to shuffle partitions around; it should keep a free block list and only move partitions around with the user's permission. Also, in --EE mode, partitions outside the OpenBSD portion of the disk should be changeable. OpenBSD 3.5 October 27, 1997 6  abcdfiklnoprstuvwxBDEGHLPTUXYZ0#[pވ lpޜΘ;|#ZLhވ`lpޜΘ;|#ZnވtlpޜΘ;|#Zn,dtpޜΘ;|#Z(zH?t{w?t wwΘz#Z(wwwΘ;|68z{\.? ;@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.15 2003/06/02 23:32:06 millert Exp $7{~{}`{}{}p{~8{|{{{~{}{}{}{~{}{}{}{{`{{#0#(# $OpenBSD: cmp.c,v 1.5 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.21 2003/08/06 19:09:09 tedu Exp $P.6<$OpenBSD: print.c,v 1.22 2003/09/26 00:48:44 deraadt Exp $$OpenBSD: util.c,v 1.11 2003/08/06 19:09:09 tedu Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. @(#)ping.c 8.1 (Berkeley) 6/5/93.Ad######"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)6A6A#a6B}##ؠb6B@}èa\#؀#`B6B}ø#8#c6B}ð##׸#אd6BA}#p#Xe6B}Ð#8# #f6B}##F6B}Ø#֘#pg6B}#P# #h6B}Ô##ՠHA}#Ո#hi6B}Ìa#H#0#j6B}Ä##J6B!}à#԰#ԘlH_L6B}ü#x#`m6B}#P#@#0n6B"}ì###p6BH`P6B`L#q6B}È#Ө#x#`r6B"}#8##s6B!}Ü#Ҹ#ҘS6B!}#҈#xu6B"}#H#(#V6Baw6B"}##Ѱ#xx6B(b`#h#XX6BA}#0#y6B}ô##z6B}#и#И"6Bd#Ј~6B!}ä#`#@?6Be#6B}#(#.6BA}##} (press RETURN)... (interrupt to abort)#X#ڰ#381@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ @(#)getmntopts.c 8.3 (Berkeley) 3/29/95##`#X#P#@A#0B#(C# D#E#F#G#U#V#a#b#c#e#f#h#i#xL#`l#Pn#Hq#@q#0r# s#v#w#x#u@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.16 2003/07/29 18:38:36 deraadt Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.13 2003/06/02 20:06:15 millert Exp $#h#X#H0123456789abcdef#`#x#X#0#####p#P#0#####` pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATICPROTO2PROTO1 CLONEDUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD#x#x#h#`#X#P#H#@#8#0 #( # # # ################x#p#`#X #H!#@"#8##($# %#&#'#(#)#*#+#,#-#.#/###########~E8##send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macrotoggle use of EPSV/EPRT on IPv4 ftpset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagertoggle passive transfer modetoggle use of PORT/LPRT cmd for each data connectiontoggle preservation of modification time of retrieved filestoggle transfer progress metertoggle interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose mode$6Yrh$6R$x6P}<$p6QM$h6Q0L$`6QHc$X6QhL$P6X|$H6QD$@6QiP$86Q$06R{$(6R|$ 6RPt$6Rg$6Rk$6Rn$6R|$6Sc8$6X|$6S0Mt$6R0x$6XHV|$6SPe$6Sg$6Sc$6S$6T{$6QhL$6T@jt$6V<$6T`v$6Tn$x6T($p6Tl4$h6Tp$`6U[,$X6UwX$P6U@p$H6UpM@$@6U$86V<$06UO$(6UO$ 6U$6Vn$6V0$6V`$6R0x$ 6V<$ 6V8$ 6Wg$ 6WXet$ 6Wxe$ 6W~$ 6YpM$ 6Wvh$ 6X|$ 6X(y$ 6XHV|$ 6XXVX$ 6Xm$ 6Xl$ x6Xh$ p6X|@$ h6Yx4$ `6Y($ X6YH$ P6YpM$ @6VeD$ 86Yy$ 06Z,$ (6Z ^,$ 6Z8M$ 6ZX$ 6Z$ 6ZM$ 6Zcp$ 6ZJ4$ 6Z{$ 6[t|$ 6[(e$ 6SS$@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $"$"$"$!$!$! $!@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.17 2003/07/03 22:41:40 tedu Exp $$OpenBSD: getmntopts.c,v 1.5 2003/06/11 06:22:13 deraadt Exp $Q$.$.0$.HCopyright 1995, 1996, 1997, 1998, 1999 The Internet Software Consortium.All rights reserved.Internet Software Consortium DHCP ClientPlease contribute if you find this software useful.For info, please visit http://www.isc.org/dhcp-contrib.htmlPATH=/usr/bin:/usr/sbin:/bin:/sbin/sbin/dhclient-script( 0(EHC  $jX$jPw,$j@$j8w,$j($j w,$j$jw,$j$jw,$i$jw,$i$jw,$i$jw,$i$jw,$i$jw, $i$jw, $ip$jw, $i`$iXw, $iH$i@w, $i0$i(w,$i$i(w,$i$j8w,$h$i(w,$h$i(w,$h$hw,$h$hw,$h$hw,$h$i@w,$hp$hhw,$hP$hHw,$h0$h(w,$h$i@w,$h$hw,$g$j8w,$g$hw,$g$hw,$g$hw,$g$j8w, $gx$hw,!$g`$hw,"$gH$hHw,#$g0$hw,$$g $hhw,%$g$hHw,&$f$hw,'$f$i(w,($f$jw,)$f$jw,*$f$iXw,+$f$jw,,$fp$jw,-$fX$hhw,.$fH$i(w,/$f8$jw,0$f $jw,1$f$j8w,2$e$hHw,3$e$hhw,4$e$hhw,5$e$j8w,6$e$ew,7$ex$i(w,8$e`$i@w,9$eH$hHw,:$e0$hHw,;$e$i(w,<$e$iXw,=$d$iXw,>$d$iXw,?$d$i(w,@$d$jw,A$d$i(w,B$d$i(w,C$d$jw,D$dp$jw,E$d`$jw,F$dP$jw,G$d@$jw,H$d0$jw,I$d $jw,J$d$jw,K$c$jw,L$c$i(w,M$c$iXw,N$c$iXw,O$c$iXw,P$c$iXw,Q$c$iXw,R$cp$iXw,S$c`$iXw,T$cP$jw,U$c@$iXw,V$c0$iXw,W$c $iXw,X$c$iXw,Y$c$iXw,Z$b$iXw,[$b$iXw,\$b$iXw,]$b$iXw,^$b$iXw,_$b$iXw,`$b$iXw,a$b$iXw,b$bp$iXw,c$b`$iXw,d$bP$iXw,e$b@$iXw,f$b0$iXw,g$b $iXw,h$b$iXw,i$b$iXw,j$a$iXw,k$a$iXw,l$a$iXw,m$a$iXw,n$a$iXw,o$a$iXw,p$a$iXw,q$a$iXw,r$ap$iXw,s$a`$iXw,t$aP$iXw,u$a@$iXw,v$a0$iXw,w$a $iXw,x$a$iXw,y$a$iXw,z$`$iXw,{$`$iXw,|$`$iXw,}$`$iXw,~$`$iXw,$`$iXw,$`$iXw,$`$iXw,$`p$iXw,$``$iXw,$`P$iXw,$`@$iXw,$`0$iXw,$` $iXw,$`$iXw,$`$iXw,$_$iXw,$_$iXw,$_$iXw,$_$iXw,$_$iXw,$_$iXw,$_$iXw,$_$iXw,$_p$iXw,$_`$iXw,$_P$iXw,$_@$iXw,$_0$iXw,$_ $iXw,$_$iXw,$_$iXw,$^$iXw,$^$iXw,$^$iXw,$^$iXw,$^$iXw,$^$iXw,$^$iXw,$^$iXw,$^p$iXw,$^`$iXw,$^P$iXw,$^@$iXw,$^0$iXw,$^ $iXw,$^$iXw,$^$iXw,$]$iXw,$]$iXw,$]$iXw,$]$iXw,$]$iXw,$]$iXw,$]$iXw,$]$iXw,$]p$iXw,$]`$iXw,$]P$iXw,$]@$iXw,$]0$iXw,$] $iXw,$]$iXw,$]$iXw,$\$iXw,$\$iXw,$\$iXw,$\$iXw,$\$iXw,$\$iXw,$\$iXw,$\$iXw,$\p$iXw,$\`$iXw,$\P$iXw,$\@$iXw,$\0$iXw,$\ $iXw,$\$iXw,$\$iXw,$[$iXw,$[$iXw,$[$iXw,$[$iXw,$[$iXw,$[$iXw,$[$iXw,$[$iXw,$[p$iXw,$[`$iXw,$[P$iXw,$[@$iXw,$[0$iXw,$[ $iXw,$[$iXw,$[$iXw,$Z$iXw,$Z$iXw,$Z$iXw,$Z$iXw,$Z$iXw,$Z$iXw,$Z$iXw,$Z$iXw,$Zp$iXw,$Z`$iXw,$ZP$iXw,$Z@$iXw,$Z0$iXw,$Z $iXw,$Z$iXw,$Z$iXw,$Y$iXw,$Y$iXw,$Y$iXw,$Y$iXw,$Y$iXw,$Y$iXw,$Y$iXw,$Y$iXw,$Yp$iXw,$Y`$iXw,$YP$iXw,$Y@$iXw,$Y0$iXw,$Y $iXw,$Y$iXw,$Y$iXw,$X$iXw,$X$iXw,$X$iXw,$X$iXw,$X$Xw,249:;<=   !"#$%&'()*+,-./017>?@ABCDEFGHIJKLNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~$zH$z8$z($z$z$y$y$y$y$y$y$y$y$y$yp$y`$yP$y@$y0$y $y$y$x$x$x$x$x$x$x$x$xp$x`$xP$x@$x0$x $x$x$w$w$w$w$w$w$w$w$wp$w`$wP$w@$w0$w $w$w$v$v$v$v$v$v$v$v$vp$v`$vP$v@$v0$v $v$v$u$u$u$u$u$u$u$u$up$u`$uP$u@$u0$u $u$u$t$t$t$t$t$t$t$t$tp$t`$tP$t@$t0$t $t$t$s$s$s$s$s$s$s$s$sp$s`$sP$s@$s0$s $s$s$r$r$r$r$r$r$r$r$rp$r`$rP$r@$r0$r $r$r$q$q$q$q$q$q$q$q$qp$q`$qP$q@$q0$q $q$q$p$p$p$p$p$p$p$p$pp$p`$pP$p@$p0$p $p$p$o$o$o$o$o$o$o$o$op$o`$oP$o@$o0$o $o$o$n$n$n$n$n$n$n$n$np$n`$nP$n@$n0$n $n$n$m$m$m$m$m$m$m$m$mp$m`$mP$m@$m0$m $m$m$l$l$l$l$l$l$l$l$lp$l`$lP$l@$l0$l $l$l$k$k$k$k$k$k$k$k$kp$k`$kP$k@$k0$k $k$k$j$j$j$j$j$j$j$j$jp$j`;Zx0N@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.25 2003/06/02 20:06:16 millert Exp $$OpenBSD: buf.c,v 1.16 2003/10/18 19:15:43 jmc Exp ${@$OpenBSD: cbc.c,v 1.12 2003/10/18 19:15:43 jmc Exp $@ $OpenBSD: glbl.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: io.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $$$OpenBSD: main.c,v 1.28 2003/06/11 23:42:12 deraadt Exp $$$H$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.8 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.28 2003/10/30 16:01:43 millert Exp $6($$OpenBSD: utils.c,v 1.25 2003/11/24 04:22:44 mickey Exp $$$$$$@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.17 2004/02/16 22:12:02 millert Exp $$ ... ...$$$$$$$$$$$$$$$$$$$$x$p$`$X$P$H$$@$8$0$($ $$$$$$$$$$$$$$$$$$$$$$$$$$$0$x$x$x$x@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.35 2004/03/16 01:11:09 tedu Exp $ T$OpenBSD: dkcksum.c,v 1.6 2003/07/02 21:22:10 deraadt Exp $$OpenBSD: getmntopts.c,v 1.5 2003/06/11 06:22:13 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.47 2003/11/03 05:40:09 tedu Exp $$$$ȸ$Ȱ$Ȩ$Ș$Ȑ$Ȉ$Ȁ$x$p$h $`@$X@@ @%s: can't read disk label; disk type must be specified$Ҁ$X$H$8$$$$$ѐ$р$h$H$($$$$И$h$H$0$$$$$Ϩ$OpenBSD: mkfs.c,v 1.38 2004/01/13 01:42:08 tedu Exp $......@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.15 2003/06/02 23:32:09 millert Exp $@(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mt.c,v 1.23 2003/06/02 23:32:08 millert Exp $$h$`$X$P$H$@ $8 $0$($ $$$$$$$$@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.16 2003/07/29 00:24:15 deraadt Exp $${}abcdDgGhHilnNpPqrs tw xy !:#=@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $$p$ / P%%"%"%"%"%"%"%"%"%"%"%"x%"h%"`%"X%"P%"@%"8%" %"%" %"%! %!%! %!%! %!%!%!%!%!%!x%!p%!X%!P%!8%!0%!(%! %!%!% % % % % % % % % % x% X% P% 8% 0% % %%%%%%% %% _@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: sleep.c,v 1.16 2003/06/02 23:32:09 millert Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.29 2003/07/29 00:24:15 deraadt Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: dmesg.c,v 1.17 2003/06/02 20:06:14 millert Exp $%,X@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.7 2003/06/02 23:32:08 millert Exp $%.%.%.%-%-%-%-%-%-%-%-%-%-%-%-%.%.%.%.%.%.%.p%.h%.`%.X%.%.P%.H%.@%.8%.0%.(%. %-%-%.%.%.%.%.%.%.%.%.%.%.%.%.%.%.%.%.%.%. %.%.%.BKMGTPE@$OpenBSD: termcap.c,v 1.8 2003/06/02 20:18:42 millert Exp $$OpenBSD: tgoto.c,v 1.3 2003/06/02 20:18:42 millert Exp $$OpenBSD: tputs.c,v 1.3 2003/06/02 20:18:42 millert Exp $5MS7) $OpenBSD: confstr.c,v 1.6 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: cfsetispeed.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: fscanf.c,v 1.6 2003/06/02 20:18:37 millert Exp $$OpenBSD: fstab.c,v 1.12 2003/06/02 20:18:34 millert Exp $%:%:%; l t$OpenBSD: cfgetospeed.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $%<$OpenBSD: linkaddr.c,v 1.3 2003/06/02 20:18:35 millert Exp $0123456789abcdef$OpenBSD: getprotoname.c,v 1.4 2003/06/02 20:18:35 millert Exp $$OpenBSD: vis.c,v 1.12 2003/06/02 20:18:35 millert Exp $$OpenBSD: errx.c,v 1.7 2003/06/02 20:18:34 millert Exp $$OpenBSD: verrx.c,v 1.6 2003/06/02 20:18:35 millert Exp $%<`$OpenBSD: fwrite.c,v 1.3 2003/06/02 20:18:37 millert Exp $$OpenBSD: sethostname.c,v 1.7 2003/07/15 17:32:41 deraadt Exp $$OpenBSD: crypt.c,v 1.18 2003/08/12 01:22:17 deraadt Exp $./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:$OpenBSD: md5crypt.c,v 1.13 2003/08/07 00:30:21 deraadt Exp $./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz%QP$OpenBSD: tcsetattr.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: fputc.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: errno.c,v 1.2 1996/08/19 08:22:34 tholo Exp $$OpenBSD: basename.c,v 1.11 2003/06/17 21:56:23 millert Exp $$OpenBSD: ethers.c,v 1.17 2004/02/16 19:41:12 otto Exp $xx:xx:xx:xx:xx:xx$OpenBSD: setjmperr.c,v 1.3 2003/06/02 20:18:34 millert Exp $$OpenBSD: getnetnamadr.c,v 1.23 2003/06/03 21:09:00 deraadt Exp $$OpenBSD: getnetbyaddr.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: getnetbyname.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: getnetent.c,v 1.9 2003/06/02 20:18:35 millert Exp $$OpenBSD: inet_network.c,v 1.8 2003/06/02 20:18:35 millert Exp $$OpenBSD: alarm.c,v 1.5 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: inet_makeaddr.c,v 1.4 2003/06/02 20:18:35 millert Exp $$OpenBSD: getmntinfo.c,v 1.5 2003/06/02 20:18:34 millert Exp $$OpenBSD: asprintf.c,v 1.10 2003/06/17 21:56:24 millert Exp $%U0$OpenBSD: iso_addr.c,v 1.3 2003/06/02 20:18:35 millert Exp $0123456789abcdef%Up%U%V$OpenBSD: cfgetispeed.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $%V`%V$OpenBSD: times.c,v 1.3 2003/06/02 20:18:35 millert Exp $%V%Y$OpenBSD: herror.c,v 1.5 2003/06/02 20:18:35 millert Exp $%[%[%[%[h%[H$OpenBSD: wait.c,v 1.3 2003/06/02 20:18:35 millert Exp $%\$OpenBSD: sleep.c,v 1.9 2003/06/25 21:15:04 deraadt Exp $%\`$OpenBSD: getlogin.c,v 1.9 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: puts.c,v 1.4 2003/06/02 20:18:37 millert Exp $$OpenBSD: regerror.c,v 1.10 2003/06/02 20:18:36 millert Exp $%_%_%_x%_X%_H%_(%_%_%^%^%^%^%^%^x%^h%^H %^8%^ %^%] %]%] %]%] %]%]p%]`%]H%]8%]%]%\%\%\%_$OpenBSD: fts.c,v 1.34 2003/06/11 21:03:10 deraadt Exp $%bh$OpenBSD: getcwd.c,v 1.9 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: regexec.c,v 1.8 2003/06/02 20:18:36 millert Exp $$OpenBSD: engine.c,v 1.7 2003/06/02 20:18:36 millert Exp $$OpenBSD: vprintf.c,v 1.4 2003/06/02 20:18:37 millert Exp $$OpenBSD: raise.c,v 1.3 2003/06/02 20:18:34 millert Exp $$OpenBSD: daemon.c,v 1.5 2003/07/15 17:32:41 deraadt Exp $$OpenBSD: md5c.c,v 1.15 2002/12/23 21:10:22 drahn Exp $%c@$OpenBSD: tcsetpgrp.c,v 1.5 2003/06/02 20:18:40 millert Exp $$OpenBSD: setbuffer.c,v 1.3 2003/06/02 20:18:37 millert Exp $$OpenBSD: regcomp.c,v 1.11 2003/12/07 06:17:17 otto Exp $%e%e%e%e%eX%e%eP%eH%e%e@%e%e%e%e%e%d%d%e%d%dp%e%dh%d%e%d%c%e%c%c%e%c%c%e%c%c%e%e%j@%j8%j0%j(%j %j%j%j%j%i%i%i %i %i %i %i %i %i %i %i %i %ix%ip%ih%i`%iX%iP%iH%i@%i8%i0%i(%i %i%i%i%i%h%h%h%h%h%h%c %h!%h"%h#%h$%hx%%hh&%hX'%h@(%h()%h*%h+%h,%g-%g-%g.%g.%g/%g/%g0%g1%g2%g3%g4%g5%g6%g7%gx8%gp9%gh:%gX;%gH<%g8=%g >%g?%g@%f[%f\%f\%f]%f^%f^%fx_%fh_%fX`%fH{%f0{%f |%f}%e}%e~%e$OpenBSD: regfree.c,v 1.4 2003/06/02 20:18:36 millert Exp $$OpenBSD: ns_ntoa.c,v 1.13 2003/09/25 21:14:46 millert Exp $$OpenBSD: ipx_ntoa.c,v 1.5 2003/09/26 06:19:25 deraadt Exp $xxxxxxxxH.xx:xx:xx:xx:xx:xx.uuuuu$OpenBSD: glob.c,v 1.22 2003/06/25 21:16:47 deraadt Exp $$OpenBSD: tcgetpgrp.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: cfmakeraw.c,v 1.5 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: ns_addr.c,v 1.8 2003/06/02 20:18:35 millert Exp $$OpenBSD: ipx_addr.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: sscanf.c,v 1.6 2003/06/02 20:18:37 millert Exp $$OpenBSD: vfscanf.c,v 1.9 2003/06/02 20:18:37 millert Exp $  $OpenBSD: fread.c,v 1.4 2003/06/02 20:18:37 millert Exp $$OpenBSD: ungetc.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: disklabel.c,v 1.9 2003/06/11 21:03:10 deraadt Exp $%l@%l8%l0%l(%l %l%l%l%l%k%k%k%k%k%k%l%l%l%l%l%l%l%l%l%l%l@%l%lx%lp%lh%l`%lX%lP%k%k%lH%m %m %m %m %m %m %m %m%m%m%m %m %m%m %l%m %m %lP%m %m %l%n%n?9gt>QNPaPkqj,jH6T7YqϑI 7RǤq)>Oq9NNL(Kɲ@KCS[kA6666l%o($OpenBSD: printf.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: utime.c,v 1.3 2003/06/02 20:18:35 millert Exp $$OpenBSD: ftell.c,v 1.4 2003/06/02 20:18:37 millert Exp $%o`%o$OpenBSD: siglist.c,v 1.3 2003/06/02 20:18:35 millert Exp $$OpenBSD: setlocale.c,v 1.11 2003/06/02 20:18:35 millert Exp $%s@%s0%s %s%s%r%rCCCCCCC%s$OpenBSD: inet_lnaof.c,v 1.4 2003/06/02 20:18:35 millert Exp $$OpenBSD: setmode.c,v 1.12 2003/06/02 20:18:34 millert Exp $%t$OpenBSD: getttyent.c,v 1.6 2003/06/02 20:18:34 millert Exp $%t$OpenBSD: closedir.c,v 1.5 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: seekdir.c,v 1.5 2003/06/02 20:18:34 millert Exp $$OpenBSD: opendir.c,v 1.9 2003/06/02 20:18:34 millert Exp $%u$OpenBSD: telldir.c,v 1.4 2003/06/25 21:16:47 deraadt Exp $$OpenBSD: readdir.c,v 1.6 2003/06/02 20:18:34 millert Exp $$OpenBSD: getbsize.c,v 1.9 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: nlist.c,v 1.47 2004/01/30 23:14:32 millert Exp $pz$OpenBSD: fgetc.c,v 1.3 2003/06/02 20:18:36 millert Exp $$OpenBSD: pwcache.c,v 1.6 2003/06/02 20:18:34 millert Exp $$OpenBSD: getgrent.c,v 1.19 2003/06/02 20:18:34 millert Exp $$OpenBSD: getpwent.c,v 1.31 2003/06/25 21:16:47 deraadt Exp $%wH$OpenBSD: err.c,v 1.8 2003/06/02 20:18:34 millert Exp $$OpenBSD: verr.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: warn.c,v 1.7 2003/06/02 20:18:35 millert Exp $$OpenBSD: vwarn.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: warnx.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: vwarnx.c,v 1.6 2003/06/02 20:18:35 millert Exp $%x%y%yX?%y$OpenBSD: getproto.c,v 1.4 2003/06/02 20:18:35 millert Exp $$OpenBSD: getprotoent.c,v 1.5 2003/06/02 20:18:35 millert Exp $%z$OpenBSD: popen.c,v 1.13 2003/06/02 20:18:34 millert Exp $$OpenBSD: exec.c,v 1.16 2003/06/11 21:03:10 deraadt Exp $%{$OpenBSD: waitpid.c,v 1.5 2003/06/02 20:18:35 millert Exp $$OpenBSD: cfsetospeed.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $%{$OpenBSD: _sys_siglist.c,v 1.2 1996/08/19 08:21:27 tholo Exp $$OpenBSD: siglist.c,v 1.3 2003/06/02 20:18:35 millert Exp $$OpenBSD: siglist.c,v 1.3 2003/06/02 20:18:35 millert Exp $$OpenBSD: malloc.c,v 1.66 2004/02/19 23:20:53 tdeval Exp $%$OpenBSD: syslog.c,v 1.25 2003/06/02 20:18:35 millert Exp $@(#)strftime.c 7.64%$OpenBSD: usleep.c,v 1.8 2003/06/02 20:18:35 millert Exp $$OpenBSD: vsnprintf.c,v 1.6 2003/06/02 20:18:37 millert Exp $$OpenBSD: findfp.c,v 1.4 2003/06/02 20:18:37 millert Exp $6`878`86878`8 6878`86T6`%$OpenBSD: sysconf.c,v 1.5 2003/06/02 20:18:35 millert Exp $%X T $OpenBSD: res_query.c,v 1.21 2003/06/02 20:18:36 millert Exp $$OpenBSD: res_mkquery.c,v 1.14 2003/06/02 20:18:36 millert Exp $$OpenBSD: res_send.c,v 1.15 2003/06/02 20:18:36 millert Exp $$OpenBSD: send.c,v 1.3 2003/06/02 20:18:36 millert Exp $$OpenBSD: setbuf.c,v 1.3 2003/06/02 20:18:37 millert Exp $$OpenBSD: setvbuf.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: res_debug.c,v 1.17 2003/06/02 20:18:36 millert Exp $ d'B@;%$OpenBSD: res_comp.c,v 1.11 2003/06/02 20:18:36 millert Exp $$OpenBSD: tolower_.c,v 1.6 2002/12/13 23:16:38 millert Exp $%$OpenBSD: wbuf.c,v 1.6 2003/06/02 20:18:37 millert Exp $$OpenBSD: res_init.c,v 1.29 2003/06/02 20:18:36 millert Exp $%$OpenBSD: gethostname.c,v 1.5 2003/06/25 21:15:04 deraadt Exp $$OpenBSD: inet_addr.c,v 1.7 2003/06/02 20:18:35 millert Exp $$OpenBSD: inet_pton.c,v 1.4 2002/02/16 21:27:23 millert Exp $$OpenBSD: res_data.c,v 1.2 2003/06/02 20:18:36 millert Exp $%%%%%%%%%%%%%%%%%%%x%h%`%X%%%%P%H%@%8%0%(%$OpenBSD: fputs.c,v 1.4 2003/06/02 20:18:37 millert Exp $@(#)localtime.c 7.76$OpenBSD: localtime.c,v 1.23 2003/10/06 00:17:13 millert Exp $WILDABBR6P6P@(#)asctime.c 7.9$OpenBSD: asctime.c,v 1.7 2000/01/06 08:24:17 d Exp $%%$OpenBSD: nsap_addr.c,v 1.4 1997/07/09 01:08:45 millert Exp $$OpenBSD: toupper_.c,v 1.6 2002/12/13 23:16:38 millert Exp $%X$OpenBSD: inet_ntoa.c,v 1.4 2003/06/02 20:18:35 millert Exp $$OpenBSD: inet_ntop.c,v 1.5 2002/08/23 16:27:31 itojun Exp $%%%($OpenBSD: getdomainname.c,v 1.6 2003/07/15 17:32:41 deraadt Exp $%x%%( %%%\Xx ,%H$#$ $($0%$%D%((**P***())**P**+(%<%`%/0801012@23x$OpenBSD: perror.c,v 1.5 2003/06/02 20:18:37 millert Exp $%$OpenBSD: catclose.c,v 1.4 1997/07/09 01:08:57 millert Exp $$OpenBSD: catgets.c,v 1.5 1996/09/15 09:31:22 tholo Exp $$OpenBSD: catopen.c,v 1.10 2002/02/16 21:27:23 millert Exp $%T%%P%%%($OpenBSD: time.c,v 1.4 2003/07/08 00:11:50 jfb Exp $%h%%%8%%%%H%%$OpenBSD: getservbyport.c,v 1.4 2003/06/02 20:18:35 millert Exp $%@$OpenBSD: fgets.c,v 1.6 2003/10/08 10:29:55 avsm Exp $$OpenBSD: getservbyname.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: getservent.c,v 1.6 2003/06/02 20:18:35 millert Exp $%$OpenBSD: fopen.c,v 1.3 2003/06/02 20:18:37 millert Exp $$OpenBSD: rewind.c,v 1.3 2003/06/02 20:18:37 millert Exp $$OpenBSD: fseek.c,v 1.5 2003/06/02 20:18:37 millert Exp $%%(%h%%$OpenBSD: fclose.c,v 1.3 2003/06/02 20:18:36 millert Exp $$OpenBSD: ftruncate.c,v 1.11 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: rget.c,v 1.4 2003/06/02 20:18:37 millert Exp $$OpenBSD: refill.c,v 1.6 2003/06/02 20:18:37 millert Exp $$OpenBSD: fprintf.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: fdopen.c,v 1.3 2003/06/02 20:18:36 millert Exp $$OpenBSD: flags.c,v 1.4 2003/06/02 20:18:37 millert Exp $%$OpenBSD: mktemp.c,v 1.17 2003/06/02 20:18:37 millert Exp $$OpenBSD: pread.c,v 1.6 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: snprintf.c,v 1.8 2003/06/02 20:18:37 millert Exp $%@ 0000000000000000%P}$OpenBSD: flt_rounds.c,v 1.3 1997/08/01 21:36:33 deraadt Exp $$OpenBSD: infinity.c,v 1.2 1996/08/19 08:17:37 tholo Exp $$OpenBSD: ctype_.c,v 1.6 2003/06/02 20:18:34 millert Exp $%p%x$OpenBSD: _def_monetary.c,v 1.3 1997/07/23 21:14:38 kstailey Exp $%ɸ$OpenBSD: _def_numeric.c,v 1.3 1997/07/23 21:14:39 kstailey Exp $%$OpenBSD: fvwrite.c,v 1.12 2003/06/02 20:18:37 millert Exp $$OpenBSD: wsetup.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: makebuf.c,v 1.5 2003/06/02 20:18:37 millert Exp $%$OpenBSD: getpagesize.c,v 1.4 2003/06/25 21:15:04 deraadt Exp $$OpenBSD: sysctl.c,v 1.5 2003/06/02 20:18:35 millert Exp $$OpenBSD: mmap.c,v 1.12 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: stdio.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: lseek.c,v 1.10 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: isatty.c,v 1.5 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: stack_protector.c,v 1.6 2003/10/01 18:19:08 miod Exp $%$OpenBSD: tcgetattr.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: fflush.c,v 1.3 2003/06/02 20:18:36 millert Exp $$OpenBSD: fwalk.c,v 1.4 2003/06/02 20:18:37 millert Exp $%H$OpenBSD: umoddi3.c,v 1.3 2003/06/02 20:18:36 millert Exp $$OpenBSD: qdivrem.c,v 1.4 2003/06/02 20:18:36 millert Exp $%ˈ$OpenBSD: isinf.c,v 1.5 2003/06/02 20:18:32 millert Exp $$OpenBSD: isnan.c,v 1.5 2003/06/02 20:18:32 millert Exp $%_ %$OpenBSD: signal.c,v 1.5 2003/06/02 20:18:35 millert Exp $%X%͘%%$OpenBSD: pwrite.c,v 1.6 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: ashldi3.c,v 1.3 2003/06/02 20:18:36 millert Exp $:.symtab.strtab.shstrtab.init.text.fini.rodata.data.pltpad0.pltpad1.gotpad0.ctors.dtors.gotpad1.sbss.bss.note.openbsd.identLL!``',,-"@@355;FxؐDFxؐMfxؐVfxx ]f؄؄df،ؐmv،ؐsvؐؐ x44ؐ ... (@haB   @@haB,C( @@=@@<@`dT U@haM@@?(0pLl A@haC@haC@haCJ $1hxƠ[٪7xGG! YB>Ym_mb$)m;t_ w UdKFʏ%J,Sv'3R<t\_ 9mjM5٧Ifԣz5 pG"L2[2$ϯI4ɺL6\E_EgC nggGe`C"-r0HRȑ>]ы4Ġ?LELF`4[4 ('''''$ $ K("K("K(ZRZRZ[b[b[j444OpenBSD㿠@ @D* @ +#@㿘"#H@`'"#( @, / &(@ &((J `P(  *"(J` (cP&(*#H@u@X*`:` J " 㿘"?"`     , `2 ?, ??@@??㿘"` "  㿘c,  "c,@1"㿘c0  "c0㿘c@@X#`@ 㿈!+7)#%5-'%/` @#*` €!$  %` &\ % X@pa "cd@ja"ch@ c?ؒ?& * @&` %T  `#$P   ''1' h @1 ?c@ H    hc@7  "#$  X `@#T@#P@# @  @ĒЀ  %`@cȀ  @`  %``(@S T@Q蠒 P@H  @: `P`H@  @ @6 @[\`2"@P`X@*  @ P`H@ ڐ  "@2( 2b`x@ ͐ @;@耢 `@  @' 8 @ c4  4 ` " ` 4 " `` ` @  0@ϒ  H@  @˒  @ 0HȚaB + cB + 3`  *`  @67   @ 01@: Ȁ̀@  0@Ő`      ! !?   ?# ! ? ?#   F?2B  ?  ?# !  ?0@! *? ?c@  ̀@ ?@ ̐ ? ?c@ ! @  @!   #?9 ?  ?# !  ?/@! (? ?c@  ̀@ ?@ ̐ ? ?c@ ! @   @!  2 ? ?# !??? ?c@ ! @ ?#" @!  ?"  ?c@ ! @  @!  #? "? ?c@ ! @  "@! @#@"4     @   # " "a!!0  !X@g@D@2  `X"  @! `"!!@!@!Ȗ4`!@&@ @a &&  `  㿘. >@0R 2@b@ @b(@ 㽐@ `H@ܐ @< b@@Ґ cd F !""hcd" ` * "`쀢 bP@  X`"h@ ` @X)'cd, *  "@ X @` @cdX @"04b@z   b@s  b@ @ bȔ@l @ `Д@c @ʐc"ؒ Q@0 0 b@  @͒@ @Ɛ * @   @@ x `*  d 0#, &@ xa*  0" 0 ; `@ C@8   @ bP@S  "@X  #@o`(`(  `X53 d,*"@ X @Yb   `2 dX `@G"`>X #(@>`X 0#HĒ tX-+ d,,"@ X @"b t `2 dX `@"`bP@  㿘  R  @ $D` @  $$`@ $:`  @  @ € $@D@`@ €  $@$@@` $@:  @ $D` @  $$`@ $:`u ?n #!@? ?#  #X3   2 "  S Q 46, 6 +   " B `  " " € `" < . > @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .      $ xa@$ xa@㿘'L'P'T'X@L㿘#(!`X@]#``@#`#`@S``@% xa@$ xa@$$ xa@$OpenBSD: umul.S,v 1.5 2003/06/02 20:18:32 millert Exp $ /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  㿘'H'L'P'T'X#@H@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" $_ xa@$ xa@$ xa@?ch?#ض  @ ޺ ?@ ?# @!?3?a/?#?  ?# !?#?󀢡?#?  ?# ! ??󀢡 ?#? ?#  ̀??  ? ?# ! ?#?  ?#  ?U#؀Q??# #?  ?# !  ?6@! 0?#?  ?c@  ̀@ ?"@ ̀@?#?  ?c@ ! @  @! @ #?    L # #?  ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"  ` @! @2` @   ??  ?# ! ?#?  ?#  ?T#؀P??# #?  ?# !  ?6@! 0?#?  ?c@  ̀@ ?"@ ̀@?#?  ?c@ ! @  @! @ #?    K # #?  ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"   @! @2    ?#Ԑ# @ ?`?D '#\   @)2@   v? "!@Đ `? , 4 $    "?J 2, ?:#@ :E4&@ @? ?`)` ` % _ J _"@A 2 `?$  ` , `4  ` ,  "J 2L Т` 8@f `?@ u0#@SF ӄF @   "  ?b!' 4 @+ 4    i ΐ d?cX l ]آ   #\   @)?@ F ؐ @ 06*` *      @ `( ( @ @  @   @”@?#\  @(??@ ,`4`$`` @  `J 2,``z0d %`@?`W@ "SL "O @6 " L _2;`  @, 25` $` ``"!  ``  ?#@ " #`   ,`@ ,`,`  ,` 2  ? ,`4`  ,`` @ "L  8?#  @&" @6@[! @( h㿘 l?  , @€? 㿘 C ?m㿘'L'P'T'X@L㿘c(!!`x@ #`` @#``@ #`@ #`@ `@ 㿘'H'L'P'T'X@H㿘c(!!`@ x#`  @Ð#``@ n#`@ ǐ#`@ g`㿘'H'L'P'T'X@H㿘#(!`@ R#` @#`#`@ H`㿘 @, 㿘&@&&@-˒  @*&"*? &&  㿘`"" 'D@ H = ?$@+{ 517 `"  " &N@ :!X& ? ` @  2 @+Q܀ a-` `!!`" N@ :!xV  "!"!N@ ? :"` :0^ ?`  "! D*``"% `:`!`5`!`" N@ :!0  "!"! ??%N@Ā`: ??%!` N@ :!"!  ?2'@ `2   "@㿘a!" ? @ !Ѐ@ $" " *`:  + -"`*`:  + -!`) %!$!`"!'?"b"! J`!%! b!$!"b""@ " $"$?%"$bC?*@$J - J 0@  - *!` $ * @  %a%$`#b?!" "?b$""@ " $b $" b?2"bJ` "`$J` -J ! "!$ $"O""" "@$?%"$")* @ "%JJ`-`"J`-   $`:@  2 G?!$J  :$ -J  -@   -J`"?J` $!` N :!Ò"! ?6 W25`J` ;1`J`! $!a $N :! W"!N`:Y ?W :* @$ޘ a$I`J@ : J`@ =$%aJ "J`/%a :  $!a $N :!`"!N`: ? :* @%a`  6* $@ %a!`$$㿘  R 㿘H 㿘> $I xa@@,A0@A0A0@HA0A0A0A0@d@@A0@A0A0A0@A0A0A0@A0A0A0A0A0A A0A$A0A0A0A0A0A0@<A0A0A0A0@X@t@A0@A0A0A0@A0A0A0@A0A0A0A0A0AA0Ax#(!'ؠ!@( c\''@( ''@('@(''ؔ @+o  @("c4x"Paڐ#8`#('@( c\'ܐ @('''@(~'@(z'' @+D 㿘@א c ? @. 8 "a' %T@@?@ T @*X #4 #"@ "#T@ "@  㿐%. 6  * #\  .  @#?!#@%)*. #$$#  H'"\ ` @* )-1"@) ? x , @)  2o@ "! b]Lđ* : `>LN#*` €"L* J%"L"L2 F%"LC""P ?"bP<"#@ 8"c@5""T1"bT."#D *"cD'"#< #"c< "#P "cP"#8 "c8"#H "cH %L  %L!"P"($"P$"PL  }L  "cP#\   @#=??"c"H@ϐ c 2 # ?"L"c("# &#  %"L"L *` @i%"L"cXa& @#ِ"h㿘#? bT#     T* `""` "@"""T &#@` @)  6  4 c" * #   "@  #"  `#P`. @' Ѐ` cX "cX@㿘? (    +?>   >  c,    2 2 *   *,`  @Ȑ    6 6   : 6 * 2 2@6 6 & @( 6 @q@nM 2@*6 6 6 6 &  4 `   ?2 * #@ `" 6   2*  (   # `  +@ 2*` +@*#  $@ ?6 6 `c c * "@c&"cP c`  "    ,`"T`"@n  $,`   2? $ *` 4 c"@$?cP": *   ,  @&㿘# `#4`@% "a  "P`2  2"x#L` @&a 㿘#4`@%# `2j"#4` " b"# ["#*   ?@N#`@ !`@  #<`A@??@;,#P 1  * ?@+# ?,@2 2 *`  2#@ c<* 2 @2 @ #P`$@@% #X 0L   ` @"/0@"*@㿘 # `{"0#4`#6 # m"0# e"0#+   @0  *@?.  2L# 0t2 *  2@  ` =#@0e#P` , @%y Е,@  *@$@    `4  #* @# 2  @"@ "@   :@ @" @ "@  * @$'"@$@@@2@"@  c2 " #* " `2  @&  VT㿘!# ͐#` $#"`"\`@'% "a㿘#b\ !@'#` c"\ $#`԰ 0W#`$#`b\ @'#H` s#㿘#b\ !@&#` c"\ $#`,#`$#`b\ @&㿘"\`@&`# "c\"` 0 <c`$c`"\ @&#H` #㿘 4#p0߀.#X0?'#0 , "   * @ %#'   #" #@ `#P`.`  @$H#D`@$ T c*  "T #@`$@% cX 2"  $cXcX" " "  ` " "A$  ` :`@ 2@`@ cX"`" &` "@0$cX` @`&` @`%&``2"@  &`  &` &@" 2@`&`&`  cX" "&@$cXn#@ 2 !`"L@+1` #T@' @} #T@! "L`&`@&` @S ` #2 $  &#T #.`" `@ #?#c ѐ㿘@&#쀢`!``? ` ,  "??, @Β`2`@$$OpenBSD: brk.S,v 1.5 2003/12/25 18:49:07 miod Exp $b`@8   :xa@ bd$OpenBSD: sbrk.S,v 1.4 2003/06/02 20:18:32 millert Exp $d   : xa@"d㿀. * "* 2  *   ? # #h#h? P? ?    ( 0 8 @ H88888 8(80888@8H8P?X㿘!`@Q#   R X 2 &  ?2 2 """""""0"4"D"H㿘@- " `  ` "@` 2`} $㿘u@!p㿘U@#d "a㿘@" X\XhXXXXXXYYY(Y4Y@YLYXYhYtYYYYYYYYXXXYYx? `}'U#*` € G  @#’耢 ~?|z d W  7  @#耢 n?l ,  )  C  #     : !              '9'    '1'                    $? ܖؘ @Ě ? ܀ ? "a ? ܖؘ @ ??܁㿘 @  2J@ "J`  2J@ 㿘@a㿘 "@"L  0?,@#-  @"?  0,㿘 @!x 䀦 . "$  @6@ #?န @)@ Đ@X  "a#a@$a㿘?  "a ?"   㿘?  =  @ @7   @.@08/`(@ @ @?@4@08/`(@р 6`6`@؆@_0______________________`________`_______`㻐!' "?N @ / @w@"& 2 @! 2!@!Ȣ !J B  ?* : `(3W!*` € J@  4 @ 1 *`J@ ) @ **% J@   @  *`J@  @ **    * * L  :`%*@?2 L 2 L ? @N!؁0 ?, $?#\   @m ڐ?2???#@ >  && ̐?㿘 `"@ J@ "@ 2N@@p  @ *@`N &*@   (+  2 2 " 2+J " ?J   㿘" @?`  ` `2 @ - +L@  L@` 0 L@ x XL` ` 0   ) #@ 0@! $ $  "  /) "J" &? ? %*"  #?%   @`?   ` `?Π?   ` `?   ` `??`&@ J@   J@J`  㿘'L'P'T'X@JL 4H / #H#8*"@ J=2#H"  J JJ 2 J=ې    㿐ƒp @X  %'' !` ,`'l  l @ ?`@ & $#? .` `.   @? @.  ` , ,  . @㿘"` ⬐ *@? #"**⬁㿘"` bb? *b ` `,  @@, ` - - ,㿘"` @c⬞⬐ (⬖   ` + *  *⬔  (⬄ ,   ` + *  *⬔  (⬢ +` +  *  *⬘ (⬔ ( + *  *   *  *  + @+ ` 㿐#\#`  @  p{{p{{{{{{pq{qq{s0s8s8s8s8s8s8s8s8s8{{{{{{{{{{t t{t{{{{s{{w{{{{{y{{y{{{{{{{{{{sttttst{{s{wwxXs{x{y{{yL`t$$$$$$$$$d@lt@DD|㿘` @e&`&`&` 8a    ? ,$ 7'''7'''''@ @ 2? @  @4  @!㼀!'H'@' ` ` 2 ` @#  "a/?`   HW` H!H4''0 ''P'X'T'' @  4 %'' $$XT@ 'X 'TiP '   '''?/J@`'?`XZ"*` €O  /  L ?Ѐ 0, L** ?Г:`  L $ 0  '0H0@,0 .' '.'  '  +/J  *?'L ? 0, L** ?Г:`  L $ 0  '0H0@k,0 .'.?&g?f?Ѐ  , * ?РJ@`?Ѐ ' $?&S?R?K  , * ?РJ?Ѐ ' $2?'0 7'0H0@,/, * @J l2% '! 0`.@/   ''0 @ `.@*  : `.@:  6q  -/`k ? g   G  "  0`.@''?`".@''?@ "  -/" @ " (#`!#\'@8 g G  ?@$ g g E e e f' `@s'( @ (`  O'`@ @  O'``4  $@ O' D  -A/  0`.@:`:  `.@ " @ 0`.@2`.@"   'x'|x 0 @ `.@  `.@  0`.@b '  q x0`.@"(   @f "@$/@   'p'tp 0 @ `.@  `.@ / "0"  ''h'lh  0 @ `.@  `.@   2 / '?쀔`S "  7F"H  4`,  `4 0 , 806 03,  @ `0, F  ` `0, , 4`  ` 4  ,@  %@ / / @''O `' '􀥠4O" . 3a $$XT` 'X 'TDP ? a$$XT@ 'X 'T.P O   $$XT`  0//  $$XT` 'X 'T P 4" . - $$XT` 'X 'TP e? 4$$$XT@ 'X 'T֒P O" - - $$XT` 'X 'TP 5? 4$$$XT@ 'X 'TP ! e$$XT@ F∁ BV "h $$XT` 'X 'TP  (@  $ $XT` 'X 'TfP ߤ(?  - $$XT` 'X 'TLP Ť? 4$$$XT@^ ``("h $$XT` 'X 'T(P $ $XT` 'X 'TP   - - $$XT` 'X 'TP u? 4$$$XT@ 'X 'TP _$($XT(@R$($XT( @ 'X 'TɒP B ("@ - - $$XT` 'X 'TP '? 4$$$XT@ 'X 'TP  "p $$XT`  $XT  @ 'X 'TyP   "p $$XT` 'X 'TcP ܤ$ (" $( X" T@ t ( 4 R   .//  $$XT` 'X 'T6P  B($(?$XT( .@ ? 4 - $$XT` 'X 'T P ? 4$$$XT@$$XT` 'X 'TP f`$$XT @ 'X 'TْP R 1" , 3a $$XT` 'X 'TP 5? 4$a$$XT`'X`'TP !0 & 'X P 0'TX P 0'T0耢, '0` @? @o"x! ?X'/*`\ * \ *`\ * \*`\* \*`N%2   N `X[ T*` €N ?X %L* @ L*`ДЀ @LN*6 N ?X  L* @ L*`ДЀ @L $@  @ \@X\ *@`@4 \@ X\ *@`@4NЀ NЀ   +  * ?И NЀ  $ @ X@\@ڒX\ *@`@4qpN X@\@ȒX\ *@`@4_^N@\@X\ *@`@4ONN@X@\@X\ *@`@4>=N@\@X\ *@`@40/NX@\@X\ *@`@4N@\@zX\ *@`@4N X@\@iX\ *@`@4N@\@YX\ *@`@4N@X@\@HX\ *@`@4ߦN@\@:X\ *@`@4ѦN X@\@(X\ *@`@4N@\@X\ *@`@4N@X@\@X\ *@`@4N@\@X\ *@`@4NX@\@X\ *@`@4NX@\@ےX\ *@`@4rqN X@\@ɒX\ *@`@4`_N@\@X\ *@`@4PON@X@\@X\ *@`@4?>N@\@X\ *@`@410N X@\@X\ *@`@4 N@\@yX\ *@`@4N@X@\@hX\ *@`@4N@\@ZX\ *@`@4N2N* &#\   @i?& )\+ " \ `[ *` €`@?``@? ``@?``@?`` $\ !k'\! @"㿐@ *  #\  @?&@@|#\ ? @  @@:@& @  @ߔ$@ &@㿀?"\ f#   e E  " 9/ -/?#\  ?@耤 g G f# fJ 02 @b B  '@@" B3'@   0`*@@ '`" "@ X!'`, -,   +,  쀦` @  0.@ڒ ` `0..    0. `0. & @-"PPhl㿘#.  ` @ " ,, 0 "`"`"`"`  `㼅("@ 㿘? #   @༑4`4  *  $ 2  ,   * @M ː, " & 㿘 @X  *`   "`"``   N      &N    ?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘&  " " 㿀 `@6  `  ` . ' , `,`% *%@  ''@ L@ @`'?c '? cΐ @  Ǒ4`4 444 4  $@? #߮ 4 4ߦ4 @   4 $@  $'  "' 㿘` !*  >``#!#```"q$# $@ 2^$@"`" >`U>``2@㿘>`@ *  Z `` "? * ` " * " 2@ ` " " ?& C`(` " ?8 㿘     H     ` * `@ (? # @  "  22: "  33 ` :`@  ?# @  : 2`@ 33  :`  ? 2 ?   ?0  :  4?8      ( ;``"##㿐  * ? " &@ " 4  ? "@ ,2   ? " 3 ,  ? " 4+ @ ?"#㿐T ?. . 6  `''`'   " *@ $ 2 '$   $   $ ΐ $ $   ` 5͐@& "@ Γ. @&. "@&㿐v? o ?`  " * " *#??ā`@='H  @  ' @" `  2`M@ - + '2M@`M@` @`0 *  `M@`0 @`O* : + '     -*   ?4`+  *  ?Ъ`M@ /9뀥 :`E` =M@0Ϫ`M@0`π 6e ' `(``   -*  4+  *   -*    +  *    M@Ѐ Ӓ`e EI 2 `2"ڪ`M@+ -І `M@Ѐ .0Ϫ`M@0"`π !Ъ`M@ *  `M@?Ѐ/9*%@ "" 2     `H &@  ' B?  ?c* @ $'%H  BD? >'@ 2:%`"_H%`  #.` ?$%% B"@ $%c*@?$&@ .`% B@?$% B #*` ?$% ?*%@P #* ?$% B?4$ :"@ ""a䀢 H   + @?$% B?: + ?,$ ?%( B?  $(#a?_]  #* ?$% ?K:4 c + ?$% B?: + c@?"#  D(?)F!?()BD F?  ""a䀢`|H 4?@?r  4'''o  0[5 # @  I ?   ?  2:?8 ? ? ! B0&  !+' ` &1'? " !`( `0 0B'`0B &'??@?Ѐ B- %?,??? @'cD?   #"D?  `0B B?f?? @D?   F#' €? 8 `@ 0 H ``` *@ v` ܒ `       $@  ?3 6" @   4`% & $@    4`( "w & X  ?H 2"?"쀢 #㿘 t -    `0 `1?#  ' @#4`4    "@ @2 @:`"44 3`: ('  "'  0?#`  - @4   4` " 2 @:`"44 3`:  ('  "' h#'L'P'T ?# *@  """#Ȁ`6'@ '@ * ' % T#"@̀? P  P X h\`N    \"x B T "\հ`p "  /Ȼ2g Ⱥ| ?* &' d2`   @Ȑ"̒*2   ̐"*@'  B?{͔ ? '? '` DxHFBL ' B# '#, $ȇ%)'#?    '% 'L 8'LL` 'L L "'e!* €?'? 'P'P`P 'PP' 'P``'  ` "#  ,  `"㸪"c ` Ⱥ  '  c* @<"  #Ƞ #ؘ  ?Ȁ # /`@ &' B<  `ȅ!?Ȳ`c* @>`$Ȁ %B?#  /`@ $ȇ%B?ȡ<  `耢 ` 9' 쀢 ` B ?'ȀF ?0D'@'&   '$% ?ȅ)  P?䀢 Ic* @`$% ȉ ȑȍB'`0-@ȍ…&' Y?ȉ" #ā) 0 @6T? ȑ DDB?ȅ'`0.Ȱ …&' 7?ȅƁ)} 0`@4?Ȑ* c@ $% B Ȁ@B'`0.Ȱ ? ȅD-Y 0ȉ&' 9?Ȱ?N 0"? Ⱥ`D??Ȥ  ZX#, "P #    ` Bȁ  1-@ Ȁ@̍B'`0 L.Ȱ  ?ȉ"#B  ?ȅ$%L` 0?N 92?-@ .  B? xD`'Ԁ ! L ؀d3 6" &$' %  ` @4%%&@䀢`` 8 } t L̀ 2'?@2 '   ''  *` s '@ `` "```@m g耢`    ٔ 쀥L  ˔ }  1Pɤ8 1-@`Ĥ``,܀'  Ը* @     Ԁ   ' 'Ԑ  `Ԣ 06L  *f` L` ̀ `9+ 4`f.& ``L`̀ `ƒ  4`2N.`"K.``:  9E. `9` 9., ;..@   ( ` 0.@  Β 4 ??`N  1?N 9  .-@`N 0"?   Ԁ`@ ߐ2. 0-@` .T"\2"+dd0Ѕ(#$"܆       $((()(*(+ (,!(-"(.#(/" $" "` "`"㿘` ` ` 2 @@  "a?@`  ` `, $$ ڤ`" $&`ְ `s "` `@  @2` :` ``#. ` *. ⥒` ``&@$`$`$@$`` "`*@@`@"@$`$@.@` @@@@$@ 2` `` `,` $u` ` @o`@"@$`$@`" $&`b   `  ` @  "@  `@ ` `@ @ @5@@@$@ +0@ `,` 0   @`@"@$`$@2`@t   `" $&` ` ? @4` 㿘!`2  2  " "  0` @@"& 0ᶐ & 0 &   ?6 &  6   2  " @b?@   &  &   &  㿐  C & & '&@%Q  U  C  & 6 & &@#d`& & & @V  2` 6 8T  &&Ӎ  &<  ؐ`?`&$&@( "&@$ L ( (s#@"$㿐!@`     6  @H   6? 2& !#쀢 ސ $##\   @?? 2$  $ $ 2 $ $$  * "  $ @  ? 㿐!@<`6 0`    !#쀢  $##\   @??2  $ $ $$@ؔ  $ @Д 㿈 0` 0   '?   @ ? 0? 0$0<HPX|`llllllllt|㿘 @U  N`2J   < ; <"b@( <9    1 ",  ?`#s ̓*` €#?###    (",&  & "a?㿈'XX#d#h#\#` @  Ł㿘T   P > B< P ?Đ*@4 㿘 ! V  @-  ?Ē* 6 V 㿘T   @?  2  ?Đ*@4   4 < P㿘V 㿐'  @ 0 ?? #\ @ ǰ  @ 4`!'#  c@ ,  @ 8@ c @ . @*#8㿈a     % ?'      @w ?2`  * , * * 8! '?''Ė '''''c@ @a?' @ @[ @ ''' @. @R@ @6 $OpenBSD: bzero.S,v 1.3 2003/06/02 20:18:32 millert Exp $ `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*㿘 `@㿘 2 u@7!p   @  "a?㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`, 㿘# ? T` "??`X2"  `  ?2  㿐@H 'T#$t T 0.?T2 7耦(7耢 2: " 4`444`4`4`ؑ45 'ē45 5 5  `A'? 7' `>`І`*  4|`*  *r`*   T` eT :-`-2 ,`- ͓2`   ` `" `` 8   đ. ?2@ Đ" * c'Ā@ '.` @ '  @ @ @?   '/ @   7@', п 'Ϲ. 2, @ ( ?#   ?#/@..  ?Ϝ'$$66`% @"6``4@  *. ?  @26`@4@Ā2T`#@  " . @?* :@ @2. 4@*  *`T@ :̑* Τ Г*`@  +    ?( 8 2 + ( 2X@V+  2     " *@ `2 "@ `2 *@ `0* @  "2 2  "? *@2 ?"@? *@;`` (` `?#;```0  ?2 `2 # "  J` ? `   ?J@"J@@  " *   J@"`   `(*`  $OpenBSD: strlen.S,v 1.3 2003/06/02 20:18:32 millert Exp $ J " 㿐!?' @; c   `     ` @"@@  @@  @ @@ @ $OpenBSD: sigprocmask.S,v 1.4 2003/06/02 20:18:32 millert Exp $@2@  0 xa@2"$OpenBSD: cerror.S,v 1.4 2003/06/02 20:18:32 millert Exp $ a??x  ??''쀢' "a ?! *@ @  '@^؀ ?؁㿘  ` ?μ "a  Ͷ @ (Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*$: xa@$6 xa@$K xa@$t xa@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  $Ƅ xa@$. xa@$ xa@$ $ʄ xa@$„ xa@$J xa@$ xa@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  $y xa@$% xa@ 㿘'L'P'T'X@L㿘`@%㿘@㿘@ǐ 㿘@ɒ`㿘'P'T'X@Ph!'P'< @ ax ## #ߖ#` : !#` @@A̠Ȗ@I((  (6'$@@ ̖А@ & 6$` 2` 2`#(&``@ & 6$` "`@ & 6$`   :,  , *` ?$-+:  %`%N m`% @ '@ Ӕa@ ̖6$@`N % `` `. . $. *` ȑ: .P@ & 6` $'@$b '''' ̔ `  `` @@[@@   7@A@K@͐ @@  7 ` " Ք  >܋ $$b ''''А @@x! ;" 㿘?"& ?&&  !'2   @ L ?3& @ ? ?-a  )  ? j ?/???????????/b07  h@ . j? ɘ&& a "@㿘 2&& "&   &㿘t?&& &  `"`p000000000000000000000000000000000000000000000000000000000000000xtH,<<\00080H00<T0000008 0<80X|00 4`l㿐@' @ "`2*? *H!'LG`%=L`z7|"ȓ*` €0``"*` | !@P``"*` ` !@@`` "*` 0 !@0`` "*` !@!` d\'la@c0 @ ߠ'̐#x` a@ɰ` a@ږ!`a@Ζ` ;7 " a@` a(@`a@`  " a@~`a@v` a@m!0@f` #8#4@YP!8L!@@a@bI`@'`'` '`'`'`'`'` '`$'`('@ 2'ؠP @ @V$#!`@K` `?"a@% ` " ah@p > ``'l` $2mv d 2 np! 2mn!mf d  !n`! !m!n? X$?T $@?& Ζ 4` -`` -` 5-`:  V g a2  ' d,aap@!x``` "    a@`ah@wnc(c, ''` '@hf' '` d'la@jQ`'lap@aH`( @r@` D` a @ @c9` 5`$`6! !@Q < <* , ,  <ap@# c<  . L   Ґ!㿀#a' @ Ð@ a !@ `@  (*@  㿐 !Аd"@'Ƭ"@* "@*`@*`'@ Ւ  8`#`? "77''''ۼ*@㿘 miniroot:\ :ty=winchester:se#512:nt#2:rm#300:ns#64:nc#96:\ :ts=3500:\ :pa#12288:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#0:ob#0:\ :pc#12288:oc#0: rdroot:\ :ty=ramdisk:se#512:nt#2:rm#300:ns#4:nc#544:\ :pa#4352:oa#0:ta=4.2BSD:ba#8192:fa#1024:\ :pc#4352:oc#0: floppy|floppy3|3in|3.5in High Density Floppy:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#18:nc#80:\ :pa#2880:oa#0:ba#4096:fa#512:ta=4.2BSD:\ :pb#2880:ob#0:\ :pc#2880:oc#0: fakecdrom|Fake image for Bootable CDROM:\ :ty=winchester:se#512:nt#1:rm#350:ns#640:nc#2048:\ :pa#1310720:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#1310720:ob#0:bb#8192:fb#1024:tb=4.2BSD:\ :pc#1310720:oc#0:bc#8192:fc#1024:tc=4.2BSD:\ :pd#1310720:od#0:bd#8192:fd#1024:td=4.2BSD: ASI-1.0GIBM:\ :ty#winchester:ns#80:nt#15:nc#1632: Arte DEC DSP3160S:\ :ty#winchester:ns#112:nt#16:nc#1744: CDC 9720-850:\ :ty#XD7053:ns#66:nt#15:nc#1358: CDC EMD 9720:\ :ty#XD7053:ns#48:nt#10:nc#1147: CDC EMD 9720-1230:\ :ty#XD7053:ns#82:nt#15:nc#1633: CDC IPI 9720:\ :ty#ISP-80:ns#82:nt#15:nc#1631:\ :pa#33210:oa#0:ba#8192:\ :pb#131610:ob#33210:\ :pc#2006130:oc#0:\ :pg#196800:og#164820:\ :ph#1644510:oh#361620: CDC IPI 9722:\ :ty#ISP-80:ns#156:nt#7:nc#1630:\ :pa#33852:oa#0:ba#8192:\ :pb#132132:ob#33852:\ :pc#1779960:oc#0:\ :pg#197652:og#165984:\ :ph#1416324:oh#363636: CDC Wren IV 94171-344:\ :ty#winchester:ns#46:nt#9:nc#1545: CONNER 30170E:\ :ty#winchester:ns#46:nt#8:nc#897:\ :pa#14720:oa#0:ba#8192:\ :pb#40480:ob#14720:\ :pc#330096:oc#0:\ :pg#274896:og#55200: CONNER 30200:\ :ty#winchester:ns#49:nt#4:nc#2121:\ :pc#415716:oc#0: CONNER CFP4207S 4.28GB:\ :ty#winchester:ns#125:nt#20:nc#3353:\ :pc#8382500:oc#0: CONNER CP3500-540MB-3.5:\ :ty#winchester:ns#50:nt#12:nc#1768:\ :pc#1060800:oc#0: CP3100:\ :ty#winchester:ns#49:nt#4:nc#1023:\ :pc#204864:oc#0: Conner CFP1060:\ :ty#winchester:ns#111:nt#8:nc#2329: Conner CP3540:\ :ty#winchester:ns#49:nt#12:nc#1805: DEC DSP3107L:\ :ty#winchester:ns#83:nt#8:nc#3147:\ :pc#2089608:oc#0: DEC DSP3210 2 GB:\ :ty#winchester:ns#86:nt#16:nc#3040:\ :pc#4183040:oc#0: DEC DSP5200:\ :ty#winchester:ns#71:nt#21:nc#2619:\ :pa#32802:oa#0:ba#8192:\ :pb#65604:ob#32802:\ :pc#3904929:oc#0:\ :pg#3806523:og#98406: DEC DSP5350:\ :ty#winchester:ns#91:nt#25:nc#3053: DEC_RZ26:\ :ty#winchester:ns#57:nt#14:nc#2568:\ :pa#66234:oa#0:ba#8192:\ :pb#132468:ob#66234:\ :pc#2049264:oc#0:\ :pg#1850562:og#198702: DEC_RZ28:\ :ty#winchester:ns#84:nt#16:nc#3043:\ :pa#64512:oa#0:ba#8192:\ :pb#196224:ob#64512:\ :pc#4089792:oc#0:\ :pg#3827712:og#260736: DEC_RZ58:\ :ty#winchester:ns#85:nt#15:nc#2112: DEC_RZ58_whole_disk:\ :\ :pc#2692800:oc#0: DEC_RZ74:\ :ty#winchester:ns#91:nt#25:nc#3053:\ :pa#65975:oa#0:ba#8192:\ :pb#193375:ob#65975:\ :pc#4192825:oc#0:\ :pg#3931200:og#259350:\ :ph#2752750:oh#4192825: Fujitsu M2243AS:\ :ty#ACB4000:ns#17:nt#11:nc#752: Fujitsu M2246E:\ :ty#winchester:ns#35:nt#6:nc#1196:\ :pa#16170:oa#0:ba#8192:\ :pb#28140:ob#16170:\ :pc#251160:oc#0:\ :pg#206850:og#44310: Fujitsu M2263SA:\ :ty#winchester:ns#53:nt#15:nc#1652: Fujitsu M2266SA 1.2GB:\ :ty#winchester:ns#85:nt#15:nc#1652: Fujitsu M2266SA 1GB:\ :ty#winchester:ns#85:nt#15:nc#1642: Fujitsu M2344K:\ :ty#XD7053:ns#64:nt#27:nc#622: Fujitsu M2511A:\ :ty#winchester:ns#25:nt#1:nc#9950: Fujitsu M2512A small:\ :ty#winchester:ns#25:nt#1:nc#9950:\ :pc#248750:oc#0: Fujitsu M2512A v2:\ :ty#winchester:ns#25:nt#1:nc#17840:\ :pc#446000:oc#0: Fujitsu M2622SA:\ :ty#winchester:ns#64:nt#7:nc#1429:\ :pc#640192:oc#0: Fujitsu M2624FA:\ :ty#winchester:ns#64:nt#11:nc#1440:\ :pa#22528:oa#0:ba#8192:\ :pb#67584:ob#22528:\ :pc#1013760:oc#0:\ :pg#450560:og#90112:\ :ph#473088:oh#540672: Fujitsu M2652SA:\ :ty#winchester:ns#88:nt#20:nc#1935: Fujitsu M2654SA:\ :ty#winchester:ns#88:nt#21:nc#2174: Fujitsu M2684S:\ :ty#SCSI:ns#74:nt#6:nc#2338: Fujitsu-M2284/M2322:\ :ty#XY450:ns#32:nt#10:nc#821: Fujitsu-M2312K:\ :ty#XY450:ns#32:nt#7:nc#587: Fujitsu-M2333:\ :ty#XD7053:ns#67:nt#10:nc#821: Fujitsu-M2351 Eagle:\ :ty#XD7053:ns#46:nt#20:nc#840: Fujitsu-M2361 Eagle:\ :ty#XD7053:ns#67:nt#20:nc#840: Fujitsu-M2372K:\ :ty#XD7053:ns#67:nt#27:nc#743: Fujitsu-M2382:\ :ty#XD7053:ns#81:nt#27:nc#743:\ :pa#80919:oa#0:ba#8192:\ :pb#129033:ob#80919:\ :pc#1624941:oc#0:\ :pd#470205:od#209952:\ :pe#944784:oe#680157:\ :pf#209952:of#0:\ :pg#1414989:og#209952:\ :ph#1544022:oh#80919: Fujitsu-M2624S-512:\ :ty#winchester:ns#64:nt#11:nc#1429: Fujitsu-M2651SA:\ :ty#winchester:ns#88:nt#16:nc#1934:\ :pc#2723072:oc#0: Fujitsu-M2694ESA:\ :ty#winchester:ns#77:nt#15:nc#1830: HP 97549T:\ :ty#winchester:ns#64:nt#16:nc#1909: HP 97556:\ :ty#winchester:ns#72:nt#11:nc#1668: HP 97558:\ :ty#winchester:ns#72:nt#15:nc#1933: HP 97560:\ :ty#winchester:ns#72:nt#19:nc#1933: HP C2247 1.05GB:\ :ty#winchester:ns#95:nt#13:nc#1661:\ :pc#2051335:oc#0:\ :pg#1640080:og#0:\ :ph#411255:oh#1640080: HP C3010 / Cranel 2.0GB Fast SCSI2 H10:\ :ty#winchester:ns#95:nt#19:nc#2165: HP97548SU 664MB:\ :ty#winchester:ns#56:nt#16:nc#1445:\ :pa#35840:oa#0:ba#8192:\ :pb#71680:ob#35840:\ :pc#1294720:oc#0:\ :pg#197120:og#215040:\ :ph#342720:oh#609280: Hewlett Packard C2490A:\ :ty#winchester:ns#107:nt#18:nc#2159: Hewlett Packard C3323A:\ :ty#winchester:ns#98:nt#7:nc#2995: Hewlett Packard C3725S:\ :ty#winchester:ns#140:nt#9:nc#3362:\ :pc#4236120:oc#0:\ :ph#4193280:oh#1260: Hitachi DK315C-10:\ :ty#winchester:ns#75:nt#11:nc#2467: Hitachi DK315C-11:\ :ty#winchester:ns#58:nt#15:nc#2478: Hitachi DK315C-14:\ :ty#winchester:ns#75:nt#15:nc#2462: Hitachi DK326C-10:\ :ty#winchester:ns#87:nt#7:nc#3200: Hitachi DK326C-6:\ :ty#winchester:ns#87:nt#4:nc#3200: Hitachi DK515C-78:\ :ty#winchester:ns#69:nt#14:nc#1354: Hitachi DK516C-16:\ :ty#winchester:ns#80:nt#15:nc#2170: Hitachi DK517C-37:\ :ty#winchester:ns#81:nt#21:nc#3297: Hitachi DK815-10:\ :ty#XD7053:ns#67:nt#15:nc#1735: IBM 0662-S12:\ :ty#winchester:ns#114:nt#6:nc#3002: IBM 0662S12:\ :ty#winchester:ns#108:nt#5:nc#3803: IBM 0663-E15:\ :ty#winchester:ns#37:nt#20:nc#3182: IBM 0663L12:\ :ty#winchester:ns#66:nt#15:nc#1979:\ :pc#1959210:oc#0: IBM 0664-M1H/N1H:\ :ty#winchester:ns#86:nt#16:nc#2856: IBM 0664CSH:\ :ty#winchester:ns#125:nt#30:nc#2787: IBM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM DFHSS1x:\ :ty#winchester:ns#125:nt#4:nc#4383: IBM DFHSS2x:\ :ty#winchester:ns#125:nt#8:nc#4388: IBM DFHSS4x:\ :ty#winchester:ns#125:nt#16:nc#4390: IBM DPES-31080:\ :ty#winchester:ns#108:nt#4:nc#4901:\ :pc#2117232:oc#0: IBM DSAS-3270:\ :ty#winchester:ns#108:nt#2:nc#2542: IBM DSAS-3360:\ :ty#winchester:ns#108:nt#2:nc#3297: IBM DSAS-3540:\ :ty#winchester:ns#108:nt#3:nc#3259: IBM DSAS-3720:\ :ty#winchester:ns#108:nt#4:nc#3292: IBM OEM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM OEM DFHSS2F:\ :ty#winchester:ns#135:nt#8:nc#4076:\ :pa#4100760:oa#0:ba#8192:\ :pb#301320:ob#4100760: MAXOPTIX (NON-ISO, 1024b) DATA:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 1024b) SYSTEM:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 512b) DATA:\ :ty#winchester:ns#60:nt#1:nc#15081: MAXOPTIX (NON-ISO, 512b) SYSTEM:\ :ty#winchester:ns#60:nt#1:nc#15081: MICROP 4221-09MZ 10204:\ :ty#winchester:ns#139:nt#9:nc#3198:\ :pc#4000698:oc#0: MICROPOLIS 1991-27:\ :ty#winchester:ns#149:nt#27:nc#4400: MICROPOLIS 3243-19:\ :ty#winchester:ns#106:nt#19:nc#4139: MICROPOLIS 4110-09:\ :ty#winchester:ns#95:nt#9:nc#2283: Maxtor 7213SR NB:\ :ty#winchester:ns#65:nt#4:nc#1595:\ :pc#414700:oc#0:\ :pg#414700:og#0: Maxtor DXP3105S:\ :ty#winchester:ns#57:nt#14:nc#2568: Maxtor LXT-200S:\ :ty#winchester:ns#43:nt#7:nc#1117: Maxtor LXT-340SY:\ :ty#winchester:ns#70:nt#7:nc#1355: Maxtor LXT535ST:\ :ty#winchester:ns#61:nt#11:nc#1547:\ :pc#1038037:oc#0: Maxtor MXT1240S:\ :ty#winchester:ns#70:nt#15:nc#2306:\ :pc#2421300:oc#0:\ :pg#2421300:og#0: Maxtor P0-12S (1632):\ :ty#winchester:ns#90:nt#15:nc#1478:\ :pc#1995300:oc#0:\ :pg#1995300:og#0: Maxtor P0-12S (1795):\ :ty#winchester:ns#90:nt#15:nc#1510:\ :pc#2038500:oc#0:\ :pg#2038500:og#0: Maxtor P1-17S:\ :ty#winchester:ns#83:nt#19:nc#1816:\ :pa#78850:oa#0:ba#8192:\ :pb#78850:ob#78850:\ :pc#2863832:oc#0:\ :pd#78850:od#157700:\ :pg#2469582:og#236550:\ :ph#78850:oh#2706132: Maxtor P1-17S NB:\ :ty#winchester:ns#90:nt#19:nc#1711:\ :pc#2925810:oc#0:\ :pg#2925810:og#0: Maxtor XT-1050:\ :ty#ACB4000:ns#17:nt#5:nc#1020: Maxtor XT-3280S:\ :ty#winchester:ns#25:nt#15:nc#1222: Maxtor XT-4380S:\ :ty#winchester:ns#36:nt#15:nc#1202: Maxtor XT-8380S:\ :ty#winchester:ns#53:nt#8:nc#1626: Maxtor XT-8610E:\ :ty#winchester:ns#52:nt#12:nc#1626: Maxtor XT-8760E:\ :ty#winchester:ns#50:nt#15:nc#1616:\ :pa#97500:oa#0:ba#8192:\ :pb#63750:ob#658500:\ :pc#1212000:oc#0:\ :pd#280500:od#97500:\ :pe#280500:oe#378000:\ :pf#489750:of#722250:\ :pg#561000:og#97500:\ :ph#658500:oh#0: Maxtor XT-8760S:\ :ty#winchester:ns#54:nt#15:nc#1614: Micropolis 1304:\ :ty#ACB4000:ns#17:nt#6:nc#825: Micropolis 1325:\ :ty#ACB4000:ns#17:nt#8:nc#1022: Micropolis 1355:\ :ty#winchester:ns#34:nt#8:nc#1018: Micropolis 1528-15:\ :ty#winchester:ns#83:nt#15:nc#2102:\ :pa#32370:oa#0:ba#8192:\ :pb#64740:ob#32370:\ :pc#2616990:oc#0:\ :pg#2519880:og#97110: Micropolis 1548-15:\ :ty#winchester:ns#131:nt#15:nc#1701:\ :pa#33405:oa#0:ba#8192:\ :pb#66810:ob#33405:\ :pc#3342465:oc#0:\ :pg#3242250:og#100215: Micropolis 1558:\ :ty#winchester:ns#35:nt#15:nc#1218: Micropolis 1578-15:\ :ty#winchester:ns#35:nt#15:nc#1231:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#646275:oc#0:\ :pg#548625:og#97650: Micropolis 1588-15:\ :ty#winchester:ns#53:nt#15:nc#1637:\ :pa#32595:oa#0:ba#8192:\ :pb#65190:ob#32595:\ :pc#1301415:oc#0:\ :pg#1203630:og#97785: Micropolis 1598-15:\ :ty#winchester:ns#70:nt#15:nc#1931:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#2027550:oc#0:\ :pg#1929900:og#97650: Micropolis 1624-7:\ :ty#winchester:ns#114:nt#7:nc#1647:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#1314306:oc#0:\ :pg#1216152:og#98154: Micropolis 1674-7:\ :ty#winchester:ns#35:nt#7:nc#1255:\ :pa#16415:oa#0:ba#8192:\ :pb#32830:ob#16415:\ :pc#307475:oc#0:\ :pg#258230:og#49245: Micropolis 1684-7:\ :ty#winchester:ns#53:nt#7:nc#1785:\ :pa#32648:oa#0:ba#8192:\ :pb#65296:ob#32648:\ :pc#662235:oc#0:\ :pg#564291:og#97944: Micropolis 1908-15:\ :ty#winchester:ns#95:nt#15:nc#1890:\ :pa#32775:oa#0:ba#8192:\ :pb#65550:ob#32775:\ :pc#2693250:oc#0:\ :pg#2594925:og#98325: Micropolis 1924-21:\ :ty#winchester:ns#94:nt#21:nc#2072:\ :pa#33558:oa#0:ba#8192:\ :pb#67116:ob#33558:\ :pc#4090128:oc#0:\ :pg#3989454:og#100674: Micropolis 1926-15:\ :ty#winchester:ns#101:nt#15:nc#2769:\ :pa#33330:oa#0:ba#8192:\ :pb#66660:ob#33330:\ :pc#4195035:oc#0:\ :pg#4095045:og#99990: Micropolis 1936-21:\ :ty#winchester:ns#101:nt#21:nc#2772:\ :pa#33936:oa#0:ba#8192:\ :pb#67872:ob#33936:\ :pc#5879412:oc#0:\ :pg#2846382:og#101808:\ :ph#2931222:oh#2948190: Micropolis 2105-8:\ :ty#winchester:ns#94:nt#8:nc#1448:\ :pa#32336:oa#0:ba#8192:\ :pb#64672:ob#32336:\ :pc#1088896:oc#0:\ :pg#991888:og#97008: Micropolis 2108-10:\ :ty#winchester:ns#94:nt#10:nc#1450:\ :pa#31960:oa#0:ba#8192:\ :pb#63920:ob#31960:\ :pc#1363000:oc#0:\ :pg#1267120:og#95880: Micropolis 2112-15:\ :ty#winchester:ns#94:nt#15:nc#1452:\ :pa#33840:oa#0:ba#8192:\ :pb#67680:ob#33840:\ :pc#2047320:oc#0:\ :pg#1945800:og#101520: Micropolis 2205-05:\ :ty#winchester:ns#109:nt#5:nc#2088:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#1137960:oc#0:\ :pg#1039860:og#98100: Micropolis 2210-09:\ :ty#winchester:ns#109:nt#9:nc#2099:\ :pa#33354:oa#0:ba#8192:\ :pb#66708:ob#33354:\ :pc#2059119:oc#0:\ :pg#1959057:og#100062: Micropolis 2217-15:\ :ty#winchester:ns#109:nt#15:nc#2105:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#3441675:oc#0:\ :pg#3343575:og#98100: Micropolis 4110:\ :ty#winchester:ns#114:nt#9:nc#1998: Micropolis 4221:\ :ty#winchester:ns#109:nt#9:nc#4079:\ :pa#4001499:oa#0:ba#8192:\ :pc#4001499:oc#0: NEC D2363:\ :ty#XD7053:ns#67:nt#27:nc#964: NEC-D2352:\ :ty#XD7053:ns#57:nt#19:nc#758: Quantum ELS 127S:\ :ty#winchester:ns#54:nt#3:nc#1541: Quantum ELS 170S:\ :ty#winchester:ns#54:nt#4:nc#1542: Quantum ELS 85S:\ :ty#winchester:ns#54:nt#2:nc#1535: Quantum Empire 540S:\ :ty#winchester:ns#92:nt#8:nc#1431: Quantum Empire 1080S:\ :ty#winchester:ns#92:nt#16:nc#1431: Quantum Empire 2100S:\ :ty#winchester:ns#137:nt#12:nc#2497:\ :pc#4105068:oc#0: Quantum GoDrive 120S:\ :ty#winchester:ns#56:nt#4:nc#1067: Quantum GoDrive 160S:\ :ty#winchester:ns#58:nt#4:nc#1413: Quantum LPS 105S:\ :ty#winchester:ns#42:nt#4:nc#1221: Quantum LPS 120S:\ :ty#winchester:ns#60:nt#2:nc#1987: Quantum LPS 240S:\ :ty#winchester:ns#60:nt#4:nc#1995: Quantum LPS 270S:\ :ty#winchester:ns#76:nt#7:nc#992: Quantum LPS 525S:\ :ty#winchester:ns#70:nt#6:nc#2444: Quantum LPS 540S:\ :ty#winchester:ns#125:nt#4:nc#2113: Quantum Lightning 730S:\ :ty#winchester:ns#63:nt#16:nc#1415:\ :pa#161280:oa#0:ba#8192:\ :pb#96768:ob#161280:\ :pc#1426320:oc#0:\ :pg#1168272:og#258048: Quantum PD 80S:\ :ty#winchester:ns#34:nt#6:nc#832: Quantum PD 120S:\ :ty#winchester:ns#42:nt#5:nc#1114: Quantum PD 170S:\ :ty#winchester:ns#42:nt#7:nc#1117: Quantum PD 210S:\ :ty#winchester:ns#49:nt#7:nc#1189: Quantum PD 425S:\ :ty#winchester:ns#60:nt#9:nc#1540: Quantum PD 700S:\ :ty#winchester:ns#70:nt#8:nc#2441: Quantum PD 1050iS:\ :ty#winchester:ns#92:nt#12:nc#1859:\ :pc#2052336:oc#0: Quantum PD 1050S:\ :ty#winchester:ns#70:nt#12:nc#2444: Quantum PD 1225S:\ :ty#winchester:ns#70:nt#14:nc#2442: Quantum XP32150:\ :ty#winchester:ns#109:nt#10:nc#3850: Quantum XP34301:\ :ty#winchester:ns#118:nt#20:nc#3561: Quantum XP34300W:\ :ty#winchester:ns#107:nt#20:nc#3907: RICOH RO-5031E:\ :ty#winchester:ns#54:nt#15:nc#710:\ :pc#575100:oc#0: RZ24:\ :ty#winchester:ns#38:nt#8:nc#1344:\ :pc#409792:oc#0: RZ55:\ :ty#winchester:ns#35:nt#15:nc#1218:\ :pa#32025:oa#0:ba#8192:\ :pb#59850:ob#32025:\ :pc#639450:oc#0:\ :pg#547575:og#91875: SEAGATE ST11950N:\ :ty#winchester:ns#81:nt#15:nc#2715:\ :pc#3298725:oc#0: SEAGATE ST15230N:\ :ty#winchester:ns#111:nt#19:nc#3974: SEAGATE ST31200N:\ :ty#winchester:ns#85:nt#9:nc#2692: SEAGATE ST31230N:\ :ty#winchester:ns#104:nt#5:nc#3978:\ :pc#2068560:oc#0: SEAGATE ST32550N:\ :ty#winchester:ns#109:nt#11:nc#3495:\ :pc#4190505:oc#0: SEAGATE ST3600N:\ :ty#winchester:ns#79:nt#7:nc#1853:\ :pc#1024709:oc#0: ST83220K:\ :ty#"ISP-80":ns#102:nt#19:nc#2652: SUN0104:\ :ty#winchester:ns#35:nt#6:nc#974: SUN0121:\ :ty#winchester:ns#39:nt#4:nc#1520: SUN0207:\ :ty#winchester:ns#36:nt#9:nc#1254: SUN0327:\ :ty#winchester:ns#46:nt#9:nc#1545: SUN0424:\ :ty#winchester:ns#80:nt#9:nc#1151: SUN0535:\ :ty#winchester:ns#80:nt#7:nc#1866: SUN0669:\ :ty#winchester:ns#54:nt#15:nc#1614: SUN1.3G:\ :ty#winchester:ns#80:nt#17:nc#1965: SUN2.1G:\ :ty#winchester:ns#80:nt#19:nc#2733: Sabre ST82500J:\ :ty#XD7053:ns#82:nt#19:nc#2609: Seagate (CDC) Wren V 94181-702:\ :ty#winchester:ns#48:nt#15:nc#1543: Seagate (CDC) Wren VI 94191-766:\ :ty#winchester:ns#52:nt#15:nc#1659: Seagate (CDC) Wren VII 94601-1.2G SunOS 4.1.1:\ :ty#winchester:ns#70:nt#15:nc#1925: Seagate (CDC) Wren VII 94601-15:\ :ty#winchester:ns#71:nt#15:nc#1905: Seagate (CDC) Wren VIII ST41650N:\ :ty#winchester:ns#89:nt#15:nc#2070: Seagate Elite ST43400N-3.5G:\ :ty#winchester:ns#99:nt#21:nc#2736:\ :pa#2843360:oa#0:ba#8192:\ :pb#2843360:ob#2841993: Seagate IPI ZBR Elite:\ :ty#"ISP-80":ns#78:nt#17:nc#1893:\ :pa#34476:oa#0:ba#8192:\ :pb#132600:ob#34476:\ :pc#2510118:oc#0:\ :pg#663000:og#167076:\ :ph#1680042:oh#830076: Seagate ST11200N:\ :ty#winchester:ns#80:nt#15:nc#1714:\ :pa#2056800:oa#0:ba#8192:\ :pc#2056800:oc#0: Seagate ST11900N:\ :ty#winchester:ns#83:nt#15:nc#2619:\ :pb#498000:ob#0:\ :pc#3260655:oc#0:\ :ph#2761410:oh#498000: Seagate ST1239N SWIFT:\ :ty#winchester:ns#35:nt#9:nc#1264: Seagate ST12400N 2.4GB:\ :ty#winchester:ns#82:nt#19:nc#2668:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#4156744:oc#0:\ :pg#4058590:og#98154: Seagate ST12550N:\ :ty#winchester:ns#80:nt#19:nc#2747: Seagate ST1480N:\ :ty#winchester:ns#64:nt#9:nc#1456: Seagate ST15150N:\ :ty#winchester:ns#78:nt#21:nc#5119:\ :pc#8384922:oc#0: Seagate ST410800N  (@haB   @@haB,C( @@=@@<@`dT U@haM @5PP (0pLla@haL @haL @haL/!@haL @haL @haLja@haL @haL @haLGٶB!@haLN@haLN@haL:nVa@haLI@haLI@haL[!@haL߀@haL߀@haL:[!@haLv@haLv@haLvw f!@haL@haL@haLw"!@haLz9@haLz9@haLz9w-!@haL@haL@haLw*!@haLf@haLf@haLfwxUe`^sO@n`LKwб2<6J悹@ٚ9I%ɼdcReґ =-X(d[u8E.h<Ƥ<X4r8/YBzf?t/%Xb-#jeW ʆIr1|VTw\ꮖ9BZ~4+'&<a  Nn}of!KF _syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 server/var/empty/sbin/nologin2_identd*identd/var/empty/sbin/nologin3_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 server/var/empty/sbin/nologin1popa3dLGhc ~ y 2  2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmspfa#GB _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin3G_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ZU n D n_tcpdump*LLtcpdump/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/csh2_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/csh3proxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T _Z  < 7 w nobody*Unprivileged user/nonexistent/sbin/nologin2www*CCHTTP server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadminvm,%KB s n   z 5 0 _isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_tcpdump*LLtcpdump/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/csh1root\Vpk-( Z U  p : pnamed*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucppk(# s proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_tcpdump*LLtcpdump/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerdElite 9:\ :ty#winchester:ns#108:nt#27:nc#6087:\ :pc#17749692:oc#0: Seagate ST42100N - Wren 9:\ :ty#winchester:ns#96:nt#15:nc#2574:\ :pc#3706560:oc#0: Seagate ST42400N Elite 2:\ :ty#winchester:ns#84:nt#19:nc#2604:\ :pc#4155984:oc#0: Seagate Sabre-5 ST81236J:\ :ty#XD7053:ns#82:nt#15:nc#1633:\ :pa#99630:oa#0:ba#8192:\ :pb#261990:ob#99630:\ :pc#2008590:oc#0:\ :pd#548580:od#361620:\ :pe#1098390:oe#910200:\ :pf#361620:of#0:\ :pg#1646970:og#361620:\ :ph#1908960:oh#99630: SeagateST3283N:\ :ty#winchester:ns#57:nt#5:nc#1689: Sun1.0G:\ :ty#winchester:ns#80:nt#15:nc#1703: SyQuest SQ555:\ :ty#winchester:ns#34:nt#2:nc#1273:\ :pc#86564:oc#0: Toshiba MK 156F:\ :ty#winchester:ns#34:nt#10:nc#815: Vertex V185:\ :ty#ACB4000:ns#17:nt#7:nc#1163:  8`@#`.#" $@``T@+#t.c@Z"@H*/++-"ct  0  " +" Ԑ *+" ̊!`+" @㿐@l+"$&@(#X-#|`&L@ 3&&#p3&1-%-/&+-)--&'-5&7+9- ;-#@qc@ x $xx cp@x!@ M! 2%cp@@@ L@ 2@ڒ ܐ@@ːȀ`#tcb1   @'+Ȇ? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1?&@#1?㿘 #@(1&@#1㿘@; " ܒ㿘 @X㿘+#x` @e+ "a0- #@ #x $#x㿘+cx ? "cx+@ca0㿐%+@*0?4.!X'@5&@R#@ 0 2'-&.a`@H#0'1.#+`!T@ 3bp 2-!T@''bp@4 !T'0@6bp - -#ā 2 -"ȁ㿘-` 2-+"Ȑ#|"`"`"`"` "`"`" @`  "cİ? -  ?- 㿘  ; < 㿘 + `@ @<   @1"&  ?  㿘+ Ȁ`-@|-ct  $  -+ c"p-"#|JJ`  -2*@-#|@ (*`J@ @ *`  +c-"#pJ  *@J` )*@ct -`"#|``*J@ -& @-- *:  c` d a #xJ@ s #xJ@  #x$#x#a @ ##xJ@  @㿘@ + Ȩ`  @W`x$` $`%--#t `( $ -cp€  #̒`$` $`$@ 'p@ @02p@ǐ $`&` 2!--+a @ِ"} 'p@ X0"+`ؔ @ʐ+` @Ŕ + "a, +`!4 $$ 㿘#-ct`   ``*  `ct   '@`2`0`,6 * '@ 㿘  & `& $& (   € " '@ 㿘 ` @+ -#t `( ( @0@ 㿘   2  @ $ ?,`$ *㿘-#t` `0`4 㿘-#t` `?`8 ? 㿘  ,`'@D x?@ `?㿘 ,m`€s㿐-t ` #t    #tO!+ #?  `$ *t`P Ȁ`/`$*O O /O㿘㿐-#t `      O ? X/O O /O㿐-#t/  0T@㿘  㿘-#t`t€㿘@+@Z`㿐-ct    #tX#t p@X+ Ȁ` + ##` +   Ћ@+@ `` * * * * * *3-ct` `€ 0 ' @@ct|@㿘-#t` !+`@'@N`'@a '' a@ ' @a   !d`!dN@J@2J`N` " 2 㿘-#t` €' 0! @ 㿘!+#ߖ ??" #.㿘),! ?N  @  -"#8#8$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` '@!H+  " * @7 $`0 "$`4 " @D$` @ 2!&  %! '@!h 㿘#,a  @ 4 "$a & 4$a㿘+ ̓*`@ +'!@v" ++!        '!@_` `+ Ԅ@ + ̕8 <?*   آ&@  ` + @㿘?(,,1-\&#t H L` T ` X P d l$ p  t @, .@㿘- c@_ 4 4 -@ scĒ'@ !G '!#@  ##@ 8?@?# @!a%#?@?# @!a#?@?# @! a #?@?# @ '0 `'#@ @Ő!耦 @㿐`'@"@?@ %?# @! `  a `  `  @u`@`쀢 '@?  ?# ! ? ?# !!'` !'@!',@`@2,@`@s"`@`Z'` "@f@ ` "`,@?`` A'`,@`",``,``,``@N``@`@5'@ @  -',@ ,` ,` ,`  ?`@v'@'" @#``? ? -"c'"(@@A& @"0 ` @  ! ??#2   @7 :d뀤 '@`,    6`,`  ̘D  "`,= x*@ `,*` -c@  '@"H0'@ E   2 `, "`,`@"'@`, @ 2`,'@"X? P# 2H  C'"x'"'" @x    d d @ "@  @@ @X @ E   :    '"@ @N"   @@ "  @" `,   @` %   - d"#  "  4-c@  '@""0`0, * @c@-c@ r '@ "0-c!' "-c!'"-c!'#@ ] @0k`0@ `7E    @ " `("L@ 5 1' ? )'""'" @ː    d   @ @` ?$ @ @E  `0Ѡ (-'@#(-c 4 4&` &`6`*@h6`,@? -"c''@@#0 㿐` @ 0@Eฐ`@ @༠@* @ @ג@x` * d, `0 200@"x @* @ @ ?  "? 6"?% 0@ 㿘 `  .` 8@ ^&  @   @`&@``@@6``,`G D& h`?  ,` @@!  @0$@     d ,  0 2 0 2 %@` ,`@@,`& 㿐   <P @* 40*:  8  20 @8 0<D @L@ @  Ȁ)n 2; @=0$  " @]  d  *  0 @]$ $  $@&@&    b 8   @   " & 㿐`@  <@`@-5 2& :@ "   2  @  " *@B<@@` ڐ2 ``@Ӑ 㻀@ Ц @ &`@@$`   `  @2 %\F!T@  0@@eg0   @ t,   $@  'a L@  @5<`/2L@`L@ /"`L@"y   נ  / ``4k `L@  /`,@P谒 \,@, W(  2LL@@/ $H  E;@j%( 8@b"@( 0 K䰒 *@E`  d*  0` @AO / ' 'ݒ L@  @   0@! @@ Ё㿘 &     . @ "  @0  .  "  @ 0 @ @  а 㿐 @ @&B<@@`@@ ``@0 2&     ":?"   ? @ : ` :?  2`"` "`:`0㿐`  8 `@@2.@``@.@+?) @ " " ""@@C <@  @ @ @ B <@   @(*`  pZ j.!X1a"'А $  $ $ ''X@Ғ 2V?+bH??"bH4` $@!#`"#@ #\ @  !-'@L#8;?#-#c@#*`4c' @2 `'@3#`"?.'ܠ .a`L"L@~܀ ?."x.`Ȕx@t܀  ?.b`@܀ ? ?  M.!L.a`?@G 2B?@@> 29?+bH-?"bH6 "&#`a#@b#\ @   - H"c''@( ?@I ?#'@ ? ?㿘`&"@  &@  㿘 &   ? @&@ m.@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@# @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` 㿐@ ( ( @ `  -``( ( '#@ڔ     2` * @h *`  * +` **` +   h  (@ g@ Z@ ~`-`  ` րϰ    *` *   *  M `/  M /" M MJL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @ ``  `-`( U(  gh 8  *   *` *   @ @@ ˀg@+ @    >>>&`>  * *`   * & +` * +   :>@ 0  @  @ 㿘  @ &  㷐 R@ N`@4 @H``@C@2 *@ `  @ h,  ( )􀢨$ 2@` ' 8'" w@ S'@@ @ B <@&hhB <@2&     ":?"   ? @ : ` :?  $2`"`"`  :`0   㿘  ,  ". /.".+."&  "!"..^ 0Y W ?T 0Q @͠LK *L0E 0B 0pؒ  @ Ɛ@ v 8 'p@ t    $ #`a#\b` @  ? - H "c؀`-@   "#İ?㽠P  x@   'P $` $` $`  $$` ($` ,$`@ -$` 8 @ nt$`     h #`ab`$#\ @ ? -# x 0  &,& &&& D& &(&$@ <㺈 ` ($ a b????#\#`  @ ? -# `  dh@ d .@  ?0  '  $  $  (  ,     $$L#`a $b (#\  @L ,? L `" H-"#Ē?@T@֔0 '#@ - H"cİ?㿘@Ӑ +- "c"H-""H6 & 2?-c"cȖ0 "!"0" ?㷈-#Ȯ#Ȑ` '@ Ȑ# N  m `/2N N /" N a  0 ] @I x  <$N O  N  /  .ؔ A.0 0Ȣ" 2;@ @  $+  (@D;@@O`/ Ȁ@0 x@, x  @% x N  &`  @ x@ x㿘  "& @ x&  㿘' #-!-%'@    ? c2  ! @   ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  +0(( 4 2`:2` <"` @"`D :`0 㿐\@?<6   '?'?@ ?. '?` '?`@""?'?Đ #`#` #`#`#\ #`c$ #@? -` @``2'"@#- H"cİ?㿘!-$#@H . @ 2?`2 ?`(` $#Đ @i ??"@?2..@( 2  2 2 *?. Ā #  .(@"# " " " 㾐a"@2 o'Ô?'' "p #\#` ""   C   p'–0 !-#@c?(@ 8 H$#ā8G8G8H8H8G8G8H8G8H8H8H8H8H8H8H8H8H8H8H8H8H8G8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8G8H8H8H8H8H8H8H8H8G8H8H8H8H8G`8Gl8Gx8G8G8G㿘`X1!Г*` €1(0 H1(- `1(* x1(' 1($ 1(! 1( 1( 1( 1(!1(!01(!X1( !p1( !1,(! @ @! ,,`d@**@`"`㿘#,,!,"ah$ad ,P'P'T'X@Y$!`ad!` *`2*`& (@,!J?  .@ 7Ɛ(   , 4 , 4 ` 44 `~4 `4 `4 `b,4 `4 #\"X .@W (@!? .2aX aX2  aX @ 0+ ? @ +??"bX $`㿘+ h@m 5㿐@-!"#  5@2?@ 2?`(2?`&2?` 2 ? `@  ??x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` +"    .`'"`'ܐ@-ܖ@ܘ( @?(!@<x@ް {ހ( (  u?@p?2n?<@ 2g? 2c?6``<`]@l 2Y? &U?``  2M?` &@ǐ  4 & ` 2>?` "6`` %(@"0? ,  $ $ ' '`'''4 @.  ?$$ $ $ $ $$ $ $ $ ` ??㿘\   )- <+(`%#(?@ @b8@,`4 2 #Ā   $$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘,!,@  .  @ 0,@@ "@t  0,@@  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "< N ,N`$* `.! ؒN*`? @ . ɒ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* 㿘 3` 3` 3`  .+`+`+`+`3` c+` ??㿘b  @,   +bh@%  "` ?` ?7,+Pመ :  0 *@ `  *@`*@`,*!" @ ` ?  2  㿘,a'H'L'P'T 'X @"a@H(@"`>㿘("h㿘." , @` @ , 㿘@@n㿘@ 㿘 D " ? 2  H1- L&#@e  $ #Đ `$ D?$ @ L$ ?$  @`$㿘אԐ* А* ̐?. ?$`@㿘+"  , @     & &"   & T`?& & S`?   2?  ?B& @     `* ??w?2? o  e  "  D Z   D  ?& @㿘@h?7`5@ X,!. `%"   >`P>@>`>`>`>` >`(>`0>`8>`@>`H(p?@ @ `@ &`L&@Z&`H0 @ `@ X@ɐ?㿘 - "c?.". @ ,. ! @  L@@ X@㿘,!.   @?? ?2%  ?% @%   T "<   8 @a    "@"% %% %  "  @* 4 -#Ā`% D " %   &   B @ B = = % DW  D  L!-$#Đ@ % #Ā % D L%@ '% @  P@H" % P  P ?% @ @   @&  = =   @) % P @ 2   D 2   2x T  P@"  % P&㾘 - ."- @,@8!-  `T @?2*$`(&$`" ` -o l-k @ F`2.``)  @ ?V @ `L  <`P<@<`<`<`<` <`(<`0<`8<`@<`H(p?@ @$@$`L$`H`4 `5`@1`@ f )`' a !ɒ: @-  Zd 4 `0 Z"cİ??+ ? * `:```? +c "c"    +?"  @ @   @ *0   @ *`㿘.. " @  @  - $"c2  " @      @ $-"#Ā`- "#İ?㿘.. "@ @  - "  -  Z :@B: Z"cİ? ?   ` 㿐." @  `  ` - D"c$@$`$` 'I 8-@`` / "`J +`)$@&$` !,@  -" € ` `!, `" ` @-"#$@?㿐.. " @@  - ,"c" @ * 2`      - "c B< ' - "c&?8f`8g$8gl8h(8h(8h(8h(8h(8h(8h(8fX8h(8h(8g8g8h(8h(8g48h(8g8h(8h(8h㿘'H'L'P'T'X"Ē@ H㿘"Ē@8N@`N@`%` N@`|`!H*` € @wL` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @/ N@ @& N@ @ N@ 0 x  @ N@ % w ls㿈("x@ @,@ؐ  ?L?㿘+#` ,!( bJ@ x#!v (+#l@ +# @  'h@@B`@ ` l  ($l"ƒ  .ؐ 7Ɛ(  , 4 , 4  ~4   44  4  4  4 hb4 j4 h"$@#\ .0? hl'l(Ӑ" ` `4` l4`  $l4`㿘+hR(㿐h--"#(2*?@ 2&?`(2"?`&2?`  @??+#l+*@  *`@ `v  ??㿘@ /`(+`&'` # `Z   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (6`@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   ?: :  *2@ : J@   J@J`   J " @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &   `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  8}L8~<8~8~8~88,888,88T88L8888888 "? $`2"`?  : " : e("`D"`d"`H"@"`"` "` "`$"`0"`4 㿘 N 12:?@ 5?2 (1? $ "P$ ($ 0 , 2 ("p$ , ( 0  `?$ $"` >` "` 8 ,"`"`,?€ 0$ $㿘 (*ؒbؔ  " P" D" L" H㿘 $ , 2   *@ (  0 $ ,>  2    * $ $ ($ $  &@@    ,?"@  $ (%$ $ (" @8 ,  0"@@   ,)"@ $ ($ $ (  $ ($ ( $ @@$ $ 㿈  $   "? 2  2? 2  $   04 `!D*` € ` $"&  @?*``` * 4 l  q*  m*4   e  @ $& 8  $ Ţ "f&  @?*``` ?c4 4 *` , $& 8   $   & & & &$4$0  @ɔ $& 8 $`"6&   `$@4 $"+&  @?*``` $4      *4 $  $ $#&  $4^ `$@` 4 "&  @?*```?c4  *$8   $8 88 ג"8%"@$8@%*@"&  @?*```  a$X4  $\4  $T4a򀢠 $$``T@*#X h"&  @?*``` ` *@*`3 $`4T `h(dL*#X(*`0  $` $L$D$d @_   *^#*#&  $ $$`X\` hL * ?D * @@7`񀢀7  "J&  @?*``L*?D * @@7`񀢀7  @   "*&  @?*`@ ` $@4`*`3`i$` !  @   "&  @?*`@ ` $@4`` *   45 @   "&  @?*`@ ` $@4  4` @   "&  @?*`@ ` $@4  4`X\ R?? h`?*`2`?$`X\` *QL( $D$L$ddX hL@ *X d*``h$H$P\  @yP y* $L * ?D * @@7`񀢀7  "t&  @?*``L*?D * @@7`񀢀7 - + 7*@* 7 2` "H&  @?*`` 2 D* @@7`7$@4$@4$8   $ @ }$2*  $@$@ @   "&  @?*`@ ` * 8? @$84 $@  $P * ?H * @@7`񀢀7  "&  @?*``P*?H * @@7`񀢀7 ` , 7*@* 7 2` "&  @?*`` 2 H* @@7`7$@4$@`@4 $< `$@$@ @   "&  @?*`@ ` * <? @$<4 $@ $<"@i $u&<"( , $ ""@8 8&@8"$8% @?.@``8 2 $H ;.@$` 6`8  ":&  @?*``` &@B > $@&@$& 8?c4 4 *` , *#&  j$   $ ?M?& & && $0$4   8   ْ  $3?  '  B& @B > >   $ @\"@$& 8 4@ " & 4`"?㿘 ? $` ,2`,0 `" ,€ 0 ,  0€ $$ $㿘 "4? $ "0?  *? @ @  ?j   $? @ ,"@   $ $ , "$ $ $   @  @0#   ( @#@㿐 P?`$ 2`0J 2 4 D?   ` 4  0 " * % 4%% 0  3*  0  42`?% 0 % 4  % `@```@ @B  " %`%@=` `?` `q  =`=`  % "? $ 2 ?  4`?㿘 `"a?`$"]?`("Y?`, 2`0S?  2,J?   * `( `0 2 @`0`,€?06@>`> `> `> ` > `(> (`0> 0`8> 8D zؒ"@ e( $DH:ؐ" ?%($Hdzؒ"@ e( $d *,Ȑ$,& $ 㿘?c6  @`W R1 !!6& @`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ @β` @`@񀦠,`@'X'D'H'T /```0 TH) @ ( 6T ` ?, "?8 "8?`    * " *  /`.  c``(/`  D YЄ&2? 7   ``0@`  D H) @ (@(0@X6 0  HD +4X '**!}='+?t' ( ?D'     ?%  ? 'X) '@ /67/. /@7 `/7 , ,/`7 @(3`0,626  ( 5@DX*`H(@ X"  ('@ @ ,(@& *.``@ . & 4`D, %A ,((#8}0 @//+  '7    /7 (3.0626 ߀ %T&@+     "@(  , ( 00? # + p㿘+#p`1,!㿘`+_ #p`G8,!@6  * `@@  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * 6  ` ,!@6  * `@ 8>> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x dvma_mapindvma_mapoutboot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s promprom0Can't open device `%s' Can't open network device `%s' xmit: not a network device %x mac-address drop swap 6 cmoveielefdxyxdstsddevice_typeblocknetworkbytenode %x property %s length %d > %d Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d2.2read header: %s ELFunknown executable format %d+%d+[%d+%d]=0x%x boot: short read read phdr: %s Can't find entry point. %s%lu+read text: %s +%luseek to section headers: %s read section headers: %d %s%ld [lseek symbols: %s read symbols: %s ] bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d CD001nfsread: short packet, %d < %ld nfs_open: must mount first. nfs_readH 0 h8D  D  tD   D  <(0 L ` 0 Pި0 ް0 @ ޸0 T  0 ,sparcsparc x (  |(ddd  p |(ddd Ƽ p@`dddddd   l4dd   `l4d  ( Ǵ `dddddTdd 8 < 0l4h Ќ  0l4d  D  `l4d @3Ԥ83Ԥ03Ԥ@38303 3333ָ 3ָ 3ָ3ָ3ָ3l3lx3 h3 X3<P3ՈH3 @3 83X`H0  XT(88XH0 μ ޭޭK %%%%Fh P Ҝ X0 ׸  $ < X ݀ ݐ ݘ 3t80(  T ` l x <x$lP @TP ` #P( *P( *PP #PP *P( l $ @D  |  0H (D * )X / 0 / 0< B< BD B E D ; = < A T8 Tx S S|  Y Z S S| PxhXH8(< z, z4 { {p {p(0h T L D z L |h X ||@|8|0K < h <}P , τT d   d 8 dT ( dPh  H< t  0X 0|D A BH, Y\ YQ ^L ^` ^t ^ ^ ^ ^ _ _(H m n o o   | T x € ´ Ìxph`XPH@8080( P d2d 8   < ++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>??  ` ~ ^ "' AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyxph`XPBoldface3x">""""&n@T((T`px|~~|xp`>~~>8|8888|8fffffffff~t0xs; x8|8888|88|8888888888888888|8 003f$ff$<~~<wfllllllll||| 0 `F8ll8vv0 000000 0 0f<ffff<~~~~`0``|```0||~~0  0~ 0`0 ~p~vv8ll8 Pp lllllx0`|||||||Gallant 3000` 3ff?ff`f>``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp383X  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް4X4 X24 `)4 a4 4!04!H4!4!4" 4"4",4"<4"L  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~4"o4#4$(4$04$@4$P  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     4$a?4%4&h4&x4"\&4$`!4&std4*4* hp iD j k@ kP iP d e0std4+P4+x m oP n o8 oH p@ kX khstd4+4, v x x$ x x y|X r sX¨1+$A'* + + std4,4, | ~ ~8 ~ ~ < zt {std4-4-8 ( 8 h  std4-4-  p < 8hstd4. 4.H h (` $Èstd4.4. L  t \ (std4/04/X < d Ę4 std4/40 8 0 ` @std40l40 \ Ȥ ” ¸std4041  X ϼ $` D ˠPstd41|41 x \ X ԰ std4242, , ߰  \H xstd4242 ( x ` p X `std4343< H std4343 L D X h p\ T xX  80( ( ` HP 2 3 8 8 I< r stڰh w xڸ L, \ l  l rd0  0 D   ~ L  H X `h P ɰ D L F B I< C C8 HH 0   @   0PX  L 0 X P  |  P@ɴ:d:::>l>d ` `8 ~ (  `   `  !X ȔɴdD P ɰ h И  0 4   Ȕɴ F B G H C l   @ p 0>t>?\ r t v v wX w Ȕ | X 8 T  HȔɴȔɴ}}~<O$OPVZ] XY<~  | X 4Q4Q4QD4DhP@0xhXH8(xhX@( xhXH8(ޭT @d.symtab.strtab.shstrtab.text.rodata.data.sbss.bss@`4!!8) ΀#H/4V4`54W4`x4`: