,PP@((ھ084 `@# ` "L" $@` `T@   bL@i"@H*/+  "b  0  "# "#Ԑ * "#̊!` "#@ bootxx%s: can't open device㿐@;#@  "aa @ "   @ޒ`@+  @ #Ȁ  "@@%s: alloc failed%s: block table corrupt%s: read failure%s: short read㿐! @z#ؤ   ! @`#ܢ @E #) ?#,`2  !@   ؟  !@ @؀@` "@z 2`@?@2 @a aa2 `@` c܀@ IJ@?  Ĉ`Ī` Đ`IJ` dvma_mapin㿘? #@(1? @4#1?dvma_mapout㿘 #@(1 @" 1㿘@ " ْ㿘 @  promprom0㿘 #Ȁ  @ "   ""@ `"@ J*@J` )J  *@Can't open device `%s' 㿘@  cȰ @@ "`  "@`"@`$@ 2$    b@@!x0  $   #Ȁ c`$`$` 㿘# b   ` ༟* `b   '@`20,6 * '@ 㿘  1& & $& (`   €4 " '@ 㿘 " `@ 0(@ 㿘 @ $ ? $  !*@ 㿐 "  / 0T@㿘  㿘 " tInvalid controller number prom_iopen: "%s" error=%d 㿘) !Ā ?D    " @6 8$ $  $ $`  @ * @ *`@`@F $0` "`$4` " @$ @  & !İ  %!@  㿘# aĀ    @ 4 "$a & 4$aāprom_mapin: length=%dprom_mapin: invalid maptype %d㿘 #̑* @ "@@            @y"X      #< #Ԛ@;@ ?*@Ԣ &@ ` #  @   ?( , H L\ T ` X` P d l  t$ p   *  ?@ * @:@ @?  ` "`" @  "@ ?"  㿘'H'L'P'T aȀ 'X "aȐ@4H @$ exit㿘 !0 ( ԝ㿘'L'P'T'X! $! !P@L!*㿘'H'L'P'T'X  8@ H㿘  8@8 "\ `N@`%` N@ `* 4444t4t4t4t4t4t4t44t4t44@4t4t44t4 4t4t4T L@v `ϒ L  ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@` - @1 N@@) N@@! |N@ 0 x @ oN@ % g lc0123456789abcdef㿈  @ @ ,@  ?L?|/-\㿘  А! ``J " @@    @*0    @*`2( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  4444444d44x4   4L444#4,4x74P=4F4 hO 4\4f4 n48w4d44 44(4 444h4 444`4p4 @ 7y]   @@7yҪ@@PQ/mnt<@`bT @ 7y   @@7yҪ@@P^<@`bT U7y\PP@(oQ](A 7y7y[fH7y[fHH(A7y 7y7ynAhyA7y7yM8~7yM8~Bv0 7y4687y87y %XPX`hpxr7y )o`7y :Kx7y :KxI\uVD7y 1ݰ7y 6vX7y ͻC$'77y 9SP7y :7y ͻ{!7y)%R7y)%R7y)&ߡ0jQ!7y)7y)7y)&ߡ0jϧ΄a7y*YX7y*YX7y*`Ra7y*G7y*G7y*`5㫨a7y* s7y* s7y*`"G<!7y*:7y*:7y*!6yG2!7y*3<7y*3<7y*!6!7y*_B7y*_B7y*!6֩a7y*+ ,X7y*+ ,X7y+ `l~a7y*/6.7y*/6.7y+ `K \a7y*2ɞ7y*2ɞ7y+ `$P!7y*6] 7y*6] 7y+ `6o"!7y*9}07y*9}07y+ `6j!7y+X7y+X7y+ `6va7y+,7y+,7y+/F0 La7y+X7y+X7y+/F0!a7y+7y+7y+/F0"'!7y+"7y+"7y+/F06 rG!7y+%07y+%07y+/F06! R!7y+(c(7y+(c(7y+/F06"m9a7y,7y,7y,ö0{ua7y,_7y,_7y,ö1s*a7y,@7y,@7y,ö2k!7y, x7y, x7y,ö60̇&!7y, p7y, p7y,ö61ҮI!7y,h7y,h7y,ö62a7y,".P7y,".P7y,8b0@-a7y,% H7y,% H7y,8b0AGa7y,(@7y,(@7y,8b0B>!7y,+87y,+87y,8b06@5!7y,/387y,/387y,8b06AI!7y,2.7y,2.7y,8b06Bǡa7y- 7y- 7y-pPY_^a7y- 7y- 7y-pQa7y-\7y-\7y-pR'!7y-9x7y-9x7y-p6P~/>!7y-p7y-p7y-p6QX^!7y-h7y-h7y-p6RF&a7y-+JP7y-+JP7y.0`ݳqa7y-.'H7y-.'H7y.0aa7y-1(7y-1(7y.0bs/!7y-4 7y-4 7y.06`!7y-77y-77y.06aD:!7y-:7y-:7y.06bOa7y.+7y.+7y.( _p4Sa7y.7y.7y.( _q$a7y.7y.7y.( _r!7y.7y.7y.( _6p4J!7y.7y.7y.( _6qC!7y. ‸7y. ‸7y.( _6rd!7y.:$(7y.:$(7y/ExѠ!7y/ ;?X7y/ ;?X7y/0Hx $! 7y/"+7y/"+7y/'oRXyg7y/*j/P7y/*j/P7y/*j/Pss0O! 7y//V7y//V7y/5yD7y/9P7y/9P7y/9Pss16!ޝ!7y0`7y0`7y0`.5!7y0[7y0[7y0[{ !7y0_7y0_7y0_^!7y07y07y0!7y0% 7y0% 7y0% 6L!7y0(j7y0(j7y0(jw$!7y0/-I(7y0/-I(7y0/-I(!7y02(& 7y02(& 7y02(& !7y097y097y09G!7y1G7y1G7y1G(!7y1n7y1n7y1n@!7y1 ij7y1 ij7y1 ijES!7y1@7y1@7y1@0;!7y187y187y18S!7y1wX7y1wX7y1wX!7y1TP7y1TP7y1TP9!7y1&;7X7y1&;7X7y1&;7XYO<\!7y1)6P7y1)6P7y1)6P!@!7y10\p7y10\p7y10\p >!7y13Wh7y13Wh7y13Wh !7y1:~p7y1:~p7y1:~p is!7y2h7y2h7y2h KU!7y2 7y2 7y2  BI!7y2 g7y2 g7y2 g JG!7y27y27y2 tj!7y27y27y2 :i0!7y27y27y2 U'!7y2l7y2l7y2l U!7y2&O7y2&O7y2&OP!7y2*Q07y2*Q07y2*Q00!7y227y227y22+?!7y257y257y25 a7y3 M7y3 M7y46N<]V!7y3k7y3k7y46N<nCta7y3 07y3 07y46N<.!7y37y37y46N<n*a7y3}87y3}87y46N<~FF!7y357y357y46N<ny-a7y3L7y3L7y46N<G!7y37y37y46N<nJa7y3 H7y3 H7y46N<!7y3"7y3"7y46N<n6Na7y3'if7y3'if7y46N<~ض!7y3)37y3)37y46N<nfNa7y3-_ 7y3-_ 7y46N<W!7y3/(p7y3/(p7y46N<n-Ma7y33Tژ7y33Tژ7y46N<ϑP!7y35`7y35`7y46N<n1a7y39+7y39+7y46N<A!7y47y47y46N<n a7y4֭7y4֭7y46N< Dp!7y4eX7y4eX7y46N<n a7y4 d7y4 d7y46N< s!7y4 .7y4 .7y46N<n ua7y4J7y4J7y46N< [!7y4P7y4P7y46N<n na7y4x7y4x7y46N< D!7y4@7y4@7y46N<n Rď|a7y4F+7y4F+7y46N< -]!7y47y47y46N<n Da7y4"S(7y4"S(7y46N<uY!7y4$m 7y4$m 7y46N<nU a7y4)17y4)17y46N<b|y!7y4+7y4+7y46N<n)ثa7y5U7y5U7y6/$gv7k!7y5<7y5<7y6/$gnJZцa7y57y57y6/$g_D!7y5 2Z7y5 2Z7y6/$gnt=a7y5^\(7y5^\(7y6/$gs2w!7y57y57y6/Pn5ۆa7y5쬘7y5쬘7y6/$gc!7y5N7y5N7y6/PnŔa7y5z 7y5z 7y6/$g6ۦ!7y5C7y5C7y6/Pn\sa7y5"@7y5"@7y6/$g'!7y5$k7y5$k7y6/Pn=7qa7y5(7y5(7y6/$gfq?!7y5*aM7y5*aM7y6/PnTa7y5-p7y5-p7y6/$gJ:b!7y50W7y50W7y6/PnLDa7y53w`7y53w`7y6/$gy!7y56L7y56L7y6/PnLa7y5;V7y5;V7y6/$g< !7y6@H07y6@H07y6/Pnaa7y6lJX7y6lJX7y6/$gG!7y66 7y66 7y6/Pn=a7y6 7y6 7y6/$g? !7y6 N7y6 N7y6/Pn+a7y6h7y6h7y6/$gy2O!7y6R07y6R07y6/Pn^a7y6~@7y6~@7y6/$g_!7y6p7y6p7y6/PnMa7y6C67y6C67y6/$guZ!7y6 7y6 7y6/Pn" a7y6#87y6#87y6/$g!7y6%7y6%7y6/Pnhj]a7y69޶h7y69޶h7y8(!x !7y767y767y8(!xna7y79@7y79@7y8(!x: !7y77y77y8(!xnET0a7y7 /d07y7 /d07y8(!xz!7y7 7y7 7y8(!xnapa7y7% 7y7% 7y8(!x~:!7y7h7y7h7y8(!xn?CXa7y77y77y8(!xT!7y7}&X7y7}&X7y8(!xn$b(a7y77y77y8(!x^w!7y7rH7y7rH7y8(!xn> /mnt/etc/dhclient.conf fi # If no zoneinfo on the installfs, give them a second chance if [ ! -e /usr/share/zoneinfo ]; then get_timezone fi if [ ! -e /mnt/usr/share/zoneinfo ]; then echo "Cannot install timezone link..." else echo -n "Installing timezone link..." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." fi md_installboot ${ROOTDISK} if [ ! -x /mnt/dev/MAKEDEV ]; then echo "No /dev/MAKEDEV installed, something is wrong here..." exit fi echo -n "Making all device nodes (by running /dev/MAKEDEV all) ..." cd /mnt/dev sh MAKEDEV all echo "... done." cd / _encr=`echo ${_password} | /mnt/usr/bin/encrypt -b 7` echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2> /dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0  . .. bin dev etckern mntmnt2sbin tmp usr varinstbin install.subinstallupgrade, bsd2.profile3 install.md4boot܀at timezone are you in [\`?' for list] [$TZ]? " getresp "$TZ" case "$resp" in "") echo "Timezone defaults to GMT" TZ="GMT" break; ;; "?") ls -F ${_zonepath}/usr/share/zoneinfo ;; *) _a=$resp while [ -d ${_zonepath}/usr/share/zoneinfo/$_a ]; do echo -n "There are several timezones available" echo " within zone '$_a'" echo -n "Select a sub-timezone [\`?' for list]: " getresp "" case "$resp" in "?") ls -F ${_zonepath}/usr/share/zoneinfo/$_a ;; *) _a=${_a}/${resp} if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then break; fi ;; esac done if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then TZ="$_a" echo "You have selected timezone \"$_a\"". return fi echo "'/usr/share/zoneinfo/$_a' is not a valid timezone on this system." ;; esac done } install_sets() { local _yup="FALSE" _have_nfs # Can we do an NFS install? test -f /sbin/mount_nfs && _have_nfs=true # Ask the user which media to load the distribution from. cat << __EOT It is now time to extract the installation sets onto the hard disk. Make sure the sets are either on a local device (i.e. tape, CD-ROM) or on a network server. You will have the chance to repeat this step or to extract sets from several places, so you don't have to try to load all the sets in one try and can recover from some errors. __EOT if [ "X$local_sets_dir" != "X" ]; then install_from_mounted_fs ${local_sets_dir} if [ X"$_setsdone" != X ]; then _yup="TRUE" fi fi # Go on prodding for alternate locations resp="" # force at least one iteration while [ X"${resp}" = X ]; do # If _yup is not FALSE, it means that we extracted sets above. # If that's the case, bypass the menu the first time. if [ X"$_yup" = X"FALSE" ]; then echo -n "Install from (f)tp, (h)ttp, (t)ape, (C)D-ROM" test -n "$_have_nfs" && echo -n ", (N)FS" echo -n " or local (d)isk? " getresp "" case "$resp" in d*|D*) install_disk resp=d ;; f*|F*) install_url ftp resp=f ;; h*|H*) install_url http resp=h ;; t*|T*) install_tape resp=t ;; c*|C*) install_cdrom resp=c ;; n*|N*) if [ -n "$_have_nfs" ]; then install_nfs resp=n else echo "Invalid response: $resp" resp="" fi ;; *) echo "Invalid response: $resp" resp="" ;; esac else _yup="FALSE" # So we'll ask next time fi if [ ! -f /mnt/bsd ]; then cat << __EOT You still do not have a /bsd in your filesystem (ie. the kernel), which seems to indicate that you are still missing important distribution files. So please continue installing... __EOT resp="" fi if [ ! -f /mnt/bin/cat ]; then cat << __EOT You still do not have a /bin/cat in your filesystem (ie. a sample random file which you probably want). This seems to indicate that you are still missing important distribution files. So please continue installing... __EOT resp="" fi # Give the user the opportunity to extract more sets. They # don't necessarily have to come from the same media. echo echo -n "Extract more sets? [n] " getresp "n" case "$resp" in y*|Y*) # Force loop to repeat resp="" ;; *) ;; esac done } munge_fstab() { local _fstab _fstab_shadow _dev _mp _fstype _rest # Now that the 'real' fstab is configured, we munge it into a 'shadow' # fstab which we'll use for mounting and unmounting all of the target # filesystems relative to /mnt. Mount all filesystems. _fstab=$1 _fstab_shadow=$2 ( while read _dev _mp _fstype _rest; do # Skip comment lines case "$_dev" in \#*) continue;; *) ;; esac # and some filesystem types (like there are swap,kernfs,...) case "$_fstype" in ffs|ufs|nfs) ;; *) continue;; esac if [ "$_mp" = "/" ]; then echo $_dev /mnt $_fstype $_rest else echo $_dev /mnt$_mp $_fstype $_rest fi done ) < $_fstab > $_fstab_shadow } mount_fs() { # Must mount filesystems manually, one at a time, so we can make # sure the mount points exist. # $1 is a file in fstab format local _fstab=$1 ( while read line; do set -- $line _dev=$1 _mp=$2 _fstype=$3 _opt=$4 # If not the root filesystem, make sure the mount # point is present. if [ "X{$_mp}" != X"/mnt" ]; then mkdir -p $_mp fi # Mount the filesystem. If the mount fails, exit # with an error condition to tell the outer # later to bail. if ! mount -v -t $_fstype -o $_opt $_dev $_mp ; then # error message displated by mount exit 1 fi done ) < $_fstab if [ "X${?}" != X"0" ]; then cat << __EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the installation process. __EOT exit fi } unmount_fs() { # Unmount all filesystems and check their integrity. # Usage: [-check] local _check _fstab _pid if [ "$1" = "-check" ]; then _check=1 _fstab=$2 else _check=0 _fstab=$1 fi if [ ! \( -f $_fstab -a -s $_fstab \) ]; then echo "fstab empty" > /dev/tty return fi ( _devs="" _mps="" # maintain reverse order while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo -n "Umounting filesystems... " for _mp in ${_mps}; do echo -n "${_mp} " umount ${_mp} done echo "... Done." if [ $_check = 1 ]; then echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done fi echo "Done." ) < $_fstab } check_fs() { # Check filesystem integrity. # $1 is a file in fstab format local _fstab=$1 ( _devs="" _mps="" while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done echo "Done." ) < $_fstab } check_kernel() { if [ ! -s /mnt/bsd ]; then echo echo "Warning, no kernel installed!" echo "You did not unpack a file set containing a kernel." echo "This is needed to boot. Please note that the install" echo "install kernel is not suitable for general use." echo -n "Escape to shell add /mnt/bsd by hand? [y] " getresp "y" case "$resp" in y*|Y*) echo "Type 'exit' to return to install." sh ;; *) ;; esac fi }  @ 0  @D, @' $+#@  /@X / "%8 %8 @<@`@`Ƃd??/usr/libexec/ld.soNo ld.so Failure reading ld.so Bad magic: ld.so Cannot map ld.so crt0: update /usr/libexec/ld.so ld.so failed hO `$   ǖ ? $             ?@ ?# @! ?܀a ?@ ?# @  ܀`     O ? " #\#`? ؀@  ?# @! 06@@! 2? ?c @ ̀@ 0%@ @ ̀@? ?c @! @ 0 @ @! @ #d#h0   #d#h0  #d#h  Ŕ  - !O$ ?    (%  "` #\#`?؀@ ?# ! ! ?@ ?# @ ?L@`G?@ ?# @!  5@@! /? ?c @ ̀@ #@ @ ̀@? ?c @! @"  @ @! @# #@?? ?@ ?# @!  3 @@! -? ?c @ ̀@ ! @ @ ̀@? ?c @! @ `  @ @! @` @   #d#h  Ř s ?   (m  j䀢!   O`  #\#`#d#hP? O  (J  GO $  $   8$  ` $ ?2   @. ! ` ?2    h"   O" (O@="`(㿘O (€ 㿘O ( "? @㿘O (€ 㿘O ( ?Service unavailable㿐O (`  `  ?1 !H  @ *`:`J " %s: %s not compiled in instbin㿘@o@ J 2@@J@@41 /  @ @`  @@k "  2  € M H a @%@ 㿘 ?@?`Usage: %s ..., where is one of: %s㿘!M H c( @  @@ @+ ) @@  O4H@c`H@@#h`@ M H @ڒc`@ hostnamekill[testdmesgexprmvsleep-shshkshsedmkdirmtshutdownstringsrmtipmount_kernfsgetoptmount_mfsnewfsinitsortfsckfsck_ffschrootchmodgzcatgunzipgzipcutcpedhaltrebootffsmount_ffsftprouteinstallbootslattachmknodrshpwdumountbasenamefgrepegrepgrepnfsmount_nfsmorelessresettsetsumcksumsysctllsifconfigchgrpchowncatpingcpiotarpaxdisklabellnsttyvibuildsyncmountnetstatdfcd9660mount_cd9660chflagsdd㿘@085X005|0(8L0 505@@050606/6L /6X@@/6tskipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qd㿈O""!O" ` O D"`0 ' %O@j`0 $`0  @T`@@6 = 2, `0@KP L  `0 @A`h c8 `0 ' @u!@  @1P   @(`  €$ $`0O`@"@ "` @ @X O @`O  @` H `  @`O!!!'"@!`!` @"O! "a`"O!"a  @ӒaO H  O  @ʒ`O "aO P `O!   @a@#?!#c@9   2 $ @(   $  ?  a@㿘@@㿘@O"aO"``㿘@O"`H㿘@O "`@L 㿘@"`@㿘O! @ؐO"``O h㿘O! @ɐO"a؁O 㿘@O:㿘@O:p8 Fx77 Gx7 Hx7777 Cx7 Dx7 Ex77777unblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination㿈 ,'D%# !1OD@3'b  @! ! @``"` @`(` `&!O"!D ݐD㿘@@%s%s: illegal numeric value%s: %s㿐@Ք ?O`0 @0a(2JO`0 @ia0`k`m`b". `w  . . .  'J`x 4O``*O @· "!O`0@zʠ!P @.`0 @)a0㿐@iK  #  O`0 @/a(2KO`0 @a0 k m b 0J w*J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,` 4' " @8" "'J`x 4$O`&`*O  @, 4 "@ "!O`0@zE!P @`0 @a0㿘O!O P  " " O  *OO P`a`$  @ $ @`   $`$`OXO Ё㿘O 8 %?O`P  `P  2  OO P P"`"` P@5"@ O" 8O`P"` ?"`O`POa`y" )O-O  O   H@8 ` `    +   ` `  +  `  H*` " $?$ H `" `  H @" $ "` "` %` "   ? $ ?O "`8$ H $@ @ $@  O P P @ " 㿘O P`"O !O ! `# @ؑ"@ O! `@ O`X!O H @נ" Oa` H "`㿘O!`O P ??   @? @?,@O P OH 8 PO!Ȩ  H@?@ "@ @ @@: @@ "@ @D$@$ $ *@` $@.  H@ " $#O`P `P @"@ `P  $ %s: short input record㿘#O`P  / @TА"`P @?@ O @ O@ : @O P@ !O!Ȣ$@ ` @  $ @$ O " *@`"    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx㿘@ @73 @bȐ @b@!$`@@Y`@??&`@@@r stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffer㿘O P   "$  $ @ $   @+̒bO P@ @  O  O @b! #O $ "@&$ a%"& @_! $ a" & @S! $ `$ O!` 'O` @+b'O@O! @!O!O` P` @B? $ P @+sbH$%O HP @* H@/@  $P` H@(@ $Ȑ @+YbXO P P"  Oa $aȀ$ @  $ #O@a  a  @     @ a"@J`!&b O OI! ഑*  +@ (!2OO OG! ⬑*  +@ (!!O O I ഑*  + ( OO G ⬑*  + ( OO "aO@t}  @ˍ` h  @*Ӓb<    a @     @ӫ ?   #   & 㿘#O`%O) O P-O!O ` z       @  @Һ  c$ 6) $2   @*y@Q@D       @V @ @Qv"O  $ @ `   $ `@ $  $` $  $  $  $`  @x%$ @@"  "  $ @  @O!$ O㿘O! ؀@O!@ O!@O4O!O!`O`  `"  "  @IO! " O!Ѐ @ %s: end of device%s: short write on character device%s: short write on tape device㿘O!Ȁ !  O!O +O@͔ 4  @bx#   @)b`>  B <`2+` ` $``  $`   `@ 2  %`@@P" "Ġ$ @Вb!O! "  &  $` ! @ӟ"@ !  & %u+%u records in %u+%u records out %u odd length swab %s blockblocks%u truncated %s %qd bytes transferred in %ld secs (%qd bytes/sec) @r̐O` " ' '`  d#\``@@` @/`   А @ d@I @O    А @˒ d@1 @O!  @= #\#` d@@ @㿘! # $# 㿘@3 %sskip reached end of input㿘O`P 2  @v     @ю ?CA @(b 9 +-P@   &D?! O`@ ?%`@ @ϒc!$ @O{ 6 @(a2㿐O!   @     @5 ?zx @(@b 7 $a@Ѐ' g @(/b   O[$ Waa@P BO  @(b7 ' a@V?2  @(b`D O/$ +aa@  "  @'b`D O$ a0! `D @4O $O㿘@HLPRinvalid flags: %sinvalid flag: %s%s: %s%sfts_read㿈@( )#@"?+? $* \\\\\\\\\[\\\[\\\[\[ ޢ  ۠  ؠ ֦ @Ӑ= @*`& @@   2 `"@? @' @?А ! $#  @  # ` @'MbJ "' @b @ 耢  @c : '`@   @'( !)@А M  4? -* @]^0^0]^0^0^ ^0^0^ ^0]\]\@   @q #@N   @q #@M0̀  <D "D <D "D < `D@ #  @M 0#  @&Βc(@?usage: chflags [-R [-H | -L | -P]] flags file ... 㿘M H@b@( uappnd,uchgnodumpopaquesappndarchschg㿘O*" "@q&c(#0  `@q@qc8#0  `O@q"O"@q c@#0  `O@q"O"@pcH#0 `O@p"O"@pcP#0@ `O@p"O"@pߒcX#0 `O@pՐ"O"@pВc`#0`O`" ,archiveddumpsappendschangesimmutableuappenduchangeuimmutable㿐`2&@2&)@'%'@)Da % &L" n2 L  o2    ?* : `"(*` b|fDfDc fDfDfDfDfDfDfDfDfDfDctfDfDfDcfDe cX@  2``a @ 2 `&`@&@`?a0@}  2ɰ ` &`@ &@cH@e  2 ` }&`{@ v&@cP@M  2``a8@A  2`^Y&`W@R&@c`@*  ``a@@  aH@ 2c `4/&`-@(&@c(@  2``aX@  2`  &` @ &@c8@ܔ  ``a`@Д  ah@ɔ 2 ` &`ߐ@ &@  㿘@`gggxgpghgXgPgHg@g8g0g( g updateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaego:Rcd9660%s: Filesystem not supported by kernel%s on %s @ ') <% #@f#?I? 0B* i0i0i0i0i0i0i0i0i0i0i0i0i0i0i0i0i0i0i0i(i0i0i0i0i0i0i0i0i0i0i0i0i0i0i0i0i0i0ii0ii0i0i0i0i0i0i0i   ,bx@] @D= @&*  @@9@`?''  ' '''#@  # - c@_c@#@o usage: mount_cd9660 [-egrt] [-o options] special node 㿘M H@Jb@W ,-o %s: option not supported㿘@\  @#В @bh 5L n L  o  @w = 2*@n "  2   @2    &*@&bp@Ƞ @Ƀ㿘@9hiklnPt:only one -t option may be specified.-i is incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file system0@%W  #W-W+W)W'O@6Ȁ?L? $E* mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm$$b%$b$%b%"$#X "  @]c@#,@= @Wb&* ` @O" @I @@  2@ @"ܒ` @Y@ț. '@ Q#@@y  @k@ <@< @@2 @@@W@ 2/`(!@,@ 2$@W"  @@@I X`@V < 2 ! x@@I<` @I`P`@  @.  @˼ 4 ` $ O" @0@%@А 㿐@插  6 , @ݐ   L 㿘#X  O"`?@    O"@ empty type list㿘  N  n @nah ON  oO O "b""  @vA , `  @*  "cX @! $@  @v, , , *@`$@ $@㿘W"  #X W" @ ,*%+W)'W b  "`z < ─ @.!! L@+!`@!&'` 4 h pB) x 々B ㈁ 㐅B 㘁 㠅B   㰅B : 0B %5.0f%cBKMGTPE %5.1f%c㿐?? B@m? p0? `J@  x`J@   @m) 㿐   B?Р'  B?   B?%-*.*s %*ld %8ld %8ld %5.0f%% %7ld %7ld %5.0f%% %s 㿐! @l   W"$  F ` !@6  @@  @ܒ@x  ` @6  @А@͐  @Ȓ@d ` @6  @@   @@P @l!''ȅD?@  @l W"   !ز"  ''ȅD?@  @lh @ld!!@l` L Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 㿐W"   `@z' hW"  $' @l'@\ @lW" "@l  @l   ! 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*ld %10ld %11ld %5d%% %s 㿈W" $"""@" @k f"X   " , d* * @@|@@ `  @6  @@   @@<  ` @6  @@ #\ @@(#\ ` @6  @@}  #` @x@ #`#d L#h@k] !㿘@  P@Fd?@^ @  @  ?  df: %qd: %s 㿘@ @Z@ # ` M H! @j  @u  usage: df [-hiklnP] [-t type] [file | file_system ...] 㿘M H@\a@i ffs㿘 O␖ F%\!T@"69?6 4& 0& (&  @z 8 ̢@ & ( d <@p"@ @ϒ d$"& ,@h ?& Ȑ&& a&$ L" L@ Z@ Z<b(@s .K lfs㿘 !O"f "!b@"6H?6 & &   "@ 2 &    $"@ 2 & T d @"@ @Ւ d& $@ &  "@: `&& (& $@ d&& &$ L#`L@ȑ Z@ȍ Z<ch@r .K ext2fs㿘 $+Ob$  ; 8#S@2J? L "6D?6 $*@& *@& (@~4    $?@v ?4 @p`@@$&  & " &b& && &$ L  ؐL@2 Z@. Z< `@rF .K 㿘@)Ô$OpenBSD: if.c,v 1.17 1998/02/27 12:07:32 deraadt Exp $ifnet: symbol not defined %-7.7s %-5.5s %-11.11s %-17.17s %8.8s %5.5s %8.8s %5.5sNameMtuNetworkAddressIpktsIerrsOpktsOerrs %5sColl %sTimeDrop%-7.7s %-5ld %-11.11s none%-15.15s %-17.17s %23s %-17.17s %xHipx:%-8s%-17s atlk:%-12s%-12s ns:%-8s (%d)%x%c%8ld %5ld %8ld %5ld %5ld %3d` @iY"0 "@0@+   " c   #  c( 0#\ 8#` @@i6#d #H @i1cP#  #X @i(c`"  #X @ichL`?"` * "@W\  @c`% P@+H Zd@ !|/`T@} G`@q7 ` *, ,\ #p@h`2 #! #@hڒ #@h֒@+  " `!"ܓ*` <l|  #! #@h #@h! @=#@h! `@<#@hY#@ , # ! x@* $@<xc@hy# x `t/t `x* `* ` * t@G@? #@h]! @>#; ! @Aˠ#@hO !!@Aà ,`7p` 7r p@!@?g! @h7! @># #!@h,` ```2 ` `! # @@@hE ` @! `@h @@ ?` <`L <`?`? ! (    .@g? " #Lc ?`$  @ c* $c@V'!@gϐ 0# W!@gǐ P" !@g PL#` ?"`#* ##@U `` (%s)%s: %s: unknown interface input %-6.6s output input (Total) output%8.8s %5.5s %8.8s %5.5s %5.5s packetserrscolls%5.5s drops %8.8s %5.5s %8.8s %5.5s %5.5s %5.5s %5d %8d %5d %8d %5d %5dH@)  # xa|PH$-"d  P@) @e  8@#a|`" (@{А " (T  `8Ma| H"@c@@Ě  $@b*#@͐"#`@gc$ *` *  *  *  :   " """@f#"@f##/  $"?"?"?"?"?" (  (L`?"` * "@U' "#"cВ"ؔ"c@f͚+b "#"@fĒcc$ *` *  *  *  :   "#  @fb # "@fcL`?"` * "@T L@# $`$`$`$`$` $`$T# $P P@(” F ! 0# #@ #  @fh " #@ @f^"@ &&&&&&@``@$``$``@$`` $`@`$$` @T $`$`( (c$ *` *  *  *  :  #```` (` # #@ #  @f " #`$$ @f "@ @`$`$` $`$ `$`$`$` L$$ `$$$?`" * " @T2 L@#@3c``@ @ː.c@눐`"@$` ($OpenBSD: inet.c,v 1.33 1999/04/11 19:41:40 niklas Exp $TIME_WAITFIN_WAIT_2LAST_ACKCLOSINGFIN_WAIT_1CLOSE_WAITESTABLISHEDSYN_RCVDSYN_SENTLISTENCLOSEDtcp??? Active Internet connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p %-5.5s %6ld %6ld %d %s㾘 $@yْc @'~`?-Y%L;%9%7%% P5/@'l $@e$#0@  @ @' H@'U `Ld@'O  x ?$@e#@ $@e#` ?"`* $@S> ! %(#\%0#`%@#d#h$#ؒ  %% % ` #\% X%`% `( 0@@d" x!  `% L   @d% 8  \@d@F@ < 0D@ 7 `d* 2` % :` L:` % @d` ?"`* $@RԐ Z%s: %ld packet%s sent %ld data packet%s (%qd byte%s) %ld data packet%s (%qd byte%s) retransmitted %qd fast retransmitted packet%s %ld ack-only packet%s (%ld delayed) %ld URG only packet%s %ld window probe packet%s %ld window update packet%s %ld control packet%s %ld packet%s received %ld ack%s (for %qd byte%s) %ld duplicate ack%s %ld ack%s for unsent data %ld packet%s (%qd byte%s) received in-sequence %ld completely duplicate packet%s (%qd byte%s) %ld old duplicate packet%s %ld packet%s with some dup. data (%qd byte%s duped) %ld out-of-order packet%s (%qd byte%s) %ld packet%s (%qd byte%s) of data after window %ld window probe%s %ld packet%s received after close %ld discarded for bad checksum%s %ld discarded for bad header offset field%s %ld discarded because packet too short %ld discarded for missing IPSec protection %ld connection request%s %ld connection accept%s %ld connection%s established (including accepts) %ld connection%s closed (including %ld drop%s) %ld embryonic connection%s dropped %ld segment%s updated rtt (of %ld attempt%s) %ld retransmit timeout%s %ld connection%s dropped by rexmit timeout %ld persist timeout%s %ld keepalive timeout%s %ld keepalive probe%s sent %ld connection%s dropped by keepalive %ld correct ACK header prediction%s %ld correct data packet header prediction%s %ld PCB cache miss%s %ld SYN packet%s received with same src/dst address/port x V%@b#А@% ! `#  !%@%0#ؔ@b͒  !%  # (!%#@%$@% @b(  !&0  (# 8!&( @$4@$0@b8<  # 4 @ !&8@$ H@b@ 2 !& 2!&# H!&@ p@$̐@$Ȑ@bcH`# 4 D!&@$ @bRD`# 4 L!&@$ @bAL`# 4 P!&@$ ؔ@b0P`# 4 T!&@$ @bT`#  Ȑ!&@$q!@bȀ  !&Ѐ  # !&Ƞ!(@$[@$WК@a`# 4 Đ!&@$C!H@aĀ`#  X!&@$2!`@aϒX  !&`  X# |!&X!@$d@$`@a|  !&  |# !&|!@#@#@a܀`#  !&@#!@a  !&  # !&"@#ѐ@#@ag  !&  # !&"H@#@#@aJ  !&  # !&"x@#@#@a-`# 4 ؐ!&@#"@a؀`# 4 !&@#n ؔ@a `# 4 h!&@#]"Ȕ@`h`# 4 l!&@#L"@`l`# 4 x!&@#;#@`ؒx`# 4 t!&@#*#H@`ǒt`# 4 ؐ!&@##x@`؀`# 4 ܐ!&@##@`܀`# 4 !&@"#Ȕ@``#  !&@"#@`쀢  !'䀢  # !' @"А@"̐@`g耤`#  !'@" X@`V  !'  # !' @"@"@`:`# 4 !'@" @`)`# 4 !'@"{ Д@``# 4  !'@"j!@` `# 4 !'@"Y!@_`# 4 !'@"H!8@_`# 4 !'@"7!X@_Ԓ`# 4 !'@"&!@_Ò䀤`# 4 !'@"!@_耤`# 4 !'@"!@_`#  !'@!!@_ %lu datagram%s received %lu with incomplete header %lu with bad data length field %lu with bad checksum %lu with no checksum %lu dropped due to no socket %lu broadcast/multicast datagram%s dropped due to no socket %lu dropped due to missing IPSec protection %lu dropped due to full socket buffers %lu delivered %lu datagram%s output %lu missed PCB cache h ْ@!d ,%#@_Ȁ # 4 ̐!*@!p#@_ ̀ # 4 ؐ!*@!_#@^؀ # 4 А!*@!N#@^Ѐ # 4 Ԑ!+@!= @^ڒԀ # 4 ܐ!+@!, @^ɒ܀ # 4 !+@! 8@^ # 4 !+@!  X@^䀦 # 4 !+@  @^耦 #  Ȑ!+@  Ȕ@^" А" ܐ" " " +# +@^n  # 4 !+@ !@^]쀦 #  !+@ ! @^M %lu total packet%s received %lu bad header checksum%s %lu with size smaller than minimum %lu with data size < data length %lu with header length < data size %lu with data length < header length %lu with bad options %lu with incorrect version number %lu fragment%s received %lu fragment%s dropped (dup or out of space) %lu malformed fragment%s dropped %lu fragment%s dropped after timeout %lu packet%s reassembled ok %lu packet%s for this host %lu packet%s for unknown/unsupported protocol %lu packet%s forwarded %lu packet%s not forwardable %lu redirect%s sent %lu packet%s sent from this host %lu packet%s sent with fabricated ip header %lu output packet%s dropped due to no bufs, etc. %lu output packet%s discarded due to no route %lu output datagram%s fragmented %lu fragment%s created %lu datagram%s that can't be fragmented %lu fragment floods ( @ l%#@]J # 4 !,@ @]9 # 4 !,@ Д@]( # 4 !,@z @] # 4 !,@i!@] # 4 !,@X!@@\ # 4 ؐ!,@G!h@\؀ # 4 !,@6!@\Ӓ # 4 !,@%!@\’ # 4 !,@!Д@\ # 4 !,@!@\耦 # 4 !,@" @\ # 4 Ȑ!,@"H@\~Ȁ # 4 !,@Р"p@\m # 4 !,@"@\\ # 4 !,@"@\K # 4 !,@"@\: # 4 !,@#@\) # 4 !,@{# @\ # 4 !,@j#8@\䀦 # 4 Đ!,@Y#`@[Ā # 4 ܐ!,@H#@[܀ # 4 ̐!,@7#Ȕ@[Ԓ̀ # 4 А!,@&#@[ÒЀ # 4 Ԑ!-@ @[Ԁ # 4 !-@ @@[쀦 #  !-@ p@[address mask replyaddress mask requestinformation request replyinformation requesttime stamp replytime stampparameter problemtime exceededrouter solicitationrouter advertisementecho#7#6routing redirectsource quenchdestination unreachable#2#1echo reply %lu call%s to icmp_error %lu error%s not generated 'cuz old message was icmp Output histogram: %s: %lu %lu message%s with bad code fields %lu message%s < minimum length %lu bad checksum%s %lu message%s with bad length Input histogram: %lu message response%s generated ؐ 8@! %#@Zے8`# 4 @!/@-!@Zʒ@`# 4  !/@! @Z  )/'/ |8  , `"@Z!X  @Zp   `# 4 !/@!@Z`# 4 !/@!@Z~`# 4 !/@Р!Д@Zm`# 4  !/@!@Z\  )/'/ |8 p  , `"@ZL"  p@ZGp   `#  !/@" @Z3 %lu message%s received %lu message%s received with too few bytes %lu message%s received with bad checksum %lu membership quer%s received iesy %lu membership quer%s received with invalid field(s) %lu membership report%s received %lu membership report%s received with invalid field(s) %lu membership report%s received for groups to which we belong %lu membership report%s sent p @ $%#@YЀ # 4 Ԑ!0@!@YԀ # 4 ؐ!0@!8@Y؀ #  ܐ!0@!h@Y܀``# 4`0!0!0!@Yo ``# 䀢`0!0!0!@Y[ 䀦 # 4 !0@"@YJ耦 # 4 !0@"0@Y9쀦 # 4 !0@"p@Y( #  !0@{"@Ylocalhost0.0.0.0%ldP?W q' " @e  /1@m! " 1  @9 <!@UD <'' o7ab  2@G! [  #!W''#\" " @B "))W+1@  b"b$`4 `$ @@%" b @{a@E$ b  $b @W" . 2   2 "  2  %.*s.%.8s*%d[%.8s]%d %-*.*sH ! 1##؀" @b P@{C@` c؀` .`2  `@``.`2  `'?1#@1#$#؀ $@lȒc     '1@{ '1.`2@z!   1# @X %s%u.%u.%u.%u㿈`Ȁ #؀ "`W"@U!  W@`5 . @D`W*"#آ 2/*'@G@l' `@ْ 2`2 @~  "@` . `W@lOb怢 ",@` `W" 21@z1W W" 22@z1W `#\W" 223`3`3` @zu `1W" %u input AH packets %u output AH packets %u packet%s shorter than header shows %u packet%s dropped due to policy %u packet%s for which no TDB was found %u input packet%s that failed to be processed %u packet%s that failed verification received %u packet%s for which no XFORM was set in TDB received %u packet%s were dropped due to full output queue %u packet%s where counter wrapping was detected %u possibly replayed packet%s received %u packet%s with bad authenticator length received %u packet%s attempted to use an invalid tdb %u packet%s got larger than max IP packet size %qu input byte%s %qu output byte%s P @ H%#@VӒԀ# 4 ؐ!2@%#@V’؀# 4 !2@#@V# 4 !2@#ؔ@V􀤠# 4 !3@ @V# 4 !3@ (@V~# 4 !3@Р X@Vm# 4 !3@ @V\# 4 Đ!3@ @VKĀ# 4 Ȑ!3@ @V:Ȁ# 4 ̐!3@!0@V)̀# 4 А!3@{!h@VЀ# 4 ܐ!3@j!@V܀# 4 !3@Y!Д@U#  !3@H"@U䀒  # 4  !3@5"8@Uѐ쀒  #   !3@""P@U %u input ESP packets %u output ESP packets %u packet%s with payload not a multiple of 8 received P @ޔ H%#@UԀ# 4 ؐ!4@"@U؀# 4 !4@٠#@Uv# 4 !2@Ƞ#ؔ@Ue􀤠# 4 !3@ @UT# 4 !3@ (@UC# 4 ̐!3@ X@U2̀# 4 !3@ @U!# 4 !3@s @U# 4 Ȑ!3@b @TȀ# 4 А!3@Q!0@TЀ# 4 Đ!3@@!h@TݒĀ# 4 ܐ!4@/#@T̒܀# 4 !3@!Д@T#  !3@ "@T䀒  # 4  !3@"8@T쀒  #   !3@"P@T %u total input packet%s %u total output packet%s %u packet%s with possibly spoofed local addresses %u packet%s with internal header not IPv4 received h @ 0%#@TJȀ# 4 ̐!5@#ؔ@T9̀# 4 А!5@#@T(Ѐ# 4 !2@z#ؔ@T# 4 !3@i @T􀤠# 4 ؐ!6@X @S؀# 4 ܐ!6@G P@S܀#  !3@6 @SӒ䀒  # 4  !3@#"8@S쀒  #   !3@"P@S$OpenBSD: ipx.c,v 1.5 1998/02/27 12:07:34 deraadt Exp $dropresponduseroutputinputspx??? Active Internetwork Packet Exchange connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-*.*s %-*.*s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p %-5.5s %6ld %6ld %-22.22s %-22.22s %d %s` 'H6@gΒc @s`?@%L ;7977 X7"@ $5Z@_ \ 6@S#0Y#@     2  @ @F  0@@ h 耢 D6@R#Y#@ 6@R#В` ?"`* $@A. ! 70#\#`#d78#h#l#p7H#t#x6#  77 7 `(#\7 `7` 7(0`8 H@R" ! "87  0@R 8\7H@R @<7@R@67@R Z ` 7  L*` 7 @R` ?"`* $@@ǐ @Z%s: %ld %s%s%s -- %s connection dropped due to no new sockets x terminated due to our end dying dropped due to inability to connect incompleted due to mismatched id's dropped due to mismatched id'spacket dropped out of sequence duplicating the highest packet refused as exceeding allocation initiated accepted established droppedembryonic connection closed (includes drops) where we tried to get rtttime we got rttdelayed ack sent dropped in rxmt timeoutretransmit timeoutpersist timeoutkeepalive timeoutkeepalive probe dropped in keepalivetotal packetdata packetdata byte retransmittedack-only packetwindow probe sent with URG onlywindow update-only packetcontrol (SYN|FIN|RST) packetrequest to send a non-existant packet received received in sequencebyte received with ccksum errs received with bad offset received too shortduplicate-only packetduplicate-only byte with some duplicate datadup. byte in part-dup. packetout-of-order packetout-of-order byte with data after window rcvd after window rcvd after 'close'rcvd window probe packetrcvd duplicate ackrcvd ack for unsent datarcvd ack packet acked by rcvd acksrcvd window update packet  @E 8 @PW* !8 #8@U` 8 08@P`PW4 !8 #8@C` 8 X8@Pۚ`PW* !8 #8@1` 8 8@Pɚ`PW, !8 #8@` 8 8@P`PW. !8 #8@ ` 8 8@P`PW0 !8 #8@` 8 8@P`PW2 !8 #8@`8 8@P`PW8 !8 #8@ע`8!8@Po`PW6 !8 #8@Ţ`8!88@P]`P< !8 #8@` 8!`8@PK`P@ !8 #8@` 8!p8@P9`PD !8 #8@` 8!8@P'`PH !8 #8@}` 8!8@P`PL !8 #8@ka8!8@P`PP !8 #8@Y` 8!8@O`PT !8 #8@G`8!8@Oߚ`PX !8 #8@5a8"8@O͚`P\ !8 #8@#b8" 8@O`P` !8 #8@` 8"(8@O`Pd !8 #8@bH8"`8@O`Ph !8 #8@bh8"`8@O`Pl !8 #8@ۢbx8"`8@Os`Pp !8 #8@ɢb8" 8@Oa`Pt !8 #8@` 8"8@OO`Px !8 #8@b8" 8@O=`P| !8 #8@bȖ8" 8@O+`P !8 #8@bؖ8" 8@O`P !8 #8@obȖ8"8@O`P !8 #8@]bؖ8"8@N`P !8 #8@Kb8" 8@N`P !8 #8@9c8" 8@Nњ`P !8 #8@'`8#8@N`P !8 #8@c08" 8@N`P !8 #8@cP8" 8@N`P !8 #8@cp8#x8@N`P !8 #8@ߢb8#8@Nw`P !8 #8@͢`8#8@Ne`P !8 #8@c8#8@NS`P !8 #8@`8#8@NA`P !8 #8@`8#8@N/`P !8 #8@`9 8@N`P !8 #9@s` 8#8@N `P !8 #9@a`88#8@M`PĀ !8 #8@O`9 P8@M`PȀ !8 #9@=`p9 8@M՚`P̀ !8 #9@+`8#8@MÚ`PЀ !8 #9@`8#8@M`PԀ !8 #8@`9 8@M`P؀ !8 #8@c9 8@M`P܀ !8 #8@`9 8@M{`P !8 #9@Ѣa8"`8@Mi`P䀦 !8 #9@a08"`8@MW`P耦 !8 #9@aH9!X8@ME`P쀦 !8 #9@ap8"`8@M3`P !8 #8@c9!8@M!`P !8 #9@wa8"`8@M`P %d %s%s%s smaller than a header smaller than advertised with bad checksums㿀 8@1 8 @L耦 !=!#8@A`=@Lۘ!䀦 !=!#8@1`=@L˘! !=!#8@!`=@L! too large to be forwarded forwarded too many times while gatewayed Refused due to lack of space at DestinationPacket at SocketNo ListenerBad Checksum at DestinationUnspecified ErrorIPX error statistics: call to ipx_errorerror ignored due to insufficient addressingerror request in response to error packetserror packet received incomplete received of unknown typeOutput Error Histogram: Input Error Histogram: 㾰  @t =@L/#!=!#=@c>@L !=!#>@u`>@L !=!#>@e`@>@K Pp!=!#>@U`p>@K l!=!#>@E`p>@Kߘ  )>` @KӐ  `@,    )>`p @K ئ `@  in transitat destinationUnknown IPX error code 0%ox   @  @ `` ```>#># ؐ >@ne0`* *     !=@ Ҡ!@Km㿘!X*  *  *  *  *  *  *  *  *  *  *  @!Q* $OpenBSD: iso.c,v 1.7 1998/02/27 12:07:36 deraadt Exp $%s: %d esh sent, %d esh received %d ish sent, %d ish received %d rd sent, %d rd received %d pdus not sent due to insufficient memory %d pdus received with bad checksum %d pdus received with bad version number %d pdus received with bad type field %d short pdus received 㿀 -@ -  (? @J?@J ?@Jې!?@J֐!(?@JҐ!H?@Jΐ!x?@Jʐ!?@JƐ!?@J!%s: %d total packets sent %d total fragments sent %d total packets received %d with fixed part of header too small %d with header length not reasonable %d incorrect checksum%s %d with unreasonable address lengths %d with forgotten segmentation information %d with an incorrect protocol identifier %d with an incorrect version %d dropped because the ttl has expired %d clnp cache misses %d clnp congestion experience bits set %d clnp congestion experience bits received 㾀 D@ r! ??" @J)?@J%"?@J!#?@J#8?@J#h!?#@ s@J?@J #?@J#@@J @@J 8@@I X@4@I @8@I @<@I Ё%s: %u incomplete header%s %u bad data length field%s %u bad checksum%s 㿀 "@   !@" @ +@Iǔ!@"@@ !@I!@"`@ @I%s control block: symbol not in namelist tpprev %p next %p isop_prev %p isop_next %p??? 耦 @#@I0F@@^#c@  @T0=@#H@I06H@  03Yc@ c耢')#L @ ޒ# @  @\ c` ?"`c* $c@7 耢Active ISO net connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-*.*s %-*.*s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p %-5.5s %6ld %6ld () *.* x!l KA@H Y#@ A@H L`?"` * "@70 ! A!8#\ #`#dA!@;h#pA!P#tA!`#xA  A A!(Aa0A!`#\A!hAa(A0A8A!@AaP@H"!l!  #$A!@H c`8A`\!@@Hc@`"0a  aA@KA@H! `Y#` lA@H!`  !`l@ a@  !@ݒ `"0`΀  `A@A@Hb!0Y#` A@HX!0  "`@Ք b@  "@ undefined tpcb state: %p %d %-12.12s㿈@ r * @ g@ h* ]"0# %L "O@ V!  2YB@H  Y#@    ";쀢 "8쀢 5c @ :  `"   @2  Yc@ *    `B *`B @G` ?"`* $@6  * @*%8lx tpip("D@  Y#@  X$@G'$ ! B"@GA!8B\@GbؐX!@#@^"H\TP not configured 㿘 B@G#0 ?@G !Z!@ !Ȑ@u %*sReceiving: %*s%ld variable parameter%s ignored %*s%ld invalid parameter code%s %*s%ld invalid parameter value%s %*s%ld invalid dutype%s %*s%ld negotiation failure%s %*s%ld invalid destination reference%s %*s%ld invalid suffix parameter%s %*s%ld invalid length %*s%ld invalid checksum%s %*s%ld DT%s out of order %*s%ld DT%s not in window %*s%ld duplicate DT%s %*s%ld XPD%s not in window %*s%ld XPD%s w/o credit to stash %*s%ld time%s local credit reneged %*s%ld concatenated TPDU%s %*sSending: %*s%ld XPD mark%s discarded %*sXPD stopped data flow %ld time%s %*s%ld time%s foreign window closed %*sMiscellaneous: %*s%ld small mbuf%s %*s%ld cluster%s %*s%ld source quench %*s%ld dec bit%s %*sM:L ( M mbuf chains of length L) %*s%ld: over 16 %*s%ld: %d %ld: %d %*s%ld EOT rcvd %*s%ld EOT sent %*s%ld EOT indication%s %*sConnections: %*s%ld connection%s used extended format %*s%ld connection%s allowed transport expedited data %*s%ld connection%s turned off checksumming %*s%ld connection%s dropped due to retrans limit %*s%ld tp 4 connection%s %*s%ld tp 0 connection%s LOCAL, PDN LOCAL,~PDN~LOCAL,~PDN~LOCAL, PDN %*sRound trip times, listed in ticks: %*s%11.11s %12.12s | %12.12s | %s CategorySmoothed avgDeviationDeviation/Avg %*s%11.11s: %-11d | %-11d | %-11d | %-11d %*sTpdus RECVD [%ld valid, %3.6f %% of total (%ld); %ld dropped] %*sDT %6ld AK %6ld DR %4ld CR %4ld %*sXPD %6ld XAK %6ld DC %4ld CC %4ld ER %4ld %*sTpdus SENT [%ld total, %ld dropped] %*sRetransmissions: %*sCR %6ld CC %6ld DR %6ld %*sDT %6ld (%5.2f%%) %*sXPD %6ld (%5.2f%%) %*sE Timers: [%6ld ticks] %*s%6ld timer%s set %6ld timer%s expired %6ld timer%s cancelled %*sC Timers: [%6ld ticks] %*s%6ld inactive timer%s cancelled %*sPathological debugging activity: %*s%6ld CC%s sent to zero dref %*s%6ld random DT%s dropped %*s%6ld illegally large XPD TPDU%s %*s%6ld faked reneging of cdt %*sACK reasons: %*s%6ld not acked immediately %*s%6ld strategy==each %*s%6ld strategy==fullwindow %*s%6ld duplicate DT %*s%6ld EOTSDU %*s%6ld reordered DT %*s%6ld user rcvd %*s%6ld fcc reqd B㿀)L#C`+C`@{c!C @S@{W!C  H@G@{K!C  p@;@{?!C  @/@{3!C  @#@{'!C  @@{!C $!@ @{Ca0 @{!C !H@@z!C H!h@@z!C L!@@z!C X!@Ԑ@zؘ!C P!@Ȑ@z̘!C T!@@z!C `"@@z!C!"0@@zCbP@z!C D"`@@z!C @"@@z !C \"@y@z}CbД@zw!C! "@f@zj)C!C!$#@Y@z]Cc!@zV!C!#0@F@zJCcH@zDCcp!(@z=  #`!(-a(#\@z/#`` )L#Cc+C`!l@z Cc!t@z!C!p#@ @z Cc@z!D , @@y!D 0 8@@y !D 4 p@ސ@y!D  @ѐ@y՘)D!D!| @Đ@yȘ!D!x @@yDaX@yD!#\D!#`DaD!D@ya!p!!-@ #\!`#`!@y#d L#D"C d  h'5B5E'"5Bą"?    d#` <#d@yb#\#Lc'D`  !C Ġ #\ ̖@yQ#` %D  Ȓ#\ Д#` @yB#dDb l 8@y:   #\ @y/#`   #\ #` @y"#dDc@yD tc x |@y#\D#@  '  5B5E'"5Bą"?  #\@xL#D#XC   '  5B5E'"5Bą"?  #\@x%LDcp#C` @x@ ܨ@ ئ@ !D# ܔ ؖ#\#` #d#h@xDcؔ @x@ @ @   #\#` #d#h@x!D #@q@xuE` @xo!E! H@_@xc!E! p@S@xW!E! @G@xKE`!@xDE`ؔ@x>E`!@x7Ea!@x0Ea0!@x)EaP!@x"Eah!@xEa!@xEa!@x Ea!@x{}[]<>㿘 H @Hp   A    "    `@6  `     H x ` @&@    H   ` @ @@ L`?"`` * "@/ %s㿘W#耦 %@@  .!@`*`  ` :`* * *@ *@W*cI c*@A *$OpenBSD: main.c,v 1.17 1999/03/01 01:28:13 d Exp $_ddpcb_ddpstat_ip4stat_espstat_ahstat_ipx_errstat_spx_istat_ipxstat_ipxcbtable_viftable_mfchash_mfchashtbl_mrtstat_ip_mrtproto_igmpstat_file_nfile_cltpstat_cltb_rt_tables_nimp_esis_stat_tp_stat_tp_refinfo_tp_inpcb_clnp_stat_ns_errstat_spp_istat_idpstat_nspcb_unixsw_rtstat_icmpstat_imp_softc_ifnet_udpstat_udbtable_tcpstat_tcbtable_ipstat_mbstatipencapespahigmpicmpipudptcpipx_errspxipxns_errsppidpesisclnpcltptpddpAadf:gI:iM:mN:np:rstuvw:inetlocalunixnsisoencapatalk%s: %s: unknown address family %s: %s: unknown or uninstrumented protocol %s: kvm_open: %s %s: %s: no namelist %s: no namelist %s: no stats routine 㷘@e "aJ!آ %  -J@ph?Ӑ? 8̑* ,,*,,,,,,,,,,,,0,D,,,,,,,,,,,,,,,,,,*,,*,*,,,,,,,8,L,,X,,,,,,,"!Y"#@"",J@TQ` , $J@TH` l,J@TB` f,J@T<` , $J@T3` , $J@T*` , $J@T!` , x$J@T`  o$J 8`,M@uސ H@ c"#%,^"!|\,Y""(W,T"#@,  J 8`,M@u H@ʐ C" \@" c ;"c8"#6$3" X@>,"``-%@-*= @* @@M b  "@@>  "``@` "c@  `` ` @j@@f@  @`%  $ M HJa8@u[@h @M@Ż@I@ŧ b @a1  `   M HJa(8@u;0M`8 HJ@u3a@@@ "( @`@8  \    * *  0J@>!X@# @ @? # " `?`P@   # @`t0@Sa@ # # aL@MaX0adap@a|@ !  +@l @ʾ #@ˉ `  @R@ "       @@m0@Z!      @Y   !      @C   !  !   @-   !  # 2@"!  !d   @    @^ 㿘#  "  "  *@ *`@ `` !  %s: %s 㿘!# @`ߖ#M `H# `8!L@[-"Ж@t?s LHIes LpI㿘!`!@ "` @R     `@ 2@ 㿘  !@v@@\ @| ` @Q   20@Y usage: %s [-Aan] [-f address_family] [-M core] [-N system] %s [-gimnrs] [-f address_family] [-M core] [-N system] %s [-n] [-I interface] [-M core] [-N system] [-w wait] %s [-M core] [-N system] [-p protocol] 㿘!M H#M`8@sm`M`8@sh`M`8@sca8M`8@s^ax@k $OpenBSD: mbuf.c,v 1.7 1999/02/27 21:22:19 deraadt Exp $interface addressesaccess rightssocket optionssocket names and addressesfragment reassembly queue headersaddress resolution tablesIMP host table entriesrouting table entriesprotocol control blockssocket structurespacket headersancillary dataoob datadata%s: unexpected change to mbstat; check source %s: mbstat: symbol not in namelist %u mbuf%s in use: %u mbuf%s allocated to %s %u mbuf%s allocated to %lu/%lu mapped pages in use %u Kbytes allocated to network (%d%% in use) %lu requests for memory denied %lu requests for memory delayed %lu calls to protocol drain routines 㿘"! M`8 HM@rc0  M`8 HM@rc0cY" !   *       !M`#@;!  !## )N *`  "`*`%*  A @@;ݒ`@   "b 6!)N #. @ ` "   @; `!# N  H@;"  ,* @  * N h :` " *` *  * @  d@;!#N @; N @; N @; %lu%c㿘  # k2  m21X hN @^M؁ip_mrtproto: symbol not in namelist no multicast routing compiled into this system multicast routing protocol %u, unknown mfchashtbl: symbol not in namelist mfchash: symbol not in namelist viftable: symbol not in namelist Virtual Interface Table %s%sVif Thresh Limit Local-Address Remote-Address Pkt_in Pkt_out %3u %3u %5u %-15.15s %-15.15s %6lu %7lu Virtual Interface Table is empty Multicast Forwarding Cache %s%sHash Origin Mcastgroup Traffic In-Vif Out-Vifs/Forw-ttl %3u %-15.15s %-15.15s %7s %3u %u/%u Multicast Forwarding Cache is empty Total no. of entries in cache: %d 㶸 $O@: @0 $``O@: h0O@: 0Ȁ`O@: 0O@: 0O@:!0x(  #ؖ ##O!Ȱ? '. 2 O!8OaXO@:h ??@n?Oa@:\ O@a?!?@:O D* 2  ҦD2O@:A!  {   UQ(3O  ,`j A2 (O"Ob8O@:h (W P@0Ob@:@4\ Ob8@: O.2  @9b* 2 .O@9"(  '`@2OO@9ې"O"@9֒O@9Ӑ""#؁mrtstat: symbol not in namelist multicast routing: %ld datagram%s with no route for origin %ld upcall%s made to mrouted %ld datagram%s with malformed tunnel options %ld datagram%s with no room for tunnel options %ld datagram%s arrived on wrong interface %ld datagram%s dropped due to upcall Q overflow %ld datagram%s dropped due to upcall socket overflow %ld datagram%s cleaned up by the cache %ld datagram%s dropped selectively by ratelimiter %ld datagram%s dropped - bucket Q overflow %ld datagram%s dropped - larger than bkt size X O@9/ @0n ``O@9% h0vO@9  0q`P@9"0jW 4P@9"!P̠"l@9 !PȠ#c@9!PР#0Z@8!PԠ#`Q@8!Pؠ#H@8!Pܠ#?@8ܒ!Q 6@8Ӓ!Q 8-@8ʒ!Q h$@8!Q @8!Q @8$OpenBSD: ns.c,v 1.5 1998/02/27 12:07:38 deraadt Exp $dropresponduseroutputinputspp??? Active NS connections (including servers)%-8.8s PCB%-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s %-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s ProtoRecv-QSend-QLocal AddressForeign Address(state)%8lx %-5.5s %6ld %6ld %-22.22s %-22.22s %d %s8 ĺQ@LԒc Tx`?#Yc@ Tc3Y'L+9#`7 T``Q@8#0c@  #` 2` ` #` I `(  ? hy"8 9Q@7#c@ Q@7#` ?"`* $@&* a Q#Q@7֒ca Q#R R p#\ R`8R@RHRR P@7``""8a "RR x@7R8 \@7@>R@7@8R@7 ` R  L*` R @7` ?"`* $@%ϐ ^%s: %ld %s%s%s -- %s connection dropped due to no new sockets x terminated due to our end dying dropped due to inability to connect incompleted due to mismatched id's dropped due to mismatched id'spacket dropped out of sequence duplicating the highest packet refused as exceeding allocation initiated accepted established droppedembryonic connection closed (includes drops) where we tried to get rtttime we got rttdelayed ack sent dropped in rxmt timeoutretransmit timeoutpersist timeoutkeepalive timeoutkeepalive probe dropped in keepalivetotal packetdata packetdata byte retransmittedack-only packetwindow probe sent with URG onlywindow update-only packetcontrol (SYN|FIN|RST) packetrequest to send a non-existant packet received received in sequencebyte received with ccksum errs received with bad offset received too shortduplicate-only packetduplicate-only byte with some duplicate datadup. byte in part-dup. packetout-of-order packetout-of-order byte with data after window rcvd after window rcvd after 'close'rcvd window probe packetrcvd duplicate ackrcvd ack for unsent datarcvd ack packet acked by rcvd acksrcvd window update packet  K R#@6W* !R##S[`S S@5`8W4 !R##SI`S @S@5`8W* !R##S7`S hS@5Ϛ`8W, !R##S%`S hS@5`8W. !R##S`S S@5`8W0 !R##S`S S@5`8W2 !R##S`ؖS S@5`8W8 !R##Sݢ`ؖS!S@5u`8W6 !R##Sˢ`ؖS! S@5c`8< !R##S`S!HS@5Q`8@ !R##S`S!XS@5?`8D !R##S`S!hS@5-`8H !R##S`S!xS@5`8L !R##SqaS!xS@5 `8P !R##S_`S!S@4`8T !R##SM`ؖS!S@4`8X !R##S;aS!S@4Ӛ`8\ !R##S)aS"S@4`8` !R##S`S"S@4`8d !R##Sb0S"HS@4`8h !R##SbPS"HS@4`8l !R##Sb`S"HS@4y`8p !R##SϢbxS"S@4g`8t !R##S`S"S@4U`8x !R##SbS"S@4C`8| !R##SbS"S@41`8 !R##SbS"S@4`8 !R##SubS"S@4 `8 !R##ScbS"S@3`8 !R##SQbS"S@3`8 !R##S?bS"S@3ך`8 !R##S-`ؖS#S@3Ś`8 !R##ScS"S@3`8 !R##S c8S"S@3`8 !R##ScXS#`S@3`8 !R##SbS#S@3}`8 !R##SӢ`ؖS#S@3k`8 !R##ScS#S@3Y`8 !R##S`ؖS#S@3G`8 !R##S`ؖS#S@35`8 !R##S`ؖS#S@3#`8 !R##Ty`S#S@3`8 !R##Tg` S#S@2`8Ā !R##SU`ؖT 8S@2`8Ȁ !R##TC`XT hS@2ۚ`8̀ !R##T1`S#S@2ɚ`8Ѐ !R##T`S#S@2`8Ԁ !R##S `ؖT S@2`8؀ !R##ScT S@2`8܀ !R##S`ؖT S@2`8 !R##Tע`S"HS@2o`8䀦 !R##TŢaS"HS@2]`8耦 !R##Ta0T!@S@2K`8쀦 !R##TaXS"HS@29`8 !R##ScT!hS@2'`8 !R##T}aS"HS@2`8 %d %s%s%s smaller than a header smaller than advertised with bad checksums㿀 87 R#@1耦 !X!#SG`ؖX@1!䀦 !X!#S7`ؖX@1ј! !X!#S'`ؖX@1!؁ too large to be forwarded forwarded too many times while gatewayed Refused due to lack of space at DestinationPacket at SocketNo ListenerBad Checksum at DestinationUnspecified ErrorNS error statistics: call to ns_errorerror ignored due to insufficient addressingerror request in response to error packetserror packet received incomplete received of unknown typeOutput Error Histogram: Input Error Histogram: 㾰  z X@15#!X!#XcX@1%#!X!#X{cY@1 !X!#Yk`(Y@1 8p!X!#Y[`XY@0 hl!X!#YK`XY@0  )Y` @0ِ  `@,    )Y`p @0Ð  `@  in transitat destinationUnknown XNS error code 0%ox"<  @  @ `` ```Y"Y#ؐ Y@Skb<* *     !Xؠ!@0s㿘"2  2  2  2  2  @2 $OpenBSD: route.c,v 1.27 1999/03/15 15:59:08 deraadt Exp $Routing tables rt_tables: symbol not in namelist Netmasks: Z@09 !  "  @WZ@0( 07!#(d  %!#.  "& W t ! " ! 2 Z@0 0 2 @-  $b@@@  ב. InternetXNSIPXISOX.25EncapAppleTalk %s: Protocol Family %d: 㿘?`9Z"*` k$kxkxkxk0kHkxkxkTkxkxkxkxkxklkxkxkxkxkxkxk<kxkxkxkxkxkxk`Z" Z"0Z"8Z "@Z "HZ"PZ"X `Z"hZ"p@/%-*.*s Address%-*.*s %-*.*s %-6.6s %6.6s %6.6s %6.6s %s DestinationGatewayFlagsRefsUseMtuInterface㿀! Z#  Z@/][ #\[ #`[ #d[ #h[ #l[ (#pZ#  Z @/B %-*s %-31s %-5s %-31s %-5s %-5s %-26s Source address/netmaskPortDestination address/netmaskProtoSA(Address/SPI/Proto)㿐! [ ؒ Z@/[!P#\[ [a[ [[( @/aH㿘!Y В:  Ѐ4%-16p (root node)%s => 㿘`@" T  N#a ["@.Ԓ a :  [" ["0["8@. ," !# @Ta @P   @Z ,L`?"` * "@  T 0! "  `@["@.@$`@`` mask (%d)%6.6s %16p : %16p %d refs, mk = %16p {(%d),%s ->㿘 @T @  [@.R#R  @?``_0! ` \@Q#\ @.9`?) 0 `\ 8%Ln  \ @Q ( U 0 :`\ P@.   @ɖ?` }?"``* $@N } `\@- X`̐L`?"` * "@6 route-sysctl-estimateout of space sysctl of routing tablex ' ''' ''  ܖ @n \@"8@7 @ܠ 2\@-"P@-   @W 6\@m"`@  @  %-6.6s 㿘 L `%Xp" $p    $  @4  L   . L  L @@(\ cx@ L`?"` * "@ defaultlink#%d%s%x: %02x%02x%s  ?`sx] ԓ*` u,vvvupvvvvvvvvvvlvuvvvvu   @.@`}]z h@cv@r    2 x  ]@Opc !] x  @ Ux+])]?$ ` @@Oϖ:? `@`?x@;@Q 6  z$\ @O :$x)]']?$@  @O:?$@ @O: 䀤x] @,0#؀ [ ؒ@,0Z# @,p"R" R@"` `*`R@ *@,rЁ%6d %8ld %6ld %6s - %.16s%s =>x ^@q   2 @0V "  O@p  4 C 0   \ 4cxV 8^ t@,4  T`^ (^ 0^`8@,( @`!X!@ X`t^  @$!  ^ @X ^ P] x@,  L`?"` * "@I %u.%u.%u.%u㿐c 'D"cX"@)!  X@4+ . @ X*"#ذ  D @  @4 .  X@@\b ".  !X!@4 , X!!^D #\222 @N `1X!%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d㿐#آ  ` `@ 2` @ !"@` !X#@3ؔ 1, ` `X#!^H6 @NN %1X `X#!^P6 6    #\X#!^ `#\#`X#!^p6 6  6  `@N*1X#rtstat: symbol not in namelist routing: %u bad routing redirect%s %u dynamically created route%s %u new gateway%s due to redirects %u destination%s found unreachable %u use%s of a wildcard route 㿀 _@+ 03@ _@* !_!U@*!_! L@*!_!HC@*!_!p:@*ג!_!1@*Β*.%xH*.*any*%02x%02x%02x%02x%02x%02xH.%xH%xH.%s%sp 7 7 7 7 * 7 77&7* #+   ,2  !Y  2_@Mr@ 1YY  2_@Mh1YR # @C  _+"#@9  !Y_!" X   _ #\  #`  `@M>#dL X 0  :  K 0  ,2   Y N_@M&1YY* N1Y  2_Y@M`N@]0H.㿈7 7 7 7 7 7 7 7Y`r7`r`7^7`! @>~  " %02x:%02x:%02x:%02x:%02x:%02xp / / / / / / / / / / / `/////?#7 @ $  !  2 !Y v 2_@L@ 1YY v 2_@L1YF v#@z  _!"#@p  Y_"  O`   (8#\+ ; L +`#`L ;`@Lq#d   Y _@Li1YY* 1Y v 2_Y@LZ`@㿈7 7 7 7 7 7 7Y `7` `/ `/ `/X/`! @=  " /%-31s %-5u %-31s %-5u %-5u %s/%08x/%-lu (9 @m 4 @m۔ / 0@m֔ @'ܒ @'@1~ @h#a`@1u  ̐@' @1k a @)@' @s'@1[ @E@1T  А@c' @1J a @(!a @R'@(ؐJ(8f4 a& * J TP_CONFIRMING(0x8)TP_LISTENING(0x7)TP_REFWAIT(0x6)TP_CLOSING(0x5)TP_OPEN(0x4)TP_AKWAIT(0x3)TP_CRSENT(0x2)TP_CLOSED(0x1)ST_ERROR(0x0)T_ACPT_req(0x18)T_NETRESET(0x17)T_DETACH(0x16)T_USR_Xrcvd(0x15)T_USR_rcvd(0x14)T_XPD_req(0x13)T_DATA_req(0x12)T_LISTEN_req(0x11)T_DISC_req(0x10)T_CONN_req(0xf)XAK_TPDU(0xe)XPD_TPDU(0xd)DT_TPDU(0xc)AK_TPDU(0xb)CC_TPDU(0xa)DC_TPDU(0x9)DR_TPDU(0x8)CR_TPDU(0x7)ER_TPDU(0x6)TM_data_retrans(0x5)TM_reference(0x4)TM_notused(0x3)TM_sendack(0x2)TM_retrans(0x1)TM_inact(0x0)$OpenBSD: unix.c,v 1.5 1997/06/29 21:46:06 millert Exp $Out of memory (file table). #   `!Y@?!Д Yb@'!02"aԢ!Y*` * @@'"ئ h ,?䀢 !T?• !# ! * !؀ ! !@L!آ`0@  0seqpacketrdmrawdgramstream#0Active UNIX domain sockets %-*.*s %-6.6s %-6.6s %-6.6s %*.*s %*.*s %*.*s %*.*s Addr AddressTypeRecv-QSend-QInodeConnRefsNextref%*p %-6.6s %6ld %6ld %*p %*p %*p %*p %.*s㾰 Ȓ” , f`  H鸔 2   %Ā %b@'i"b#h#\ #`#db#p;h#pb#x#t#x#|b#;#b##b# bPb#Xb@'Ic`$V 8 \  #\`#`#d` b#h#l`(#p##t`@'/#x b# @''L`?"`* "@e ????*%hu㿘`` ?#@2 1Y1c !1c !1Y!c 2@I۔bcast%d㿘`   2 1Y1c "1c !1Y"c 2 @Iddp%s㿘   #1c#!1c ! Y"D 2 c c@ab Y"D 2 c"D 2c@I1Y"D%d-%d㿘   Y"v 2c@I{H1Y"v 2c@It1Y"v%s.%s.%s㿘Y*"``L`c#*` ,8\Y2*"!Y"#cRb%!Y"#cib!Y"#c@c\ 2@I)`!Y"#cb 2@I`"1Y!Y"@~@{ 2$@!cW#@I1Y"-%s㿈` !c`" 7Yږ d@Hc8 c`?#@  d$@!d!`2n7 @HӔ* c"!Y"ڠ d$#cVc@H1Y"ځActive ATALK connections (including servers)%-8.8s PCB%-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s %-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s ProtoRecv-QSend-QLocal AddressForeign Address(state)%8lx %-5.5s %6ld %6ld %-18.18s %-22.22s@ ǔ  #YcH@ H +#L%-籔 H <4穔 w` 9d@%_"Y#@ d@%X"c` ?"`c* $c@  d"d@%Bb d"d#d#h#\ dc0d8d@dd#H@%+cX%` d#p@%#d 8#x \@% "dd##Y#X @% "dd##H| @%c` ?"`c* $c@> %s: %ld packet%s with short headers %ld packet%s with long headers %ld packet%s with no checksum %ld packet%s were too short %ld packet%s with bad checksum %ld packet%s with not enough data %ld packet%s forwarded %ld packet%s rcvd for unreachable dest %ld packet%s dropped due to no socket space p Δ $ e"(@$Ѐ # 4 Ԑ!eؠ"0@$uԀ # 4 ؐ!eǠ"X@$d؀ # 4 !e涠"@$S # 4 ܐ!e楠"@$B܀ # 4 !e攠"@$1䀦 # 4 !e惠"@$ 耦 # 4 !er#@$쀦 # 4 !ea#0@# #  !eQ#`@#㿘@unionsoftdepsynchronousroot file systemread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasynchronousffsAadfo:rwt:uvonly one -t option may be specified.rorwrqnoautogetmntinfounknown special file or file system %s.can't find fstab entry for %s.%s: unknown special file or file system.%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountd㿈@Hɠ f#Xg! 5 # /f@T-`?k? 8d* $HP  &c,J@ @~   f@<cp@0c,c,@% ?@= @ &*  ]@ 006@ Kf @7Gc f @7Ac f @7;c @  f @Βc @ ۀ   `?@,#\ 2Ϣ 0@    f@ցc. #!/bin/sh # $OpenBSD: install.sub,v 1.122 1999/04/10 04:39:50 deraadt Exp $ # $NetBSD: install.sub,v 1.5.2.8 1996/09/02 23:25:02 pk Exp $ # # Copyright (c) 1997,1998 Todd Miller, Theo de Raadt # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Todd Miller and # Theo de Raadt # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation/upgrade script - common subroutines. ROOTDISK="" # filled in below VERSION=25 VERSION_MAJOR=$(( $VERSION / 10 )) VERSION_MINOR=$(( $VERSION % 10 )) export VERSION VERSION_MAJOR VERSION_MINOR ALLSETS="base etc misc comp man game xbase xshare xfont xserv" # install UPGRSETS="base misc comp man game xbase xshare xfont xserv" # upgrade SNAPSETS="bin dev etc games man misc sbin \ usr.bin usr.binutils usr.games usr.include \ usr.lib usr.libexec usr.misc usr.sbin usr.share var" THESETS= # one of the above # Path searched for sets by install_sets on the local filesystems local_sets_dir="" # decide upon an editor if [ X$EDITOR = X ]; then if [ -x /usr/bin/vi ]; then EDITOR=vi else EDITOR=ed fi export EDITOR fi # Please don't use the 1 of n form below, good idea, wrong implementation! # get a reponse with default[s] getresp() { set -o noglob valid="false" while [ "X$valid" = "Xfalse" ]; do read resp if [ "X$resp" = "X" ]; then resp=$1 fi if [ $# -gt 1 ]; then for i in $@; do if [ "X$resp" = "X$i" ]; then valid="true" fi done else valid="true" fi if [ "X$valid" = "Xfalse" ]; then echo "Try again: Enter one of [$@]" fi done set +o noglob } isin() { # test the first argument against the remaining ones, return succes on a match local _a=$1 shift while [ $# != 0 ]; do if [ "$_a" = "$1" ]; then return 0; fi shift done return 1 } addel() { # add first argument to list formed by the remaining arguments # adds to the tail if the element does not already exist local _a=$1 _seen="" shift while [ $# != 0 ]; do echo "$1" if [ "$_a" = "$1" ]; then _seen="yes" fi shift done if [ "X$_seen" = "X" ]; then echo "$_a" fi } rmel() { # remove first argument from list formed by the remaining arguments local _a=$1 shift while [ $# != 0 ]; do if [ "$_a" != "$1" ]; then echo "$1" fi shift done } cutword () { # read lines on stdin, return Nth element of each line, like cut(1) local _a _n _oifs="$IFS" # optional field separator case "$1" in -t?*) IFS=${1#-t}; shift;; esac _n=$1 while read _a; do set -- $_a test "$1" = "" && break eval echo \$$_n done IFS="$_oifs" } cutlast () { # read a line of data, return last element. Equiv. of awk '{print $NF}'. local _a _oifs="$IFS" # optional field separator case "$1" in -t?*) IFS=${1#-t}; shift;; esac read _a; set -- $_a IFS="$_oifs" if [ "$1" = "" ]; then return; fi while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } firstchar () { # return first character of argument local _a=$1 while [ ${#_a} != 1 ]; do _a=${_a%?} done echo $_a } basename () { local _oifs if [ "$1" = "" ]; then return; fi _oifs="$IFS" IFS="/" set -- $1 IFS="$_oifs" while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } isnumeric() { local _a=$1 while [ ${#_a} != 0 ]; do case $_a in [0-9]*) ;; *) echo 0; return;; esac _a=${_a#?} done echo 1; return } get_ifdevs() { # return available network devices /sbin/ifconfig -a | egrep -v '^([[:space:]]|(lo|enc|ppp|sl|tun|bridge)[[:digit:]])' | cutword -t: 1 } dir_has_sets() { # return true when the directory $1 contains a set for $2...$n local _dir=$1 _file shift for _file in $* do if [ -f $_dir/${_file}${VERSION}.tar.gz ]; then return 0 fi # Try for stupid msdos convention if [ -f $_dir/${_file}${VERSION}.tgz ]; then return 0 fi # Special check for kernel if [ $_file = "kernel" -a -f $_dir/bsd ]; then return 0 fi done return 1 } list_has_sets() { # return true when the list $1 contains a set, given dir $2 for $3...$n local _list=$1 _file shift for _file in $* do if isin ${_file}${VERSION}.tar.gz $_list; then return 0 fi # Try for stupid msdos convention if isin ${_file}${VERSION}.tgz $_list; then return 0 fi # Special check for kernel if test $_file = "kernel" && isin bsd $_list; then return 0 fi done return 1 } ftp_list_files() { # log in via ftp to host $1 as user $2 with password $3 # and return a list of all files in the directory $4 on stdout local _host=$1 _user=$2 _pass=$3 _dir=$4 shift; shift; shift; shift ftp ${_ftp_active} -V -n $_host << __ptf user $_user $_pass cd $_dir ls quit __ptf } get_localdir() { # $1 is relative mountpoint local _mp=$1 _dir="" while : ; do echo -n "Enter the pathname where the sets are stored [$_dir] " getresp "$_dir" _dir=$resp # Allow break-out with empty response if [ -z "$_dir" ]; then echo -n "Are you sure you don't want to set the pathname? [n] " getresp "n" case "$resp" in y*|Y*) break ;; *) continue ;; esac fi if dir_has_sets "$_mp/$_dir" $THESETS then local_sets_dir="$_mp/$_dir" break else cat << __EOT The directory \"$local_sets_dir\" does not exist, or does not hold any of the upgrade sets. __EOT echo -n "Re-enter pathname? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) local_sets_dir="" break ;; esac fi done } getanotherdisk() { cat << __EOT Now you can select another disk to initialize. (Do not re-select a disk you have already entered information for). Available disks are: __EOT _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo echo -n "Which one? [done] " getresp "" if [ "X${resp}" = "X" ]; then DISK=done elif [ "X${resp}" = "Xdone" ]; then DISK=done elif isin $resp $_DKDEVS ; then DISK="$resp" else echo echo "The disk $resp does not exist." DISK="" fi } getrootdisk() { cat << __EOT The installation program needs to know which disk to consider the root disk. Note the unit number may be different than the unit number you used in the boot program (especially on a PC with multiple disk controllers). Available disks are: __EOT local _defdsk; _DKDEVS=`md_get_diskdevs` _defdsk=`echo $_DKDEVS | cutlast` if [ "${_defdsk}" != "${_DKDEVS}" ]; then _defdsk="" fi echo "$_DKDEVS" echo echo -n "Which disk is the root disk [${_defdsk}]? " getresp "${_defdsk}" if isin $resp $_DKDEVS ; then ROOTDISK="$resp" else echo echo "The disk $resp does not exist." ROOTDISK="" fi } addhostent() { # $1 - IP address # $2 - symbolic name # Create an entry in the hosts table. If no host table # exists, create one. If the symbolic name already exists, # replace its entry. if [ ! -f /tmp/hosts ]; then echo "127.0.0.1 localhost" > /tmp/hosts fi sed "/ $2.$FQDN $2\$/d" < /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2.$FQDN $2" >> /tmp/hosts } addifconfig() { # $1 - interface name # $2 - interface symbolic name # $3 - interface IP address # $4 - interface netmask # $5 - (optional) interface media directives # Create a hostname.* file for the interface. if [ "$3" = "dhcp" ]; then echo "dhcp NONE NONE NONE $5" > /tmp/hostname.$1 addhostent 127.0.0.1 $2 else echo "inet $3 $4 NONE $5" > /tmp/hostname.$1 addhostent $3 $2 fi } configurenetwork() { local _ifsdone="" _ifs _ouranswer="" _reprompt=1 _IFS=`get_ifdevs` resp="" # force at least one iteration while [ "X${resp}" != X"done" ]; do if [ $_reprompt = 1 ]; then cat << __EOT You may configure the following network interfaces (the interfaces marked with [X] have been succesfully configured): __EOT for _ifs in $_IFS; do if [ "X${_ouranswer}" = "X" ]; then _ouranswer=$_ifs fi if isin $_ifs $_ifsdone ; then echo -n " [X] " else echo -n " [ ] " fi echo $_ifs done echo fi echo -n "Configure which interface? (or, enter 'done') [$_ouranswer] " getresp "$_ouranswer" case "$resp" in "done") ;; "") _reprompt=0 ;; *) _ifs=$resp _ouranswer="done" if isin $_ifs $_IFS ; then if configure_ifs $_ifs ; then _ifsdone="$_ifs $_ifsdone" else _ouranswer="" fi else echo "Invalid response: \"$resp\" is not in list" fi _reprompt=1 ;; esac done } configure_ifs() { local _up _if_name=$1 _if_ip _if_mask local _if_symname _if_extra _hostname set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` _up=$1 _if_ip=$2 _if_mask=$3 if [ $_up = "UP" ]; then ifconfig $_if_name delete down fi # Get IP address resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "IP address (or 'dhcp') ? [$_if_ip] " getresp "$_if_ip" _if_ip=$resp done # Get symbolic name _hostname=`hostname` resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Symbolic (host) name? [$_hostname] " getresp "$_hostname" _if_symname=$resp done # Get netmask if [ "$_if_ip" != "dhcp" ]; then resp="" if [ "X${_if_mask}" = X"" ]; then _if_mask=255.255.255.0 fi while [ "X${resp}" = X"" ]; do echo -n "Netmask ? [$_if_mask] " getresp "$_if_mask" _if_mask=$resp done fi if [ -n "`ifconfig -m ${_if_name} | sed -n '/media/p'`" ]; then echo "Your use of the network interface may require non-default" echo "media directives. The default media is:" ifconfig -m ${_if_name} | sed -n ' /supported/D /media:/p' echo "This is a list of supported media:" ifconfig -m ${_if_name} | sed -n ' /media:/D s/^ // /media/p' echo "If the default is not satisfactory, and you wish to use another" echo "media, copy that line from above (ie. \"media 100baseTX\")" echo -n "Media directives? [$_if_extra] " getresp "$_if_extra" if [ "X${resp}" != X"" ]; then _if_extra=$resp fi fi # Configure the interface. If it # succeeds, add it to the permanent # network configuration info. if [ "$_if_ip" = "dhcp" ]; then ifconfig ${_if_name} down ${_if_extra} cat > /etc/dhclient.conf << __EOT initial-interval 1; send host-name "$_hostname"; request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT dhclient -1 ${_if_name} set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` if [ $1 = "UP" -a $2 = "0.0.0.0" ]; then echo "hostname-associated DHCP attempt for $_if_name failed..." ifconfig $_if_name delete down cat > /etc/dhclient.conf << __EOT initial-interval 1; request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT dhclient -1 ${_if_name} set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` if [ $1 = "UP" -a $2 = "0.0.0.0" ]; then echo "free-roaming DHCP attempt for $_if_name failed." ifconfig $_if_name delete down return 1 else echo "DHCP attempt for $_if_name successful." addifconfig ${_if_name} ${_if_symname} ${_if_ip} return 0 fi else echo "DHCP configuration of $_if_name successful." addifconfig ${_if_name} ${_if_symname} ${_if_ip} return 0 fi else ifconfig ${_if_name} down if ifconfig ${_if_name} inet \ ${_if_ip} \ netmask ${_if_mask} ${_if_extra} up ; then addifconfig ${_if_name} ${_if_symname} ${_if_ip} ${_if_mask} "${_if_extra}" return 0 fi fi return 1 } # Much of this is gratuitously stolen from /etc/netstart. enable_network() { # Set up the hostname. if [ ! -f /mnt/etc/myname ]; then echo "ERROR: no /etc/myname!" return 1 fi hostname=`cat /mnt/etc/myname` hostname $hostname # configure all the interfaces which we know about. ( tmp="$IFS" IFS="$IFS." set -- `echo /mnt/etc/hostname*` IFS=$tmp unset tmp while [ $# -ge 2 ] ; do shift # get rid of "hostname" ( read af name mask bcaddr extras read dt dtaddr if [ ! -n "$name" ]; then echo "/etc/hostname.$1: invalid network configuration file" exit fi cmd="ifconfig $1 $af $name " if [ "${dt}" = "dest" ]; then cmd="$cmd $dtaddr"; fi if [ -n "$mask" ]; then cmd="$cmd netmask $mask"; fi if [ -n "$bcaddr" -a "X$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr"; fi cmd="$cmd $extras" $cmd ) < /mnt/etc/hostname.$1 shift done ) # set the address for the loopback interface ifconfig lo0 inet localhost # use loopback, not the wire route add $hostname localhost # /etc/mygate, if it exists, contains the name of my gateway host # that name must be in /etc/hosts. if [ -f /mnt/etc/mygate ]; then route delete default > /dev/null 2>&1 route add default `cat /mnt/etc/mygate` fi # enable the resolver, if appropriate. if [ -f /mnt/etc/resolv.conf ]; then _resolver_enabled="TRUE" cp /mnt/etc/resolv.conf /tmp/resolv.conf.shadow fi # Display results... echo "Network interface configuration:" ifconfig -am echo if [ "X${_resolver_enabled}" = X"TRUE" ]; then route show echo echo "Resolver enabled." else route -n show echo echo "Resolver not enabled." fi return 0 } # Print the selector and get a response # The list of sets is passed in as $1, sets $resp get_selection() { local _next="" _f _sets=$1 for _f in $_sets ; do if isin $_f $_setsdone ; then echo -n " [X] " _next="" else echo -n " [ ] " if [ -z "$_next" ]; then _next=$_f fi fi echo $_f done # Get the name of the file. echo -n "File name [$_next]? " getresp "$_next" } # Do globbing on the selection and parse +/-, sets _get_files and _setsdone # (which must exist in the local namespace) as side effects. glob_selection() { local _selection="$1" _parent_dir="$2" _sets="$3" local _action _matched _tfile _f if [ "X${_selection}" = X"" ]; then return fi # Change +/- into add/remove _action=add case "$_selection" in +*) _selection="${_selection#?}" ;; -*) _selection="${_selection#?}" _action=remove ;; esac # Major hack to allow the user to select globbing patterns set -o noglob if [ X"$_selection" = X"all" ]; then _selection=* fi _tfile=/tmp/install_case.$$ # safe in single user mode cat >$_tfile << OOF case \$_f in $_selection) # Add/remove file to extraction list if [ "\$_action" = "add" ]; then _get_files=\`addel \${_f} \${_get_files}\` _setsdone=\`addel \${_f} \${_setsdone}\` elif [ "\$_action" = "remove" ]; then _get_files=\`rmel \${_f} \${_get_files}\` _setsdone=\`rmel \${_f} \${_setsdone}\` else echo "Unknown action: \$_action" fi _matched=\$(( \$_matched + 1 )) ;; esac OOF set +o noglob # Eww. _matched=0 for _f in $_sets; do . $_tfile done rm -f $_tfile if [ $_matched -eq 0 ]; then echo "File $_parent_dir/$_selection does not exist. Check to make" echo "sure you entered the information properly or enter 'list' for a file list." fi } install_url() { # Get several parameters from the user, and xfer # files from the server. # Note: _ftp_server_ip, _ftp_server_dir, _ftp_server_login, # _ftp_server_password, and _ftp_active must be global. local _sets _kernel _f _file_list _get_files _failed_files _osetsdone local _url_type _url_base # Is this an ftp or http install? _url_type=$1; shift echo echo "This is an automated ${_url_type}-based installation process. You will be asked" echo "questions and then the files will be retrieved iteratively via ftp(1)." echo # Proxy the connections? if [ "X${_proxy_host}" = X"" ]; then _proxy_host=none fi echo -n "HTTP/FTP proxy URL? (if you use a proxy) [${_proxy_host}] " getresp "${_proxy_host}" if [ "X${resp}" = X"none" ]; then unset _proxy_host ftp_proxy http_proxy else _proxy_host=$resp export ftp_proxy=${_proxy_host} export http_proxy=${_proxy_host} fi if [ "${_url_type}" = "ftp" -a "X$ftp_proxy" = "X" ]; then # Use active mode ftp? (irrelevant if using a proxy) case "${_ftp_active}" in -A) resp=y ;; *) resp=n ;; esac echo "By default, ftp will attempt a passive connection and fall back to a normal" echo "(active) connection if that doesn't work. However, there are some very" echo "old ftp servers that claim to support passive mode, but really do not." echo "In this case, you should explicitly request an active session." echo -n "Do you want to use active ftp? [${resp}] " getresp "${resp}" case "$resp" in y*|Y*) _ftp_active=-A ;; *) unset _ftp_active ;; esac fi # Provide a list of possible servers test -z "$_ftp_getlist" && _ftp_getlist=y echo -n "Do you want a list of potential ${_url_type} servers? [${_ftp_getlist}] " getresp $_ftp_getlist case "$resp" in n*|N*) _ftp_getlist=n ;; *) _ftp_getlist=y ftphost=129.128.5.191 if [ "X${_resolver_enabled}" = X"TRUE" ]; then ftphost=ftp.openbsd.org fi ftp ${_ftp_active} -V -a -o /tmp/ftplist ftp://${ftphost}/pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/ftplist > /dev/null cat /tmp/ftplist | grep "^${_url_type}:" | cat -n | less -XE ;; esac # Get server IP address resp="" # force one iteration while [ "X${resp}" = X"" ]; do if [ -f /tmp/ftplist ]; then eval echo -n "Server IP address, hostname, or list#? [\$_${_url_type}_server_ip]\ " else eval echo -n "Server IP address, or hostname? [\$_${_url_type}_server_ip]\ " fi eval getresp "\$_${_url_type}_server_ip" if [ "X$resp" = "X?" -a -f /tmp/ftplist ]; then cat /tmp/ftplist | grep "^${_url_type}:" | cat -n | less -XE resp="" elif [ -n "$resp" -a `isnumeric $resp` -eq 1 -a ${resp:-0} -ge 1 \ -a -f /tmp/ftplist ]; then maxlines=`grep "^${_url_type}:" /tmp/ftplist | cat -n | sed -n -e '$p' | cutword 1` if [ $maxlines -lt $resp ]; then echo "There is no ${resp}th line in the list." resp="" continue fi tline=`grep "^${_url_type}:" /tmp/ftplist | sed -n -e "${resp}p"` url=`echo $tline | sed -e "s/^${_url_type}:\/\///" | cutword -t' ' 1 | cutword -t' ' 1` host=`echo $url | cutword -t/ 1` path=`echo $url | sed -e "s/^${host}\///"` path="${path}/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" eval _${_url_type}_server_ip=$host eval _${_url_type}_server_dir=$path resp="" # do it again, just to double check echo "Using $tline" else eval _${_url_type}_server_ip="$resp" fi done # Get server directory if [ "${_url_type}" = "ftp" -a "X${_ftp_server_dir}" = X"" ]; then # Default ftp dir _ftp_server_dir="pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" fi resp="" # force one iteration while [ "X${resp}" = X"" ]; do eval echo -n "Server directory? [\$_${_url_type}_server_dir]\ " eval getresp "\$_${_url_type}_server_dir" eval _${_url_type}_server_dir=$resp done if [ "${_url_type}" = "ftp" ]; then # Need default values even if we proxy ftp... if [ "X${_ftp_server_login}" = X"" ]; then _ftp_server_login=anonymous fi if [ "X${_ftp_server_password}" = X"" ]; then _ftp_server_password=root@`hostname`.${FQDN} fi # Get login name resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Login? [${_ftp_server_login}] " getresp "${_ftp_server_login}" _ftp_server_login=$resp done # Get password unless anonymous if [ ${_ftp_server_login} != "anonymous" ]; then resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Password (will not echo): " stty -echo getresp "${_ftp_server_password}" stty echo echo _ftp_server_password=$resp echo -n "Password (again): " stty -echo getresp "${_ftp_server_password}" stty echo echo if [ "${_ftp_server_password}" != "${resp}" ]; then echo "Passwords do not match, try again." resp="" fi done else # only used by ftp_list_files() _ftp_server_password=root@`hostname`.${FQDN} fi fi # Build up the base url since it is so nasty... if [ "${_url_type}" = "ftp" -a "${_ftp_server_login}" != "anonymous" ]; then eval _url_base=${_url_type}://${_ftp_server_login}:${_ftp_server_password}@\$_${_url_type}_server_ip/\$_${_url_type}_server_dir else eval _url_base=${_url_type}://\$_${_url_type}_server_ip/\$_${_url_type}_server_dir fi # Get list of files from the server. # XXX - check for nil $_file_list and deal if [ "${_url_type}" = "ftp" -a "X${ftp_proxy}" = X"" ]; then _file_list=`ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_ftp_server_password" "$_ftp_server_dir"` else # Assumes index file is "index.txt" for http (or proxy) # We can't use index.html since the format is server-dependent _file_list=`ftp -o - -V ${_url_base}/index.txt | sed 's/ //'` fi _sets="" if list_has_sets "$_file_list" $THESETS; then for _f in $THESETS ; do if [ "X${_f}" = "Xkernel" ]; then if isin bsd $_file_list; then _kernel=bsd fi elif isin ${_f}${VERSION}.tar.gz $_file_list; then _sets="$_sets ${_f}${VERSION}.tar.gz" elif isin ${_f}${VERSION}.tgz $_file_list; then _sets="$_sets ${_f}${VERSION}.tgz" fi done else eval echo "There are no OpenBSD install sets available in \"\$_${_url_type}_server_dir\"." echo -n "Search for *.tar.gz and *.tgz files? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac # *.tar.gz and *.tgz are possible sets _sets="" _kernel="" for _f in ${_file_list} ; do case "$_f" in *.tar.gz|*.tgz) _sets="$_sets ${_f}" esac done if [ "X${_sets}" = X"" ]; then echo "There are no *.tar.gz or *.tgz files in that dir." echo -n "See a directory listing? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac echo echo "${_file_list}" echo return else echo "Adding *.tar.gz and *.tgz files to selector." fi fi # Yes, all those blackslashes really are necesary... eval echo "\\\\n"\ "You will now be asked for files to extract. In addition to the\\\\n"\ "files listed in the selector you may enter any file located at\\\\n"\ "\$_${_url_type}_server_ip:\$_${_url_type}_server_dir. You can also enter\\\\n"\ "'all' to install all the standard sets, or 'list' to list the\\\\n"\ "files avilable at \$_${_url_type}_server_ip:\$_${_url_type}_server_dir.\\\\n"\ "When you are done selecting files, enter 'done'.\\\\n"\ "Some of these sets are required for your ${MODE} and some are optional --\\\\n"\ "You will want at least the base and bsd sets.\\\\n"\ "Consult the installation notes if you are not sure which sets are required!" _osetsdone="$_setsdone" # Set a minimal default for _f in $_sets $_kernel; do case "$_f" in base*.tar.gz|base*.tgz|etc*.tar.gz|etc*.tgz|bsd) if ! isin ${_f} ${_setsdone}; then _get_files=`addel ${_f} ${_get_files}` _setsdone=`addel ${_f} ${_setsdone}` fi ;; esac done # Allow the user to select/de-select additional sets while : ; do echo echo "The following sets are available for extraction." echo "Enter filename, \`list', \`all', or \`done'." echo "You may de-select a set by prepending a '-' to its name." echo get_selection "$_sets $_kernel" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo eval echo "\$_${_url_type}_server_dir:" echo "${_file_list}" continue fi eval glob_selection \"$resp\" \$_${_url_type}_server_dir \"$_sets $_kernel\" done # User may have said "done" without selecting any files if [ "X${_get_files}" = X"" ]; then return fi echo echo "Fetching files via ${_url_type} may take a long time, especially over a slow network" echo -n "connection. Ready to download files? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) _setsdone="$_osetsdone" return ;; esac # Download the files one at a time and keep track of which ones failed while test -n "${_get_files}" ; do _failed_files="" echo for _f in $_get_files ; do echo "Getting ${_f} ..." if [ "X${_f}" = "X${_kernel}" ]; then ( cd /mnt ; ftp ${_ftp_active} -V -m ${_url_base}/${_f} ) else ( cd /mnt ; ftp ${_ftp_active} -o - -V -m ${_url_base}/${_f} | tar zxpf - ) fi if [ $? -ne 0 ]; then # Mark xfer as having failed,. _setsdone=`rmel $_f $_setsdone` _failed_files="${_failed_files} ${_f}" fi done # Give them the option of refetching failed files. _get_files="" while test -n "${_failed_files}" ; do echo echo "The following files failed to transfer and extract correctly:" echo "Choose which one(s) to refetch or 'done' to exit selector." echo "You may de-select a file by prepending a '-' to its name." echo get_selection "$_failed_files" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo eval echo "\$_${_url_type}_server_dir:" echo "${_file_list}" echo continue fi eval glob_selection \"$resp\" \$_${_url_type}_server_dir \"$_failed_files\" done done } install_from_mounted_fs() { # $1 - directory containing installation sets local _sets="" _kernel _f _get_files _failed_files _osetsdone if [ ! -d $1 ]; then echo "No such directory: $1" return fi if dir_has_sets $1 $THESETS; then for _f in $THESETS ; do if [ "X${_f}" = "Xkernel" ]; then if [ -f $1/bsd ]; then _kernel=bsd fi elif [ -f $1/${_f}${VERSION}.tar.gz ]; then _sets="$_sets ${_f}${VERSION}.tar.gz" elif [ -f $1/${_f}${VERSION}.tgz ]; then _sets="$_sets ${_f}${VERSION}.tgz" fi done else echo "There are no OpenBSD install sets available in \"$1\"." echo -n "Search for *.tar.gz and *.tgz files? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac # *.tar.gz and *.tgz are possible sets _sets="" _kernel="" _sets=`cd $1 ; echo *.tar.gz *.tgz` if [ "X${_sets}" = X'*.tar.gz *.tgz' ]; then echo "There are no *.tar.gz or *.tgz files in that dir." echo -n "See a directory listing? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac echo ( cd $1 && ls ) echo return else echo "Adding *.tar.gz and *.tgz files to selector." fi fi echo "\n"\ "You will now be asked for files to extract. In addition to the\n"\ "files listed in the selector you may enter any file located in\n"\ "$1. You can also enter 'all' to install all the standard\n"\ "sets, or 'list' to list the files avilable in $1.\n"\ "When you are done selecting files, enter 'done'.\n"\ "Some of these sets are required for your ${MODE} and some are optional --\n"\ "You will want at least the base and bsd sets.\n"\ "Consult the intallation notes if you are not sure which sets are required!" _osetsdone="$_setsdone" # Set a minimal default for _f in $_sets $_kernel; do case "$_f" in base*.tar.gz|base*.tgz|etc*.tar.gz|etc*.tgz|bsd) if ! isin ${_f} ${_setsdone}; then _get_files=`addel ${_f} ${_get_files}` _setsdone=`addel ${_f} ${_setsdone}` fi ;; esac done # Allow the user to select/de-select additional sets while : ; do echo echo "The following sets are available for extraction." echo "Enter filename, \`list', \`all', or \`done'." echo "You may de-select a set by prepending a '-' to its name." echo get_selection "$_sets $_kernel" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo echo "${1}:" ( cd $1 && ls ) continue fi glob_selection "$resp" "$1" "$_sets $_kernel" done # User may have said "done" without selecting any files if [ "X${_get_files}" = X"" ]; then return fi echo echo -n "Ready to extract selected file sets? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) _setsdone="$_osetsdone" return ;; esac # Extract the files one at a time and keep track of which ones failed while test -n "${_get_files}" ; do _failed_files="" echo for _f in $_get_files ; do echo "$1/${_f}:" if [ "X${_f}" = "X${_kernel}" ]; then ftp -V -m -o /mnt/$_f file:$1/$_f else ftp -V -m -o - file:$1/$_f | (cd /mnt; tar -zxpf -) fi if [ $? -ne 0 ]; then # Mark xfer as having failed,. _setsdone=`rmel $_f $_setsdone` _failed_files="${_failed_files} ${_f}" fi done # Give them the option of retrying failed files. _get_files="" while test -n "${_failed_files}" ; do echo echo "The following files failed to extract correctly:" echo "Choose which one(s) to retry or 'done' to exit selector." echo "You may de-select a file by prepending a '-' to its name." echo get_selection "$_failed_files" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo echo "${1}:" ( cd $1 && ls ) echo continue fi glob_selection "$resp" "$1" "$_failed_files" done done } install_cdrom() { local _drive _partition_range _partition _fstype _directory # Get the cdrom device info cat << __EOT The following CD-ROM devices are installed on your system; please select the CD-ROM device containing the partition with the installation sets: __EOT _CDDEVS=`md_get_cddevs` echo "$_CDDEVS" echo echo -n "Which is the CD-ROM with the installation media? [abort] " getresp "abort" case "$resp" in abort) echo "Aborting." return ;; *) if isin $resp $_CDDEVS ; then _drive=$resp else echo echo "The CD-ROM $resp does not exist." echo "Aborting." return fi ;; esac # Get partition _partition_range=`md_get_partition_range` resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "CDROM partition to mount (normally \"c\")? [c] " getresp "c" case "$resp" in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Ask for filesystem type cat << __EOT There are two CD-ROM filesystem types currently supported by this program: cd9660 ISO-9660 ffs Berkeley Fast Filesystem __EOT resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type (Official OpenBSD CDROM is cd9660)? [cd9660] " getresp "cd9660" case "$resp" in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Mount the CD-ROM if ! mount -t ${_fstype} -o ro \ /dev/${_drive}${_partition} /mnt2 ; then echo "Cannot mount CD-ROM drive. Aborting." return fi # Get the directory where the file lives if [ "X${_directory}" = X"" ]; then _directory="/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" fi resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_directory}] " getresp "${_directory}" done _directory=$resp install_from_mounted_fs /mnt2/${_directory} umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { # Mount a disk on /mnt2. The set of disk devices to choose from # is $_DKDEVS. # returns 0 on failure. local _drive _def_partition _partition_range _partition _fstype local _fsopts _directory _md_fstype _md_fsopts getresp "abort" case "$resp" in abort) echo "Aborting." return 0 ;; *) if isin $resp $_DKDEVS ; then _drive=$resp else echo echo "The disk $resp does not exist." echo "Aborting." return 0 fi ;; esac # Get partition cat << __EOT The following partitions have been found on $_drive: __EOT disklabel $_drive 2>/dev/null | grep '^ .:' echo _likely_partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/swap/s/.*//' -e '/unused/s/.*//' \ -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _def_partition=`echo $_likely_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then _def_partition=`echo $_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then echo "There are no usable partitions on that disk" return 0 fi fi resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Partition? [$_def_partition] " getresp "$_def_partition" case "$resp" in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Ask for filesystem type cat << __EOT The following filesystem types are supported: default (deduced from the disklabel) ffs __EOT _md_fstype=`md_native_fstype` _md_fsopts=`md_native_fsopts` if [ ! -z "$_md_fstype" ]; then echo " $_md_fstype" else _md_fstype="_undefined_" fi resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [default] " getresp "default" case "$resp" in default) _fstype="" _fsopts="ro" ;; ffs) _fstype="-t $resp" _fsopts="ro" ;; $_md_fstype) _fstype="-t $resp" _fsopts=$_md_fsopts ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Mount the disk if ! mount $_fstype -o $_fsopts /dev/${_drive}${_partition} /mnt2; then echo "Cannot mount disk. Aborting." return 0 fi return 1 } install_disk() { local _directory cat << __EOT The following disk devices are installed on your system; please select the disk device containing the partition with the installation sets: __EOT _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo echo -n "Which is the disk with the installation sets? [abort] " if mount_a_disk ; then return fi # Get the directory where the file lives resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_directory}] " getresp "${_directory}" done _directory=$resp install_from_mounted_fs /mnt2/${_directory} umount -f /mnt2 > /dev/null 2>&1 } install_nfs() { # Get the IP address of the server resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Server IP address or hostname? [${_nfs_server_ip}] " getresp "${_nfs_server_ip}" done _nfs_server_ip=$resp # Get server path to mount resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Filesystem on server to mount? [${_nfs_server_path}] " getresp "${_nfs_server_path}" done _nfs_server_path=$resp # Determine use of TCP echo -n "Use TCP transport (only works with capable NFS server)? [n] " getresp "n" case "$resp" in y*|Y*) _nfs_tcp="-T" ;; *) _nfs_tcp="" ;; esac # Mount the server mkdir /mnt2 > /dev/null 2>&1 if ! mount_nfs $_nfs_tcp ${_nfs_server_ip}:${_nfs_server_path} \ /mnt2 ; then echo "Cannot mount NFS server. Aborting." return fi # Get the directory where the file lives resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_nfs_directory}] " getresp "${_nfs_directory}" done _nfs_directory=$resp install_from_mounted_fs /mnt2/${_nfs_directory} umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd # Get the name of the tape from the user. cat << __EOT The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __EOT _tape=`basename $TAPE` resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Name of tape device? [${_tape}]" getresp "${_tape}" done _tape=`basename $resp` TAPE="/dev/${_tape}" if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." echo "Aborting." return fi export TAPE # Rewind the tape device echo -n "Rewinding tape..." if ! mt rewind ; then echo "$TAPE may not be attached to the system or may not be" echo "a tape device. Aborting." return fi echo "done." # Get the file number resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "File number? " getresp "" case "$resp" in [1-9]*) _nskip=$(( $resp - 1 )) ;; *) echo "Invalid file number ${resp}." resp="" # fore loop to repeat ;; esac done # Skip to correct file. echo -n "Skipping to source file..." if [ "X${_nskip}" != X"0" ]; then if ! mt fsf $_nskip ; then echo "Could not skip $_nskip files. Aborting." return fi fi echo "done." cat << __EOT There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __EOT resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which way is it? [1] " getresp "1" case "$resp" in 1) _xcmd="tar -zxvpf -" ;; 2) _xcmd="tar -xvpf -" ;; *) echo "Invalid response: $resp." resp="" # force loop to repeat ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } get_timezone() { local _a _zonepath # # If the zoneinfo is not on the installation medium or on the # installed filesystem, set TZ to GMT and return immediatly. # if [ ! -e /usr/share/zoneinfo -a ! -e /mnt/usr/share/zoneinfo ]; then TZ=GMT return fi if [ ! -d /usr/share/zoneinfo ]; then _zonepath=/mnt else _zonepath="" fi cat << __EOT Select a time zone for your location. Timezones are represented on the system by a directory structure rooted in "/usr/share/timezone". Most timezones can be selected by entering a token like "MET" or "GMT-6". Other zones are grouped by continent or country, with detailed zone information separated by a slash ("/"), e.g. "US/Pacific" or "Canada/Mountain". To get a listing of what's available in /usr/share/zoneinfo, enter "?" at the prompts below. __EOT if [ X$TZ = X ]; then TZ=`ls -l /mnt/etc/localtime 2>/dev/null | cutlast` TZ=${TZ#/usr/share/zoneinfo/} fi while : ; do echo -n "Wh#!/bin/sh # $OpenBSD: install.sh,v 1.53 1999/04/10 04:38:30 deraadt Exp $ # $NetBSD: install.sh,v 1.5.2.8 1996/08/27 18:15:05 gwr Exp $ # # Copyright (c) 1997,1998 Todd Miller, Theo de Raadt # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Todd Miller and # Theo de Raadt # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. FILESYSTEMS="/tmp/filesystems" # used thoughout FQDN="" # domain name trap "umount /tmp > /dev/null 2>&1" 0 MODE="install" # include machine-dependent functions # The following functions must be provided: # md_copy_kernel() - copy a kernel to the installed disk # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_prep_disklabel() - label the root disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_native_fstype() - native filesystem type for disk installs # md_native_fsopts() - native filesystem options for disk installs # md_makerootwritable() - make root writable (at least /tmp) # md_machine_arch() - get machine architecture # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$ALLSETS $MDSETS" if [ "`df /`" = "`df /mnt`" ]; then # Good {morning,afternoon,evening,night}. echo ================================================== md_welcome_banner echo -n "Proceed with installation? [n] " else echo "You seem to be trying to restart an interrupted installation!" echo echo "You can try to skip the disk preparation steps and continue," echo "otherwise you should reboot the miniroot and start over..." echo -n "Skip disk initialization? [n] " fi getresp "n" case "$resp" in y*|Y*) echo echo "Cool! Let's get to it..." ;; *) md_not_going_to_install exit ;; esac # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 # Deal with terminal issues md_set_term # Get timezone info get_timezone # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. if [ "`df /`" = "`df /tmp`" ]; then md_makerootwritable fi # Get the machine architecture (must be done after md_makerootwritable) ARCH=`md_machine_arch` if [ "`df /`" = "`df /mnt`" ]; then # Install the shadowed disktab file; lets us write to it for temporary # purposes without mounting the miniroot read-write. if [ -f /etc/disktab.shadow ]; then cp /etc/disktab.shadow /tmp/disktab.shadow fi while : ; do if [ "X${ROOTDISK}" = "X" ]; then while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done DISK=$ROOTDISK else DISK="" while [ "X${DISK}" = "X" ]; do getanotherdisk done if [ "${DISK}" = "done" ]; then break fi fi # Deal with disklabels, including editing the root disklabel # and labeling additional disks. This is machine-dependent since # some platforms may not be able to provide this functionality. md_prep_disklabel ${DISK} # Assume partition 'a' of $ROOTDISK is for the root filesystem. # Loop and get the rest. # XXX ASSUMES THAT THE USER DOESN'T PROVIDE BOGUS INPUT. cat << __get_filesystems_1 You will now have the opportunity to enter filesystem information for ${DISK}. You will be prompted for the mount point (full path, including the prepending '/' character) for each BSD partition on ${DISK}. Enter "none" to skip a partition or "done" when you are finished. __get_filesystems_1 if [ "${DISK}" = "${ROOTDISK}" ]; then echo echo "The following partitions will be used for the root filesystem and swap:" echo " ${ROOTDISK}a /" echo " ${ROOTDISK}b swap" echo "${ROOTDISK}a /" > ${FILESYSTEMS} fi # XXX - allow the user to name mount points on disks other than ROOTDISK # also allow a way to enter non-BSD partitions (but don't newfs!) # Get the list of BSD partitions and store sizes _npartitions=0 for _p in `disklabel ${DISK} 2>&1 | grep '^ *[a-p]:.*BSD' | sed 's/^ *\([a-p]\): *\([0-9][0-9]*\) .*/\1\2/'`; do _pp=`firstchar ${_p}` if [ "${DISK}" = "${ROOTDISK}" -a "$_pp" = "a" ]; then continue fi _ps=`echo ${_p} | sed 's/^.//'` _partitions[${_npartitions}]=${_pp} _psizes[${_npartitions}]=${_ps} # If the user assigned a mount point, use it. if [ -f /tmp/fstab.${DISK} ]; then _mount_points[${_npartitions}]=`sed -n "s:^/dev/$DISK$_pp[ ]*\([^ ]*\).*:\1:p" < /tmp/fstab.${DISK}` fi _npartitions=$(( ${_npartitions} + 1 )) done # Now prompt the user for the mount points. Loop until "done" echo _i=0 resp="X" while [ $_npartitions -gt 0 -a X${resp} != X"done" ]; do _pp=${_partitions[${_i}]} _ps=$(( ${_psizes[${_i}]} / 2 )) _mp=${_mount_points[${_i}]} # Get the mount point from the user while : ; do echo -n "Mount point for ${DISK}${_pp} (size=${_ps}k) [$_mp, RET, none, or done]? " getresp "$_mp" case "X${resp}" in X/*) _mount_points[${_i}]=$resp break ;; Xdone|X) break ;; Xnone) _mount_points[${_i}]= break;; *) echo "mount point must be an absolute path!";; esac done _i=$(( ${_i} + 1 )) if [ $_i -ge $_npartitions ]; then _i=0 fi done # Now write it out _i=0 while test $_i -lt $_npartitions; do if [ -n "${_mount_points[${_i}]}" ]; then echo "${DISK}${_partitions[${_i}]} ${_mount_points[${_i}]}" >> ${FILESYSTEMS} _mount_points[${_i}]="" fi _i=$(( ${_i} + 1 )) done rm -f /tmp/fstab.${DISK} done echo echo "You have configured the following devices and mount points:" echo cat ${FILESYSTEMS} echo echo "Filesystems will now be created on these devices." echo "If you made any mistakes, you may edit this now." echo -n "Edit using ${EDITOR}? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} ${FILESYSTEMS} ;; *) ;; esac echo echo "============================================================" echo "The next step will overwrite any existing data on:" ( echo -n " " while read _device_name _junk; do echo -n "${_device_name} " done echo ) < ${FILESYSTEMS} echo echo -n "Are you really sure that you're ready to proceed? [n] " getresp "n" case "$resp" in y*|Y*) ;; *) echo "ok, try again later..." exit ;; esac # Loop though the file, place filesystems on each device. echo "Creating filesystems..." ( while read _device_name _junk; do newfs -q /dev/r${_device_name} done ) < ${FILESYSTEMS} else # Get the root device ROOTDISK=`df /mnt | sed -e '/^\//!d' -e 's/\/dev\/\([^ ]*\)[a-p] .*/\1/'` while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done fi # Get network configuration information, and store it for placement in the # root filesystem later. cat << \__network_config_1 You will now be given the opportunity to configure the network. This will be useful if you need to transfer the installation sets via FTP, HTTP, or NFS. Even if you choose not to transfer installation sets that way, this information will be preserved and copied into the new root filesystem. __network_config_1 echo -n "Configure the network? [y] " getresp "y" case "$resp" in y*|Y*) resp="" # force at least one iteration _nam="" if [ -f /tmp/myname ]; then _nam=`cat /tmp/myname` fi while [ "X${resp}" = X"" ]; do echo -n "Enter system hostname (short form, ie. \"foo\"): [$_nam] " getresp "$_nam" done hostname $resp echo $resp > /tmp/myname resp="" # force at least one iteration if [ -f /tmp/resolv.conf ]; then FQDN=`grep '^domain ' /tmp/resolv.conf | \ sed -e 's/^domain //'` fi while [ "X${resp}" = X"" ]; do echo -n "Enter DNS domain name (ie. \"bar.com\"): [$FQDN] " getresp "$FQDN" done FQDN=$resp echo echo "If you have any devices being configured by a DHCP server" echo "it is recommended that you do not enter a default route or" echo "any name servers." echo configurenetwork resp=`route -n show | grep '^default' | sed -e 's/^default //' -e 's/ .*//'` if [ "X${resp}" = "X" ]; then resp=none if [ -f /tmp/mygate ]; then resp=`cat /etc/mygate` if [ "X${resp}" = "X" ]; then resp="none"; fi fi fi echo -n "Enter IP address of default route: [$resp] " getresp "$resp" if [ "X${resp}" != X"none" ]; then route delete default > /dev/null 2>&1 if route add default $resp > /dev/null ; then echo $resp > /tmp/mygate fi fi resp="none" if [ -f /etc/resolv.conf ]; then resp="" for n in `grep '^nameserver ' /etc/resolv.conf | \ sed -e 's/^nameserver //'`; do if [ "X${resp}" = "X" ]; then resp="$n" else resp="$resp $n" fi done elif [ -f /tmp/resolv.conf ]; then resp="" for n in `grep '^nameserver ' /tmp/resolv.conf | \ sed -e 's/^nameserver //'`; do if [ "X${resp}" = "X" ]; then resp="$n" else resp="$resp $n" fi done fi echo -n "Enter IP address of primary nameserver: [$resp] " getresp "$resp" if [ "X${resp}" != X"none" ]; then echo "search $FQDN" > /tmp/resolv.conf for n in `echo ${resp}`; do echo "nameserver $n" >> /tmp/resolv.conf done echo "lookup file bind" >> /tmp/resolv.conf echo -n "Would you like to use the nameserver now? [y] " getresp "y" case "$resp" in y*|Y*) cp /tmp/resolv.conf \ /tmp/resolv.conf.shadow ;; *) ;; esac fi if [ ! -f /tmp/resolv.conf.shadow ]; then echo echo "The host table is as follows:" echo cat /tmp/hosts cat << __hosts_table_1 You may want to edit the host table in the event that you are doing an NFS installation or an FTP installation without a name server and want to refer to the server by name rather than by its numeric ip address. __hosts_table_1 echo -n "Would you like to edit the host table with ${EDITOR}? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/hosts ;; *) ;; esac fi cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to install." sh ;; *) ;; esac ;; *) ;; esac if [ "`df /`" = "`df /mnt`" ]; then # Now that the network has been configured, it is safe to configure the # fstab. ( while read _dev _mp; do if [ "$_mp" = "/" ]; then echo /dev/$_dev $_mp ffs rw 1 1 else echo /dev/$_dev $_mp ffs rw 1 2 fi done ) < ${FILESYSTEMS} > /tmp/fstab # XXX We no longer do the following. It is not neccessary. It can be done # XXX after the install is complete. # # echo "The fstab is configured as follows:" # echo # cat /tmp/fstab # cat << \__fstab_config_1 # #You may wish to edit the fstab. You may also wish to take this opportunity to #place NFS mounts in the fstab (this would be especially useful if you plan to #keep '/usr' on an NFS server. #__fstab_config_1 # echo -n "Edit the fstab with ${EDITOR}? [n] " # getresp "n" # case "$resp" in # y*|Y*) # ${EDITOR} /tmp/fstab # ;; # # *) # ;; # esac # # echo munge_fstab /tmp/fstab /tmp/fstab.shadow mount_fs /tmp/fstab.shadow fi mount | while read line; do set -- $line if [ "$2" = "/" -a "$3" = "nfs" ]; then echo "You appear to be running diskless." echo -n "Are the install sets on one of your currently mounted filesystems? [n] " getresp "n" case "$resp" in y*|Y*) get_localdir ;; *) ;; esac fi done resp="" # force one iteration echo echo 'Please enter the initial password that the root account will have.' while [ "X${resp}" = X"" ]; do echo -n "Password (will not echo): " stty -echo getresp "${_password}" stty echo echo _password=$resp echo -n "Password (again): " stty -echo getresp "" stty echo echo if [ "${_password}" != "${resp}" ]; then echo "Passwords do not match, try again." resp="" fi done install_sets $THESETS md_copy_kernel # Copy in configuration information and make devices in target root. if [ ! -d /mnt/etc -o ! -d /mnt/usr/share/zoneinfo -o ! -d /mnt/dev ]; then echo "Something needed to complete the installation seems" echo "to be missing, did you forget to extract a required set?" echo echo "Please review the installation notes and try again..." echo echo "You *may* be able to correct the problem and type 'install'" echo "without having to extract all of the distribution s#!/bin/sh # $OpenBSD: upgrade.sh,v 1.9 1998/09/11 22:45:53 millert Exp $ # $NetBSD: upgrade.sh,v 1.2.4.5 1996/08/27 18:15:08 gwr Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. ROOTDISK="" # filled in below trap "unmount_fs -check /tmp/fstab.shadow > /dev/null 2>&1; rm -f /tmp/fstab.shadow" 0 MODE="upgrade" # include machine-dependent functions # The following functions must be provided: # md_copy_kernel() - copy a kernel to the installed disk # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_labeldisk() - put label on a disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_machine_arch() - get machine architecture # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$UPGRSETS $MDSETS" # Good {morning,afternoon,evening,night}. md_welcome_banner echo -n "Proceed with upgrade? [n] " getresp "n" case "$resp" in y*|Y*) echo "Cool! Let's get to it..." ;; *) md_not_going_to_install exit ;; esac # Deal with terminal issues md_set_term # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. md_makerootwritable # Get the machine architecture (must be done after md_makerootwritable) ARCH=`md_machine_arch` while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done # Assume partition 'a' of $ROOTDISK is for the root filesystem. Confirm # this with the user. Check and mount the root filesystem. resp="" # force one iteration while [ "X${resp}" = "X" ]; do echo -n "Root filesystem? [${ROOTDISK}a] " getresp "${ROOTDISK}a" _root_filesystem="/dev/`basename $resp`" if [ ! -b ${_root_filesystem} ]; then echo "Sorry, ${resp} is not a block device." resp="" # force loop to repeat fi done echo "Checking root filesystem..." if ! fsck -pf ${_root_filesystem}; then echo "ERROR: can't check root filesystem!" exit 1 fi echo "Mounting root filesystem..." if ! mount -o ro ${_root_filesystem} /mnt; then echo "ERROR: can't mount root filesystem!" exit 1 fi # Grab the fstab so we can munge it for our own use. if [ ! -f /mnt/etc/fstab ]; then echo "ERROR: no /etc/fstab!" exit 1 fi # Grab the hosts table so we can use it. if [ ! -f /mnt/etc/hosts ]; then echo "ERROR: no /etc/hosts!" exit 1 fi cp /mnt/etc/hosts /tmp/hosts # Start up the network in same/similar configuration as the installed system # uses. cat << \__network_config_1 The upgrade program would now like to enable the network. It will use the configuration already stored on the root filesystem. This is required if you wish to use the network installation capabilities of this program. __network_config_1 echo -n "Enable network? [y] " getresp "y" case "$resp" in y*|Y*) if ! enable_network; then echo "ERROR: can't enable network!" exit 1 fi cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to upgrade." sh ;; *) ;; esac ;; *) ;; esac # Now that the network has been configured, it is safe to configure the # fstab. We remove all but ufs/ffs. ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" -o \ "X${_fstype}" = X"ffs" ]; then if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab fi done ) < /mnt/etc/fstab echo "The fstab is configured as follows:" echo "" cat /tmp/fstab cat << \__fstab_config_1 You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. Note that this fstab is only for installation purposes, and will not be copied into the root filesystem. __fstab_config_1 echo -n "Edit the fstab with ${EDITOR}? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac echo "" munge_fstab /tmp/fstab /tmp/fstab.shadow if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit 1 fi # Check all of the filesystems. check_fs /tmp/fstab.shadow # Mount filesystems. mount_fs /tmp/fstab.shadow echo -n "Are the upgrade sets on one of your normally mounted (local) filesystems? [y] " getresp "y" case "$resp" in y*|Y*) get_localdir /mnt ;; *) ;; esac # Install sets. install_sets $THESETS # Get timezone info get_timezone # Fix up the fstab. echo -n "Converting ufs to ffs in /etc/fstab..." ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab done ) < /mnt/etc/fstab echo "done." echo -n "Would you like to edit the resulting fstab with ${EDITOR}? [y] " getresp "y" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac # Copy in configuration information and make devices in target root. ( cd /tmp for file in fstab; do if [ -f $file ]; then echo -n "Copying $file..." cp $file /mnt/etc/$file echo "done." fi done echo -n "Installing timezone link..." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." echo -n "Making devices..." #_pid=`twiddle` cd /mnt/dev sh MAKEDEV all #kill $_pid echo "done." md_copy_kernel md_installboot ${ROOTDISK} ) unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0 tXxhov$ ׀0GH"@ $<6DN N\ <k_x<8 8fe w<Eu@# ׈.s8@ULV`=q@<p ׌ א€"3 ۘ<:MZ/dmLwWtpx+<94GU ?$#/<IgQЀf du W( c` #. _t" e P h p/< `O ZiYu1`~ <? HaPV_ tv`L(2ܸD xMhV`jP<w  PǼ08^  | ܀tD&3@H8Zlq t ܄|4/\` ܈&2(@MH]3PfH"x h Hf<0@S"P02cB)NWްnz\,P@H@` LiH 6!M/=: ȴK XZh' v ܰӄ9@, bx0J E((/DC ܸJ UPa\s0 ( "e|R@%.?|,O4_Ekxsl$ \`&@ 1Q#Cl/iL9FN8ZNpeq|<Up`%\d>8Uä  k, \; D~SD`%8g.tMl< T,/)L,'G(22<?MY jsv/h L n 8  j >  % / 9GϰY"he:huYHȰE8$Ōc` aP"* 8LL HY Ln4y3  P8X XUp[ <&P5JQ0_ti}ZG+0h X \ ` hl%͔.E_OlWh_0h\uW&t d j$ , h |$7/w4:sH pQ[jk0x6(HL%@MDO68 M  lMX^ h8r$Q cH0p,(pL 1EzMak~dLj ,3x'D %-T8?JUcR`q{ C ( ,z T#֠+ 05#A_Lx[7(iO~M 8 z,rb;ppj/fA hLV _3n5L{H+ 0 8Z +E8o,ʔ *M@4?'J`R`it0P  ,|$)kp7A# K T/T\glwbU$z|c\ EP" /)p5 \>Gt^ k {w7 8  &    b(+8lLR`,](jcw .p3$XD/.[` C J2<XK T4a~|ny [TqWH|  J|+%(;TF,T v^mˀ{ VlP  Ҁ׈  ƘM%;6WPM6 Z5@coh} 8VV;4 %d. Lp: LLV  g3pe|T= ѐ̜&8_IvU H^<kvRD  ( X`3 hHy0Ph'7 H_ brd x$X ex/HL PL H,qAM`[>e '{th`\( XP_'7$A \LU\`jxvej?|0B d yT% ϴ" `* 4DeWiauT|MWte|   Y< (5H?U0\=f6u2ǤV 4P4H   ( g$D+ : K \d0h lv€ŠI˜ ¡,ª0¶_(L`|րW\  !x7phCLdWLl GÎÛS\æök( h` XWd F+1: O V nd4~ Rď Ę`ģCIJU@.` <#|\,=VTK]d+u Ł xōśŢ}ů'|l @   _?9!9 *1 :PHDY ePw Ƅ Ɠ ƣ  ƪƵ^d (W_7E'0  =KRW_<ldlvDŽ(ǎ ǜ  Ǥ(ǫ`ǽP[p<8 !T$-  : GU7_kXsxȎțiȪ+ȷpG|  >v$"+<GzS/Db(q-x}4ɏ$ɜɥ  ɮ84ɸ+ɿ0 0  (ft  0L&!#,¼7  H>H<U`fpjXw  `~ʌ*ʜʥ eXʵ  d0@/D  h/`L8'H0p:  GV`fq  zYˋ0˙˧@,˵ll 4rN(b$_;^RPc6\r2̅ ̡̮̑  ̾d ,tPu< ѐ 4,P(&  / 9#lBN\0ddpE  ͐͛2lͧPͶ  0`<x'ð78G8<VDaSn=}·}ΖfxΤtή;οPV   ]D-`>YxSt([juF |TχGϐTϡ8ϩUDϺ b0߀ `A"L014?D@LU  e(mҴ|LЕxУ4Ь< й   ($d/88F@?M`sш ёѠwѬp\  , $8@0:A 4NSPXC8`psz ҎTҖ0Ҟдҫ/TҲT0- |<*h7D0\eo:@z,ӊӒӤ/`ӱӻڨ X  X78R"L+p9O0HW|csi~wԋԗtԥRԬJ0Թ(00 (`WP Dt " H,ӌ9IU"`]hq x#Ձ Ռ ՛4Xզղ_V|cf%ڸ/h<AGTa_dh[Lr $֍W֢ ִ P xA 9H* %+H2<IQV,|f ut \׃hאמ׭8׻Xa4 a  *><I`Q4]el | ؋  8ؓ؜ا<ص #Hd  0)p "T P( 5^B,OXLbwnzM4ن4ّٚ5٩0ٴپ>0@@2Tptfx f`, "X4D#JSy Z3h {ډàژ4ڣ0ګ4ںưmRp "0<<HQ z_plvB4ۀۈpے ۟"ۥW@۾ Hd3 "4h "~4-JBTIjX "`,mD܃O܌ܖV ܳDh T WXT'2/50IŸT}_;fuׄ݃ +ݔ8ݢ #ݭWPݼpP<D 54 'u/ ll<؄J)U0@bjtd6ޅ" ލ\ޗ #ޤް޾ + + <4p&/#8 A +KVd`|r@߃ߔxߜpߧ ,`߯o2T6`"`4BJs^Dksg~|X . .T |)@' H0 n; .HRcw .6 .F9 . &I1:B K 0R0Za /ltz /<t$  /*<D / dD,?, p& H7Œ?J Y fdpk:T \O 5 ˆ  ;h+X6(BVO /[hpu /Am( / / 7m f$[/6@G /NY i@s 0ycڈ1 0 0(2(!x.9MzZm,zr\ 0,h/@H x H) Y7R DadO[=pǸx -0 00n8'2,@>TJTackb}^t 04 bh@` 083| 0 \|`.=VDld  6b8>4VlS h,8pC 70L Xb4y̬v 74( 78 ; XK0H; ZK7]9du\v | ,.!b4`d*H 7< 7@lH 7H&<0@2\NYe {r @}2/@bbb J" 7P/D/ LV] [m0|, 7T?|c* dtp ל+ 7X1*>,E=VxftJ@ ;\ ;` ;dHH ;h0   ;p pN5NHjXdKm%uWTH  Pd6'.@ˀ 9>+8f4D=lV zb ;xmxKl ;*8-XXD ; l &@$7?H ;Xѐi q ; ;TpL+H10L ;wL(6~B O <fqD,{WIP  < <t ~`I.@M>lZll "yx9D < hD@ <Ը  <" f.-x8E < O <0TDZ$(k_| <49P:< DWk <8q <<QT2 2Ɯ> KLY<bl_x2<t$18CIracpoQ8d@6d <@ED  (01>P F4SY.Pa ]i tàWq ]C ]e.| H s`0 ?IO ][\iu3d _X,Ik ,҈1bP2J$.h< ]KP[¬i ]xF HP2y8 ]Ahe  ݔLj'L3 ; E4hTbbhnY~ ] M ]A\Gt x ]);ZN$_@hDzj|<h.Tl yH X " 8.Ӭ7q>ژEMt8aPjq|BP h ]D ]̈]_,;+7=I(UDbn" ppE޸) ] Xw+$M$@LX b @qxЬs| {pDlQ@ ) iH/z6 iXKGXla3o~` i\ ,  m` mdf`|T$ b0<)24=8pHHZG bm +xzPOt9 m  Ɉp m3 np! ֜p)#t0|>dO^ nh n(sT@X} }p1h 4 #q-(L5u@ P(dw n4 nT nPt$l    & 3L@ ;6 I R eɌ p  |\   D H 4 1 &D $  C xx 0 b  # +_, 4 ?D Q- a )h j` xD J| p | \ NT "  7| lx  n   & 2x B M8 X ` n ml w n  Ȁ    N l h B@ q h ( h  $,L /cd 9 o @fX S ^T o} }x  O t  4 o    F`  o     #N +FP 8_kbd_serial_nfs_readlinkrpc_log_copyin_sdioctl_scsi_scsi_cmd_pfkey_sysctl_ipllog_addlog_ccdlock_proc_trampoline_isbad_dmmax_ffs_oldfscompat_ipintr_ncr5380_pio_out_nv3tov_type_nfsm_srvpostopattr_nfs_iodwant_iplcrc_doforce_vndread_mtty_ca_iommu_attach_cdevvp_remrunqueue_cd9660_vfsops_nswbuf_max_sw_3_leftover_getproplen_kernel_iopte_table_pa_db_hangman_kmem_object_timerok_vm_map_entry_unwire_ffs_fifoop_p_spec_ebadf_ttychars_doshutdownhooks_mtty_cd_isp_cd_cold_msgs_cd9660_readlink_htonl_bsd_to_svr4_sig_reginval_ctx_free_kbd_repeat_dayyr_nfsspec_read_nfs_getnickauth_fix_outcksum_userconf_maxlocnames_sys_shmget_spec_read_db_lastsym_lebuffer_ca_write_all_windows_sd_get_parms_cd_get_parms_cdlock_devctty_sunos_sys_reboot_union_write_devopn_sys_rfork_iso_uiodir_isohash_dvma_mapin_xdc_error_ieattach_fdcattach_nfsspec_close_spec_close_isp_attach_lebuffer_cd_buf_bootstrap_getidprom_fdprint_iplopen_bgetvp_rcons_esc_fsrtoname_swap_pager_maxcluster_nfsd_head_flag_sys_revoke_db_cmd_loop_done_qecprint_in_pcbdetach_in_pcbconnect_zeroin_addr_msdosfs_symlink_procfs_symlink_vndsize_audiowrite_htons_arp_allocated_fdesc_setattr_ccpu_le_ca_ttydebug_si_debug_cdioctl_cpu_model_vm_map_protect_getfp_scsi_test_unit_ready_eeprom_uio_ffs_reallocblks_nfsnodehashtbl_blf_dec_ap_fixseqack_fr_pass_msdosfs_reallocblks_vmmeter_nprocs_cgtwoclose_scanjet_trigger_scanner_mustek_trigger_scanner_mfs_close_nfs_readdirplusrpc_send_reset_unp_detach_ttyclose_le_cd_scsibusattach_vm_map_submap_catq_ffree_fork1_sw_1_leftover_timerreg_4m_userconf_common_dev_iso_shipdir_MD5Update_bootlshldi3.o_sunos_sys_uname_rcons_invert_sbus_establish_mountroot_hook_establish_softdep_setup_directory_change_vmapbuf_shutdownhook_establish_mbpp_recv_mbpp_send_mmu_reservemon4m_vm_page_deactivate_ahstat_kernfs_print_fdesc_statfs_needbuffer_spec_strategy_VOP_BLKATOFF_cnrom_vm_map_clean_VOP_READ_cnputc_viking_cache_flush_srmmu_cache_flush_ms1_cache_flush_kernel_object_store_mfs_rootsize_fr_findgroup_vnode_free_list_m_copym_pipeinit_vattr_null_sys_setgid_sys_umask_db_last_symtab_cons_fr_check_getsock_bdevsw_acct_process_sys_readv_vop_symlink_desc_vop_fsync_descmax.o_cexp_tcptv_keep_init_unp_scan_intstack_cons_ocount_encode_comp_t_vop_ioctl_desc_nswdev_getsn_isofntrans_ccd_softc_svr4_find_socket_svr4_sys_context_getpropint_regyear_vnode_pager_umount_soo_write_compat_43_sys_quota_vop_lock_desc_cnstop_sys_munlock_cd9660_unlock_db_boot_crash_cmd_bootpath_store_RMD160Final.rem_ffs_realloccg_writedisklabel_ukioctl_scsi_free_xs_sys_settimeofday_cd9660_ihash_slock_am7990_shutdownmin.o_mttyread_fpu_compare_cgfourteenmmap_softdep_setup_allocdirect_gettdb_VOP_SEEK_maxvfsconf_semlock_randompid_exec_elf_fixup_db_listwatch_cmd_pv_unlink4_4c_vm_pager_cluster_blf_enc_msdosfs_lookup_adler32_fdesc_allocvp_kinfo_vgetfailed_sysctl_file_sys_getgroups_bdevvp___adddi3_ufsfifo_write_rtrequest_slstart_tablefull_tickdelta_cd9660_reclaim_region_freelist_msselect_vfs_unmountall_fill_eproc_sys_seteuid_compat_43_sys_stat_ccdinit_compat_10_sys_semsys_fr_tcptimeout_ips_num_net_sysctl_sys_wait4.urem_db_put_value_mmusegments_umapfs_vptofh_devin_groupmember_devio_VOP_ADVLOCK_sys_semop_eintstack_kbdwrite_vm_object_remove_from_pager_nfs_mknodrpc_blf_ecb_encrypt_ip_natsync_am7990_config_calltodo_svr4_sys_times_vm_pager_deallocate_nfsrv_statfs_sorflush_db_show_regs_vmel_ca_nptesg_zsabort_pager_sva_enosys_sys_ntp_adjtime_cd9660_getattr_cgfourteen_ca_vm_object_cache_clear_tcp_do_rfc1323_mrtstat_vop_mmap_desc_cd9660_unmount_ccddump_uiomove_copystr_fpu_implode_si_dma_alloc_arpt_down_vmel_cd_si_dma_free_beioctl_nfsbootdevname_spec_pathconf_cgfourteen_cdmemset.o_nfsrv_slpderef_devioc_addrmask_db_mult_expr_ptyattach_beintr_nswap_ip_natexpire_ipfr_nat_newfrag_bpf_allocbufs_userconf_common_attr_stty_start_esp_new_init_ttymalloc_compat_43_sys_gethostid_sys_getfsstat_check_console_vm_page_alloc_memory_npages_ipauth_null_reclaim_sys_nanosleep_ccdstart_audio_free_ring_cache_alias_dist_cddump_cd_read_subchannel_findroot_getprop_pmap_pageable_nqnfsrv_getlease_fae_list_umapfs_init_reassignbuf_pfctlinput_inetdomain_mb_map_kthread_q_db_strcpy_cddkdriver_ipe4_init_pipe_close_acctp_svr4_sys_systeminfo_ccodes_cnwrite_fdwrite_bcopy_pmap_stats_ipaddr_lf_findoverlap_sysctl__string_sendsig_db_unary_copyout_xyc_cmd_ipopts_ipport_hilastauto_kernfs_symlink_sbflush_ccddevs_switchexit_espattach_sys_obreak_cddone_vm_pager_unmap_pages_ufs_mkdir_umap_bug_bypass_fdesc_badop_ttyflushmuldi3.o_be_tcvr_idle_ncr53c9x_readregs_mttyclose_kernfs_pathconf_donice_semexit_fifo_pathconf_msqids_time_adj_rdioctl_doscheckpath_union_revoke_spec_advlock_vndclose.mul_bsd_to_svr4_termios_svr4_sys_uname_ev_read_intr_establish_vmeintr_establish_ext2fs_fifoop_p_ipfr_nat_knownfrag_ipfr_knownfrag_compat_43_sys_wait_emul_native_db_panic_chainlength_union_abortop_kernfs_write_sysctl_struct_sys_mincore_svr4_sys_statvfs_pmap_rmu4m_pmap_collect_mbufchainlen_acctresume.div_seminfo_ffs_clusteracct_union_start_ttylclose___divdi3_extent_free_calcrulshrdi3.o_xformswNXFORMSW_iplinit_procfs_dostatus_VOP_LOCK_safepri_vndclear_sdmatch_esp_new_hash_mi_switch_seminit_mclrefcnt_kbdselect_ufsfifo_read_dead_badop_VOP_LINKnotdi2.o_scsi_execute_xs_fr_flags_bdirty_ostype_VOP_CLOSE_xywrite_portal_statfs_vm_deallocate_finishdup_sys_nfssvc_sys_vfork_vm_pages_reserved_db_examinesaveregs.o_unp_gcing_dosdirtemplate_enodev_mbpp_hztoms_me_alloc_doreallocblks_si_obio_intr_off_ipacct_unp_shutdown_xycattach_hme_meminit_be_tcvr_init_ufs_mknod_process_read_fpregs_iftovt_tab_pv_unlink4m_nfs_update_fc_lookup_sys_setlogin_amd7930_halt_output_vm_page_queue_free_lock_ah_new_init_esp_old_output_ipflog_sys_ovadvise_audio_init_play_sunos_sys_exportfs_link_rtrequest_dead_ioctl_sc_print_addr_sunos_sys_stat_ststrategy_sys_fchflags_extent_print_all_db_radix_write_user_windows_cnrint_kernel_pmap_store_readbuffers_nat_outlookup_union_readdir_ipintrq___muldi3_kthread_create_db_extent_print_cmd_cdmatch_getcacheinfo_obp_compat_10_sys_shmsys_ipfr_fastroute_evcnt_attach_pmap_is_referenced4m_qsphy_service_iommu_remove_ext2fs_access_ufs_remove_igmp_fasttimo_mswrite_sys_shmat_db_value_of_name_cnread_fdread_vm_bootstrap_steal_memory_null_getattr_mbpp_timeout_nat_lookupmapip_timeout_svr4_sys_execve_pmap_page_protect4_4c_ippr_ftp_portmsg_getdevvp_unp_defer_logsoftc_compat_43_sys_recv_compat_43_sys_send_sys_execve_spec_bmap_kbd_reset_tcxopen_prtrealloc_rn_inithead_union_print_ipcperm_db_map_addr_mbpp_mstohz_VOP_INACTIVE_sbappend_trapsignal_union_remove_newhashinit_sys_shmdt_sys_rmdir_rtable_init_rcons_cursor_qeioctl_zsioctl_ttyinput_vsprintf_ienab_bic_4m_pmap_copy_page4m_ufsspec_read_icmpmask_bridgectl_null_lock_filedesc0_spec_open_vop_getattr_desc_bpfilterattach_scsidebug_level_oclk_set_secs_ip_sysctl_in_pcbhashlookup_VOP_MMAP_getblk_time_offset_stackdump_roundrobin_cpu_startup_svr4_sys_xstat_fdsize_ufs_ioctl_ah_new_hash_unp_mark_sys_fstatfs_cfdata_mttystop_cnselect_ufs_rename_des_ecb_encrypt_msdosfs_vnodeop_p_procfs_vnodeop_p_rootvnode_ufs_symlink_pdevinit_cgthreeioctl_fd_mountroot_hook_vm_object_overlay_union_vn_close_msread_postsig_svr4_sys_sysarch_vm_pager_get_pages_ifa_ifwithdstaddr_socantrcvmore_pipespace_sys_sysarch_sched_sync_VOP_BMAP_svr4_sys_sigsuspend_beeint_ptcwrite_sys_sigsuspend_start_pagedaemon_ccdopen_ssattach_sd_switch_union_rename_sbppwrite_ipfr_newfrag_ttclosgetsn.o_cache_alias_bits_xdc_startbuf_findzs_ipfgroups_ttyunblock_sys_setgroups_bounds_check_with_label_db_printf_vm_pageout_scan_process_sstep_VOP_OPEN_pppattach_getptesw4m_zshardscope_umapfs_vget_vm_map_pageable_ptytty_execsigs_checkreplaywindow32_vfs_getvfs_pidhashtbl_mixer_open_db_map_print_cmd_eeprom_ca_spifstcintr_cdopen_scsi_do_ioctl_sys_recvfrom_matchbyname_nfs_sillyrename_procfs_vfsops_tk_nin_nfssvc_sockhead_flag_sys_mkfifo_eeprom_cd_vm_page_free_reserved_in_pcbinit_intrnames_sbus_print_esp_new_input_svr4_sys_auditsys_mttytty_si_obio_dma_eop_union_rmdir_null_bug_bypass_vflushbuf_selscan_mustek_special_fr_addstate_extent_find_elf_load_psection.umul_vmeintr_vm_map_entry_create_tcp_ctloutput_ip_ctloutput_spechash_slock_spifsoftintr_mttyopen_vmeints_dfltpagerops_fr_newauth_physmem.udiv_vndopenucmpdi2.o_kbd_softc_pmap_prefer_compat_43_sys_sethostid_svr4_termio_to_termios_qe_put_qec_reset_mii_print_encrtrequest_bridge_input_union_reclaim_vop_valloc_desc_pagemove_rcons_insertline_timermatch_nullfs_fhtovp_soo_stat_bt_getcmap_ufs_select_region_lru_ttymodem_cgtwoioctl_mfs_ioctl_rip_input_ufs_islocked_nfsrv_dorec_vop_readdir_desc___anddi3_module_hypersparc_skipjack_backwards_udbhashsize_ttopen_svr4_sys_pause_winChkName_umapfs_root_vop_strategy_vp_offsets_vop_reclaim_vp_offsets_vop_readlink_vp_offsets_vop_symlink_vp_offsets_vop_rename_vp_offsets_vop_link_vp_offsets_vop_fsync_vp_offsets_db_read_bytes_state_regs_vm_map_delete_vm_object_collapse_vm_page_copy_tun_ioctl_ifa_ifwithaddr_union_getattr_dead_bmap_soqinsque_vfsinit_cd9660_ioctl_seginval_si_options_vm_pageout_page_ip_setmoptions_union_select_union_unmount_unp_drop_nfs_cltpsock_bridge_rtlookup_dehashtbl_compat_43_sys_sigstack_svr4_syscallnames_qsphy_status_vm_alloc_lock_vfs_opv_init_default_db_show_cmds_endtrapcode_rcons_insertchar_xdread_amd7930_set_params_st_switch_eeprom_attach_ip_mforward_rtalloc2_detrunc_sys_getpriority_pmap_clear_reference4_4c_promvecdat_pmap_enter_p_ext2fs_balloc_fragtbl124_ffs_update_nfsrvw_coalesce_hostname_db_check_interrupt_compat_09_sys_uname_nfs_quotactl_nullfs_quotactl_dead_open_rtalloc1_exec_maxhdrsz_sdstrategy_ext2fs_fhtovp_nfs_invaldir_ipl_enable_ether_ifattach_am7990_ioctlstrncpy.o_svr4_termios_to_termio_sdclose_auxio_reg_kmem_object_store_ufs_ihashlookup_userconf_cmds_userconf_base_findnode_getnewvnode_get_random_bytes_iplread_numvnodes_lkmdispatch_xydkdriver_cd_play_big_ffs_specop_p_vop_generic_islocked_cluster_collectbufs_ienab_bic_si_obio_intr_on_umapfs_start_au_set_port_db_continue_cmd_vmes_ca_qsphymatch_sbdroprecord_audio_calcwater_eintrnames_mrh_list_ev_init_xdsize_nfsrv_fhtovp_lease_check_shm_committed_vmes_cd_pmap_protect4_4c_pmap_dumpsize_nfssvc_addsock_eeprom_va_vm_page_queue_free_vm_page_zero_fill_krpc_call_cd_play_msf___ashldi3_shutdownhooks_done_ssread_ext2fs_checkpath_nfs_getattrcache_nfs_getreq_nfs_loadattrcache_tcp_respond_selwait_sys_lchown_xyc_startbuf_softdep_setup_remove_getnewbuf_sysctl_string_sys_getsockopt_ncr5380_pio_in_db_inputchar_tcp_keepintvl_check_ipsec_policy_hypersparc_get_fltstatus_cypress_get_fltstatus_turbosparc_get_fltstatus_swift_get_fltstatus_ms1_get_fltstatus_viking_get_fltstatus_srmmu_get_fltstatus_vndattach_kernel_text_cdclose_oclk_get_dt_xdr_string_encode_udpstat_semundo_adjust_cpu_exit_xyc_rqinit_sunos_sys_fstatfs_vm_page_free_bridge_ioctl_ccdunlock_ffs_vnodeop_p_nfsfifo_read_dead_lock_fifo_read_rominterpret_optionsnode_fb_setsize_lebufprint_tcp_debug_msdosfs_remove_domains_geteblk_ienab_bis_magma_match_oclockmatch_nfs_receive_vop_whiteout_vp_offsets_vop_read_vp_offsets_vop_setattr_vp_offsets_vop_getattr_vp_offsets_vop_mknod_vp_offsets_vop_islocked_vp_offsets_socketops_ktrsetchildren_vop_create_desc_tcp_close_ip_rtaddr_kernel_map_pfkeyv2_acquire_tcp_setpersist_multicast_encap_iphdr_vop_pathconf_desc_qematch_bt2pmt_vm_object_set_shadow_vm_map_simplify_tcp_template_rtstat_ccdmakedisklabel_tsleep_audiosetinfo_nsphy_status_fd_motor_on_ip_mrouter_set_seltrue_svr4_term_ioctl_mustek_set_params_cd_switch_union_vfsops_cluster_callback_vndiodonebcd.o_vslock_qec_translate_stread_ufs_quotactl_shutdownhook_disestablish_callrom_umap_inactive_portal_inactive_fifo_print_vn_writechk_allevents_sominconn_vunmapbuf_vop_inactive_desc_vop_seek_desc_xdc_ca_sunos_sys_sigvec_xdattach_in_pcbbind_VOP_REALLOCBLKS_soreserve_cttyselect_userconf_common_attr_val_cpu_conf_nfs_readdir_nfsrvhashtbl_db_get_value_xdc_cd_mttyioctl_ukclose_nfs_removeit_ureadc_nqnfsrv_vacated_ip_protox_igmp_leavegroup_msdosfs_rename_umap_vnodeop_p_portal_vnodeop_p_amd7930_get_port_nat_stats_dead_lookup_sltioctl_tbtioctl_vndioctl_ccdread_buffer_map_vm_page_queue_lock_puttdb_in_cksum_vm_map_check_protection_chrtoblk_strcat_dkcksum_pgofset_spifppcintr_cpu_fork_MD5Final_ah_new_input_rtalloc_noclone_userconf_help_hostnamelen_cgthree_ca___subdi3_netaddr_match_sunos_sys_sysconf_me_free_mfs_mount_averunnable_scsi_do_safeioctl_tdb_init_sowakeup_cgthree_cd_rt_missmsg_tk_cancc_iplused_sys_quotactl_cache_enter_db_command_svr4_setcontext_vop_balloc_desc_cd9660_mount_mmu_reservemon4_4c_ms_serial_ufs_unlock_rpc_msgdenied_userconf_number_db_cmd_search_rwindow_save_union_diruncache_kmemlimit_ccdsize_intrhandmoddi3.o_Blowfish_decipher_icmpbmcastecho_in_rtchange_nullfs_inithtonl.o_vm_object_print_pmap_change_wiring_ufsspec_close_esp_old_xform_ap_proxies_clrbits_kthread_exit_vnddump__vm_object_print_strcmp_swap_pager_inuse_ffs_isfreeblock_nfsrv_commit_msdosfs_islocked_ev_fini_vm_map_lookup_entry_nfs_access_sbinsertoob_ncr5380_reset_scsibus_vop_bwrite_vp_offsets_vop_update_vp_offsets_vop_truncate_vp_offsets_vop_advlock_vp_offsets_vop_unlock_vp_offsets_vop_lock_vp_offsets_vop_write_vp_offsets_vop_access_vp_offsets_vop_create_vp_offsets_sys_omsync_db_symbol_values_X_db_symbol_values_nswitchexit_pmap_enter4m_fr_auth_ioctl_union_unlock_union_freevp_umapfs_sync_ptsclose_sys_futimes_vn_close_ip_getmoptions_MPFail_soo_read_vop_abortop_desc_m_freem_amd7930_commit_settings_chquirks_ipfr_fragstats_cpu_sysctl_exec_aout_prep_omagic_vm_object_setpager_deupdat_vm_mem_init_espmatch_pfkeyv2_init_nfsd_waiting_resetpriority_sys_setpriority_isp_sbus_ca_callfree_vm_page_count_ipfilter_bpfselect_cd9660_rrip_analyze_xyc_start_cd_get_modescanc.o_tcp_output_rt_maskedcopy_devwait_sosetopt_scsi_probedev_sys_listen_raster_op_noclip_sun4_cache_flush_vm_set_page_size_ipf_ftp_atoi_msdosfs_select_kernel_iopte_table_ext2fs_readdir_find_global_flow_null_open_strlen_db_flush_line_ch_usergetelemstatus_unp_bind_userconf_more_config_rootsearch_strcpy_parsedisk_ext2fs_specop_p_viftable_in_pcballoc_uniqdosname_vfsconf_userconf_list_userconf_init_setsigvec_cd9660_vnodeop_p_tickadj_rdclose_unp_ino_time_phase_vm_page_free_min_min_tunctl_dos2unixfn_hmeioctl_nfs_null_nfs_readdirrpc_reserve_spi_mrt_ioctl_unix2dosfn_dosetrlimit_filehead_db_flush_lex_ether_sprintf_callout_svr4_sys_fstatvfs_si_dma_intr_timo_qe_get_module_turbosparc_vm_pager_clusternull_esp_old_init_ktrcanset_vop_lookup_desc_ext2fs_dirremove_pppasyncstart_si_vme_intr_off_ufs_ihash_slock_fr_authstart_pppfcs_arc4_init_au_check_ports_ddb_init_vm_page_free_min_max_ufs_checkpath_nfs_bmap_nfs_udpsock_route_usrreq_ppptioctl_compat_43_sys_getkerninfo_isp_restart_nfsfifo_write_sl_compress_tcp_union_inactive_fifo_write_nfs_reclaim_enterpgrp_inferior_whichqs_magma_hard_sttytty_stwrite_scsi_probe_busses_swread_fr_icmptimeout_userconf_attr_tickfix_ms_softc_bewatchdog_fr_auth_msdosfs_readdir_procfs_readdir_module_sun4_mrtdebug_pfslowtimo_suword_stty_param_waittime_hmeattach_qe_rint_vm_object_page_clean_mfs_vnodeop_p_nfs_open_freeclusterchain_sync_vnodeop_p_mfs_vfsops_filedescopen_nfsrv_initcache_nfsrv3_access_ipfr_stats_bpf_reset_d_sb_max_dupfdopen_savacctp_sys_semconfig_sunos_sys_nfssvc_svr4_sys_acl_pv_table_vop_readdir_vp_offsets_vop_rmdir_vp_offsets_vop_mkdir_vp_offsets_vop_ioctl_vp_offsets_etherbroadcastaddr_compat_09_sys_setdomainname_compat_09_sys_getdomainname_fr_authstats_tprintf_close_pgsignal_ncr53c9x_scsi_reset_ienab_bis_4m_nfs_getattr_inet_ntoa4_needqueuedrain_nwindows_soft01intr_cnpollc_nfs_unmount_nfs_realign_inet_ntoa_nullfs_unmount_Blowfish_expand0state_igmp_joingroup_socreate_db_watchpoint_cmd_eintrcnt_mmu_pagein_ch_get_params_VOP_TRUNCATE_fdshare_exec_aout_prep_nmagic_sttyread_softdep_sync_metadata_nqtimerhead_ah_new_attach_umap_lock_vm_page_wire_vm_map_lookup_done_memreg_ca_xyc_rqtopb_nfs_renameit_ppppktin_scsibusprint_mii_media_from_bmcr_mfs_reclaim_compat_43_sys_sigvec_ncr53c9x_msgin_fragtbl8_nfs_readrpc_inflate_ktrwrite_db_look_token_memreg_cd_cgtwogetcmap_fbconstty_fr_authused_db_print_cmd_db_object_print_cmd_cgfour_ca_svr4_esigcode_esigcode_dmaprint_st_mode_sense_pmap_extract_p_nfssvc_iod_proc_reparent_compat_43_sys_recvfrom_vop_rename_desc_timerblurb___bcd2bin_sd_patterns_cd_patterns_doclusterread_dead_vnodeop_p_msdosfs_vfsops_osversion_nfsv2_vnodeop_p_kernfs_access_pffindproto_ncr53c9x_debug_cgfour_cd_fpu_execute_scsi_start_cpu_spinup_userconf_change_audio_silence_copyout_sunos_sys_getrlimit_svr4_sys_getrlimit_swfree_cast_decrypt_rn_delete_sys_getrlimit_compat_43_sys_getrlimit_randomclose_sprintf_sunos_sys_auditsys_qec_fix_range_srmmu_vcache_flush_page_sun4_vcache_flush_page_fragtbl_ah_old_init_ttyrub_sys_lkmnosys_sunos_sys_execve_pmap_writetext_igmp_timers_are_running_db_find_breakpoint_subyte_xdc_perror_ip_forward_nullfs_mount_pppread_cgtwo_ca_xyc_piodriver_ssopen_rtredirect_audioattach_db_putnchars___xordi3_mtty_start_fd_dev_to_type_ufs_bmaparray_db_last_command_ipe4_output_cgtwo_cd_cgthreeclose_ext2fs_reclaim_nfs_decode_args_nfs_fhtovp_ip_mrouter_get_bufqueues_userconf_pnum_ie_hardware_names_union_mkwhiteout_vm_map_copy_entry_ext2fs_fifoop_entries_ffs_fifoop_entries_nullfs_vget_cd9660_fifoop_entries_iereset_hmeintr_vm_object_collapse_internal_frflush_tcp_debx_stathz_isp_reset_ss_switch_nfs_getauth_ipq_locked_fdesc_vnodeop_p_strncasecmp_spec_vnodeop_p_bppopen_tcp_maxpersistidle_tunwrite_sysent_vm_page_hash_mask_softdep_freefile_nqsrv_waitfor_expiry_lastdtime_vop_vfree_vp_offsets_vop_revoke_vp_offsets_vop_lease_vp_offsets_vop_close_vp_offsets_ptsopen_vn_open_srmmu_vcache_flush_context_sun4_vcache_flush_context_chiptotime_rtinit_unp_connect2_cd9660_tstamp_conv7_ttcompatsetflags_ext2fs_getattr_rtfree_par_err_reg_ext2fs_unmount_fdcresult_power_reg_sys_minherit_nswitchdiff_fpu_newnan_scanjet_set_params_nfs_close_nfsrv_readdirplus_nfs_doio_char_type_qe_read_timetochip_cttyread_config_attach_xdopen_counterreg_4m_ah_old_hash_userconf_pdev_vprint_fdcretry_module_swift_qtable_hmeinit_cdstrategy_msdosfs_unlock_msdosfs_reclaim_procfs_reclaim_printf_userconf_cmdbufbcmp.o_fr_tcp_age_fc_largedistance_kernfs_readdir_time_maxerror_MD5Initmul.o_scsi_change_def_nqnfsstarttime_ap_check_userconf_show_db_symbol_is_ambiguous_db_disasm_ch_patterns_ipl_frouteok_null_vnodeop_p_ttread_db_watchpoints_inserted_db_breakpoints_inserted_cpu_switch_ip_flush_b_to_q_somaxconn_cd1400_write_reg_svr4_sys_fxstat_nqsrv_writeslack_portal_open_swapin_tprintf_open_qe_tint_ledmaintr_espdma_reset_nullfs_root_vfs_busy_cd9660_symlink_vfinddev_scanjet_compute_sizes_mustek_compute_sizes_ufs_dirremove_nfsrv_cleancache_nat_icmpinlookup_msdosfs_unmount_procfs_unmount_vm_mmap_db_next_free_breakpoint_node_has_property_pmap_is_referenced_p_vm_page_alloc_nqsrv_clockskew_savefpstate_svr4_sys_sigprocmask_sys_undelete_sys_sigprocmask_magma_soft_fb_pfour_get_video_vmspace_fork_nfs_adv_fr_defnatage_raw_attach_clusteralloc_useracc_profhz_vop_print_desc_vn_lock_sunos_exec_aout_makecmds_nfs_nget_routedomain_tk_nout_cpu_exec_aout_makecmds_exec_aout_makecmds_obio_ca_sl_uncompress_tcp_cd9660_inactiveulmax.o___builtin_saveregs_ststart_nfs_connect_cd9660_close_page_mask_curproc_db_qualify_ambiguous_names_cfroots_size_obio_cd_amd7930_query_encoding_hmematch_ext2fs_specop_entries_ext2fs_vnodeop_entries_mfs_vnodeop_entries_ffs_specop_entries_ffs_vnodeop_entries_fifo_nfsv2nodeop_entries_spec_nfsv2nodeop_entries_nfsv2_vnodeop_entries_msdosfs_vnodeop_entries_union_vnodeop_entries_umap_vnodeop_entries_spec_vnodeop_entries_procfs_vnodeop_entries_portal_vnodeop_entries_null_vnodeop_entries_kernfs_vnodeop_entries_fifo_vnodeop_entries_fdesc_vnodeop_entries_dead_vnodeop_entries_sync_vnodeop_entries_ttyretype_nfs_init_cd9660_specop_entries_cd9660_vnodeop_entries_mclfree_initfpstate_scsi_decode_sense_extent_create_ext2fs_vnodeop_p_nfsrv_getstream_clusterfree_kernfs_vnodeop_p_fifo_vnodeop_p_au_portof_amd7930_get_props_kentry_data_size_msdosfs_rmdir_nextvnodeidxordi3.o_vop_blkatoff_vp_offsets_vop_pathconf_vp_offsets_vop_bmap_vp_offsets_vop_abortop_vp_offsets_vop_mmap_vp_offsets_vop_select_vp_offsets_vop_lookup_vp_offsets_cd9660_lookup_ncr53c9x_msgout_ncr53c9x_get_ecb_vm_coredumpulmin.o_dumpsys_amd7930_close_ledattach_nfs_msg_tcp_drain_swapdev_vp_cd9660_fhtovp_dumpsize_bpf_filter_db_active_avail_start_vm_pages_needed_kmem_map_nchstats_itimerdecr_vmspace0_region_locked_nfs_commit_frcache_time_state_pfkeyv2_cleanup_nfsrv_mkdir_ipfr_forget_portal_link_clockfreq_tcp_disconnect_procfs_statfs_userconf_disable_vm_fork_cd9660_tstamp_conv17_ccdstrategymd5.o_fd_motor_off_ufs_whiteout_audio_attach_mi_db_symtablen_X_db_symtablen_susword_stdump_ffs_init_process_read_regs_bswlist_mustek_minphys_umax_uc630_sw_ip_mrouter_ip_defttl_au_set_gain_oldmon_w_trace_swift_hotfix_nfsrv_setcred_tcp_init_am7990_reset_sttystop_bucket_lock_in_setsockaddr_sysctl_rtable_vop_mkdir_desc___ashrdi3_fuibyte_esp_write_reg_scsi_inqmatch_nqfhhash_procfs_start_user_config_vm_fault_unwire_nfs_hash_rttrash_domainname_vmcmd_map_zero_db_delete_nfsrv_setattr_nfs_request_msdosfs_getattr_procfs_getattr_ncr53c9x_abort_ether_ioctl_bpfattach_vm_object_cached_tbattach_slattach_nfs_flush_db_delete_temp_breakpoint_db_set_temp_breakpoint_ffs_alloc_nfs_false_xdr_string_decode_rip_ctloutput_time_reftime_rqinit_ext2fs_create_osrelease_vndshutdown_ffs_balloc_fr_checkstate_sunos_sys_quotactl_sunos_sys_setsockopt_mbppclose_cgeightclose_lf_advlock_sys_setsockopt_pmap_extract4m_pmap_is_referenced4_4c_setpte4m_fdcpseudointr_ffs_fhtovp_tunread_kernfs_reclaim_vn_ioctl_db_write_variable_ncallout_ss_set_window_nfs_link_nfsrv_mknod_vttoif_tab_sys_chroot_sys_getpid_ufs_readdir_nfssvc_nfsd_fdcloseexec_avail_end_numdquot_nfs_fsync_domaininit_cd9660_ihashrem_reserve_dumppages_lehwinit_ledmatch_rt_ifmsg_pppstart_svr4_sysent_tcp_drop_sys_getsid_clockmatch_find_flow_vop_reallocblks_vp_offsets_vop_balloc_vp_offsets_vop_valloc_vp_offsets_vop_inactive_vp_offsets_vop_remove_vp_offsets_vop_seek_vp_offsets_tty_init_am7990_gethtons.o_sunos_sys_setrlimit_svr4_sys_setrlimit_fdc_reset_swwrite_nfs_bufq_sys_setrlimit_compat_43_sys_setrlimit_elf_check_brand_fr_tcpclosewait_kernfs_getattr_dumpdev_fr_stateunload_kernfs_unmount_nchrdev_vop_select_desc_ledmamatch_procfs_rw_sttyopen_bwtwoopen_krpc_portmap_ksymsattach_rcons_pctrl_bppclose_cgfourioctl_bt_putcmap_umapfs_quotactl_suid_clear_sys_getuid_exec_script_makecmds_dumpmag_sbus_match_fd_do_eject_ip_output_ppp_softc_socantsendmore_ttcompat_nfs_disconnect_m_copyback_procfs_print_nfs_savenickauth_autoconf_nzs_esp_old_zeroize_ah_old_zeroize_fdesc_select_st_check_eod_ch_getelemstatus_am7990_put_xddump_vmspace_free_ip_init_icmp_send_union_vnodeop_p_portal_badop_vop_rmdir_desc_audio_alloc_ringimax.o_in_ifscrubbpendsleep_sys_ftruncate_compat_43_sys_ftruncate_db_end_line_ah_new_output_if_attachhead_config_detach_children_ippr_ftp_init_nullfs_sync_session0_db_show_all_procs_ccdattach_clockintr_nfs_mkdir_union_dircache_db_delete_breakpoint_swapout_threads_vm_pager_map_pages_ttspeedtab_process_set_pc_uihashtbl_cd9660_blkatoff_clockreg_fr_authsize_VOP_UPDATE_xdc_piodriver_qecattach_nfsv3_procid_arp_intimer_cd1400_write_ccr_priv_regs_vm_object_deactivate_pages_nfs_mmapimin.o_svr4_getcontext_pmap_pa_exists_nfs_advlock_vnd_softc_svr4_fil_ioctl_be_mcreset_ffs_reclaim_userconf_add_read_rndstats_mustek_read_si_get_ipflog_read_unpdg_recvspace_unpdg_sendspace_sb_lock_ttyout_compat_43_sys_getsockname_sys_getsockname_cd9660_ihashinsstrncmp.o_softdep_change_directoryentry_offset_nfs_vgetashrdi3.o_xdc_rqinit_esp_dev_ffs_fsync_checkdirs_sys_madvise_svr4_sys_getdents_pfkey_unregister_kinfo_vdebug_vfs_unregister_ccdiodone_ttcompatsetlflags_scsi_probe_bus_dos2unixtime_m_copydata_sys_accept_strncpy_svr4_sys_access_ss_gen_quirks_vm_pager_lookup_fr_authpkts_arcbroadcastaddr_vop_print_vp_offsets_vop_open_vp_offsets_sys_access_disk_init_db_line_at_pc_db_map_equal_X_db_line_at_pc_revarpwhoarewe_nfs_reqq_rcons_scroll_Blowfish_stream2word_icmp_error_ip_drain_svr4_to_bsd_sigset_dt_to_gmt_ffs_unmount_mfchash_ip_freemoptions_ppp_deflate_draft_dead_select_userconf_device_sysctl_clockrate_svr4_to_bsd_sigaction_pmap_changeprot4m_console_font_module_sun4c_object_collapses_disk_busy_db_print_loc_and_inst_isp_control_prom_vstart_fb_pfour_set_video_nfs_mknod_esp_new_attach_cttyopen_nfs_removerpc_nfsrv_access___hex2ascii_pmap_map_sttywrite_fpu_add_ufs_reclaim_umapfs_fhtovp_m_reclaim_randomioctl_ccdbuffer_pmap_redzone_scsistrategy_tcp_recvspace_tcp_sendspace_ifaof_ifpforaddr_ffs_vget_nfsrv_rmdir_db_boot_sync_cmd_max_hdr_union_create_vm_fault_vn_read_ptsread_stopen_st_patterns_sun4_hotfix_swdevt_nuidhash_max_sbrelease_stty_ca_bwtwo_ca_avail_next_xddkdriver_pmap_is_modified_p_mfs_pri_tcp_attach_fdesc_vfsops_kernel_segtable_store_lematch_vm_object_copy_ipflog_init_msdosfs_start_initproc_nfs_root_union_symlink_ttycheckoutq_stty_cd_bwtwo_cd_ffs_isblock_in_iawithaddr_portal_setattr_zombproc_db_delete_cmd_st_erase_tcp_dooptions_ip_dooptions_union_lock_cd9660_ihashget_speclisth_trapbase_has_iocache_sadb_exts_required_in_baddynamicports_lastddate_union_link_xyattach_vnodepagerops_nfsrvhash_masterpaddr_fr_defnaticmpage_bpf_detachd_pppopen_machine_suswintrntohl.oadddi3.o_ext2fs_advlock_encoutput_null_inactive_rminit_kmem_alloc_wait_db_console_setpgt4m_setuse_extendfile_sofree_rmfree_ktrsysret_nfs_readlink_nullmodem_userconf_enable_mmu_has_hole_nfs_bioread_nat_log_raw_ctlinput_sysctl_rdstring_kernacc_db_run_modeumoddi3.o_svr4_sys_getmsg_srmmu_vcache_flush_region_sun4_vcache_flush_region_nqsrv_locklease_icmp_input_tcp_input_config_detach_sys_dup_nfs_boot_init_vfs_mountedon_db_store_count_db_boot_dump_cmd_snapshot_mmu_install_tables_ssstart_nfs_send_VOP_READLINK_xydump_hmestop_explist_psratio_module_cypress_pmap_page_index_vwakeup_extent_alloc_subregion_gmt_to_dt_vm_pager_count_mountnfs_get_sa_require_bsd_to_svr4_sigaction_vm_first_phys_unavail_start_kmem_init_ihashtbl_get_flow_ipsec_in_use_ip_freef_fpu_mul_zsread_ip_frags_pppgetm_kmem_free_svr4_sock_ioctl_pmap_release_nfs_sndunlock_portal_pathconf_unp_rights_fpu_div_swap_pager_npendingio_tcp_notify_VOP_SYMLINK_pppwrite_fdexpand_db_look_chariordi3.o_cd_size_zsconsole_ext2fs_bmap_nat_new_arpinit_done_pt_softc_vn_rdwr_dvmamap_xyc_reset_esp_new_xform_raw_disconnect_rn_addmask_msdosfs_print_vgonel_sodisconnect_solisten_gsignal_nfs_rcvlock_fr_checkauth_umap_strategy_vfs_op_descs__randseed_fr_authnext_fillinusemap_ttywflush_am7990_copytobuf_contig_opennode_get_buffer_status_tcp_ident_igmp_input_raw_detach_sbwait_ext2fs_open_nfs_read_ext2fs_blkfree_nfsd_head_qe_eint_viscpy_portal_mount_vm_page_array_ufs_getattr_union_mmap_child_return_strncmp_esp_glue_nfs_sigintr_nat_inlookup_sysctl_tstring_sys_getgidntohs.o_SHA1Init_vfs_findname_db_fncall_ether_input_pv_link4_4c_vme_ca_ufs_getlbns_ext2fs_lookup_tregion_search_prom_busprint_mfs_statfs_db_find_breakpoint_here_scanjet_set_window_mii_submatch_vme_cd_ufs_readlink_bpf_movein_union_init_db_breakpoint_list_setquota_semid_n2o_db_breakpoint_free_untimeout_ffs_clrblock_rn_walktree_nselcoll_procfs_domem_ksymsclose_scsiprint_ffs_read_nfs_namei_ipe4_attachstart_esp_dma_stop_vm_page_insertbpendtsleep_pmap_changeprot_p_ledma_ca_fuiword_rushjob_audioamd_ca_procfs_doctl_portal_root_nchinit_lkmenodev_inittodr_deflateEnd_soqremque_db_max_line_ledma_cd_i7_softdep_initialize_nfs_create_sysctl_rdstruct_audioamd_cd_stty_modem_control_mtty_modem_control_vfs_shutdown_xdwrite_soisconnected_svr4_sys_hrtsys_obio_scan_vm_wait_fr_tcpsum_msdosfs_advlock_xdc_rqtopb_scanjet_ctl_read_msdosfs_statfs_cttywrite_vcount_vrecyclerem.o_timerattach_rip_recvspace_rip_sendspace_fdesc_readlink_unpst_recvspace_unpst_sendspace_ispscsicmd_viking_pcache_flush_line_srmmu_pcache_flush_line_sys_msgrcv_spec_select_ccdlookup_db_boot_cmds_vn_stat_mtty_param_nfs_lookitup_mbppioctl_cgeightioctl_pmap_copy_lf_setlock_handle_expirations_tcp_pulloutofband_nullfs_start_pv_changepte4_4c_cpumatch_turbosparc_nfs_sync_ttyprintf_lo_microtime_fc_bmapcalls_page_shift_db_set_breakpoint_u0_fpu_shr_ap_match_ifmedia_init_nfs_mount_ptsstop_config_make_softc_db_write_bytes_isp_uninitlmax.o_xyc_error_vm_fault_wire_nqsrv_cmpnam_db_deletewatch_cmdcmpdi2.o_sdread_sys_msgsnd_db_history_prev_openpromopen_tun_output_msdosfs_write_pmap_is_modified4m_lebufmatch_scsibussubmatch_vmel_scan_vm_page_alloc_memory_dev_pager_fakelist_ext2fs_readlink_union_strategy_rootvp_kbdattach_cg3_videoctrl_vm_page_bucket_count_vm_fault_copy_entry_ap_sess_tab_tunopen_tcp_canceltimers_hexatoi_emul_sunoslmin.o_xdcattach_rddkdriver_des_ecb3_encrypt_svr4_sys_memcntl_bppioctl_bwtwommap_nullioctl_ttioctl_scsibusmatch_nfs_prog_Blowfish_initstate_max_keylen_svr4_sys_msgsys_ffs_sync_MCFail_clock_ca_xyopen_xyc_unbusy_nfs_ticks_ip_optcopy_umapfs_unmount_cluster_rbuild_dvma_end_sdsize_ext2fs_makeinode_ip_natin_rn_refines_VOP_UNLOCK_kvm_iocache_sc_err1_clock_cd_SHA1Final_esp_old_input_extent_print_vndsetcred_svr4_to_bsd_sigaltstack_kdb_kbd_trap_soisdisconnected_vm_map_insert_ndflush_userconf_lines_audio_calc_blksize_setjmp_kdb_trap_pppintr_sys_readlink_copywords_bus_untmp_procfs_badop_sys_getrusage_db_load_count_am7990_zerobuf_contig_sparc_interrupt4m_ext2fs_init_qestop_zsstop_vm_map_create_tcp_slowtimo_ip_slowtimo_cansignal_acctsuspend_vm_num_phys_vm_object_init_nfs_sndlock_tcbtable_vm_object_list_cd_play_tracks_vm_object_pmap_copy_ip_nhops_union_lookup_vop_default_desc_pager_cache_esp_new_output_numcache_doingcache_vflush_srmmu_vcache_flush_segment_sun4_vcache_flush_segment_detach_devices_svr4_sys_sigaction_iestart_fdcstart_softdep_setup_freeblocks_sobind_sys_getdirentries_compat_43_sys_getdirentries_sys_sigaction_xdgetdisklabel_rdgetdisklabel_sdminphys_fdgetdisklabel_ffs_mount_nfsrv_updatecache_fr_tcplastack_z_errmsg_pmap_count_ptes_vop_vfree_desc_cd9660_mountroot_vndgetdisklabel_sttyclose_bwtwoclose_union_pathconf_umap_node_hash_fdesc_sync_kill_vmcmds_qsphyattach_m_zero_unputc_compat_43_sys_killpg_exec_elf_makecmds_db_show_all_cmds_pmap_virtual_space_ext2fs_checkoverlap_ffs_checkoverlap_nfs_true_arpresolve_sbappendrecord_mountlist_rdread_fdattach_nfs_vfree_arpintr_ppp_bsd_compress_msdosfs_readlink_procfs_readlink_mainbus_ca_svr4_sys_kill_xdc_cmd_usermount_sys_kill_vop_read_desc_ncr53c9x_reselect_svr4_sys_lxstat_ipsp_address_union_mkshadow_VOP_WHITEOUT_bufhashtbl_sunos_sys_getdents_pv_syncflags4_4c_lehwreset_nfs_nhinit_msdosfs_vptofh_vop_generic_lock_disk_find_mainbus_cd_fpu_explode_nfs_renamerpc_nfsv2_procid_union_bmap_sys_fchdir_wakeup_sunos_sys_ostime_dumpconf_cgfourclose_cast_encrypt_rootfs_vfs_export_lookup_db_sym_numargs_X_db_sym_numargs_cgsix_use_rasterconsole_vclean_copyright_nqsrv_maxnumlease_db_set_watchpoint_be_read_bpf_validate_pipe_stat_disk_unbusy_hw_sysctl_audio_mmap_audio_blk_ms_tcx_ca_union_open_kmem_alloc_sys_munmap_nblkdev_rdsize_quotaon_tcp_backoff_procfs_close_timedelta_hz_rpc_vers_xformsw_sys_link_tcx_cd_mtty_match_kbd_repeat_step_fpu_init_nfs_timer_fr_delgroup_ifqmaxlen_fpu_ftoi_ufs_root_udp_output_unp_disconnect_sys_msgget_fdcstate_db_watchpoint_list_db_print_format_svr4_sys_nice_ext2fs_link_dqflush_bpf_tap_ext2fs_fifoop_opv_desc_ffs_fifoop_opv_desc_sys_fchown_cd9660_fifoop_opv_desc_db_watchpoint_free_suibyte_fpu_ftod_be_tcvr_write_bit_memname_ttywait_qec_ca_mask_rnhead_segm_locked_getphysbuf_vfs_register_kernel_pagtable_store_kernel_regtable_store_sbppopen_ffs_blkfree_numnfsrvcache_bridge_stop_qec_cd_sunos_sys_sigpending_svr4_sys_sigpending_cleanup_expirations_killpg1_sys_sigpending_nfs_rephead_nfsm_reqh_fdesc_symlink_lockmgr_mii_anar_first_page_audio_open___bin2bcd_bsd_to_svr4_sigset_cgsixioctl_sd_reassign_blocks_procfs_findtextvp_swapout_kern_targets_viking_hotfix_vfs_opv_init_explicit_soshutdown_slopen_tbopen_sys_shutdown_magma_attach_oclockattach_sys_ktrace_db_call_depth_db_add_expr__main.o_fpu_norm_tbconf_cd9660_access_fpu_ftox_avefree_nqnfs_piggy_in_pcbdisconnect_ienab_bic_4_4c_ffs_vfree_udp_init_raw_recvspace_raw_sendspace_initclocks_cd9660_strategy_rcons_doesc_fpu_dtof_statvar_pv_fdfinish_nfsrv_readdir_cd9660_start_cd_reset_pppdealloc_xdc_tick_scanjet_attach_invalhash_logopen_qs_sunos_sys_access_fr_authunload_tunselect_vfs_hang_addrlist_swapdev_db_trace_until_matching_cmd_kernel_object_tz_fpu_ftos_xyc_submit_iorq_cpu_coredump_sys_msgctl_locnamp_mmclose_rom_console_input_nfs_vinvalbuf_tbfdebug_winSlotCnt_sys_symlink_vm_init_limits_db_delete_watchpoint_nfs_setattr_free_msghdrs_Debugger_svr4_sys_mmap_stioctl_ext2fs_blkpref_ufs_makeinode_sys_mmap_sys_exit_in_interfaces_nfs_mountroot_ffs_mountroot_dk_mountroot_time_status_vfs_mountroot_am7990_start_chkdqchg_nfsrv_pathconf_nfsrv_write_ah_old_input_fr_state_ioctl_bridge_rtdelete_softdep_setup_allocindir_page_vn_initialize_syncerd_userconf_parse_curpriority_magma_ca_fusword_sw_2_leftover_ufs_advlock_nfs_lookup_vm_page_lookup_tb_pv_syncflags4m_nonidempotent_rpc_msgaccepted_copyinstr_udp_recvspace_udp_sendspace_magma_cd_nfsrv_fsinfo_sonewconn1_pipe_select_checkalias_am7990_copyfrombuf_contig_amd7930swintr_sdlock_ext2fs_vget_fdhashtbl_autoconf_verbose_kmem_alloc_pageable_des_encrypt2_in_pcbnotifyall_VOP_SELECT_pollscan_ncr53c9x_reset_promvec_pmap_init_tcp_mssdflt_lastday_randomattach_ncr53c9x_attach_xyc_ca_pmap_destroy_nfs_reply_SHA1Update_umap_bwrite_sttymatch_ffs_truncate_nfs_truncate_rip_usrreq_ptcopen_sys_omsgctl_db_eqname_in_pcbrehash_xyc_cd_svr4_sys_open_ufs_seek_nqnfs_clientd_sys_open_db_tok_number_loopattach_desiredvnodes_fs_sysctl_sys_mprotect_audiommap_svr4_sys_facl_xygetdisklabel_cdminphys_setdisklabel_ip4_input_bridge_bifconf_if_index_cd9660_pathconf_cd9660_print_pmap_next_page_nqsrv_addhost_union_removed_upper_db_history_size_vm_cache_max_sw_0_leftover_igmp_sendpkt_pgfind_disksort_rddump_ext2fs_dirrewrite_ufs_dirbadentry_tcpdropoldhalfopen_null_strategy_cpu_initclocks_sys_fork_semmap__insque_st_mode_select_vm_object_bypass_limfree_statclock_swapmap_vfs_export_fb_unblank_soisconnecting_free_msgmaps_time_esterror_in_socktrim_fdesc_root_dmaattach_fddkdriver_module_viking_vm_map_print_soaccept_bridgeattach_encattach_vm_object_terminate_nfs_rmdir_tty_count_kmem_suballoc_bpf_mtap_st_mount_tape_ch_get_quirks_vm_map_copy_icmp_reflect_lkmopen_sys_fchmod_spif_ca_utsname_nmbclusters_ttypend_vop_advlock_desc_microtime_configure_zsshortcuts_ext2fs_setattr_tcp_reass_sbreserve_audioopen_db_examine_format_db_set_cmd_sys_bind_ncr53c9x_scsi_cmd_spif_cd_cd_pause_ip_mrouter_done_db_history_curr_mmuregions_ufs_makedirentry_msdosfs_close_union_updatevp_VOP_REMOVE_ccdinterleave_sysctl_int_zeropage_union_newsize_nfsm_srvwcc_tcp_keepidle_tunioctl_slpque_fixalign_zsopen_ipf_cksum_srandom_iommu_ca_st_read_block_limits_dead_strategy_sys_statfs_ext2fs_specop_opv_desc_ext2fs_vnodeop_opv_desc_msdosfs_vnodeop_opv_desc_union_vnodeop_opv_desc_procfs_vnodeop_opv_desc_kernfs_vnodeop_opv_desc_umap_vnodeop_opv_desc_null_vnodeop_opv_desc_portal_vnodeop_opv_desc_fdesc_vnodeop_opv_desc_fifo_nfsv2nodeop_opv_desc_spec_nfsv2nodeop_opv_desc_nfsv2_vnodeop_opv_desc_mfs_vnodeop_opv_desc_spec_vnodeop_opv_desc_fifo_vnodeop_opv_desc_dead_vnodeop_opv_desc_ffs_specop_opv_desc_ffs_vnodeop_opv_desc_sync_vnodeop_opv_desc_pipe_read_cd9660_specop_opv_desc_cd9660_vnodeop_opv_desc_db_clear_breakpoints_esp_dma_intr_iommu_cd_lerdcsr_mem_access_fault_arp_inuse_lockmgr_printinfo_sys_acct_vnddkdriver_max_datalen_ignore_bogus_traps_softdep_setup_allocindir_metasubdi3.o_ext2fs_remove_sl_compress_init_vm_map_lookup_vm_map_find_svr4_add_socket__vm_object_allocate_softdep_mount_m_pullup_vm_object_allocate_Lfsbail_clk_wenable_nfsrv_getattr_msdosfs_setattr_unix2winfn_procfs_setattr_st_unmount_scsi_strvis_oclk_set_dt_recvit_sendit_sparc_noop_VOP_RENAME_ktrnamei_profprocs_ssclose_clockattach_unixsw_vm_object_coalesce_nfsrv_rcv_rn_insert_kernfs_lookup_pppclose_uihash_sys_getlogin_fifo_advlock_ncr53c9x_sense_tk_rawcc_vm_page_startup_initialized_vm_map_findspace_fdesc_read_sddump_nqnfs_serverd_nqnfs_getlease_portal_readdir_maxdmap_lastpid_ncr53c9x_sched_auxreg_ca_nextsibling_pmap_create_ifafree_if_slowtimo_sys_getpgid_svr4_stream_ioctl_nqnfs_vacated_secopt_portal_vfree_compat_43_sys_accept_ext2fs_rename_ext2fs_read_DES_version_vfs_free_addrlist_sys_dup2_auxreg_cd_ip_mrtproto_tbread_sys_truncate_xdcintr_softdep_fsync_db_next_free_watchpoint_db_write_cmd_random_tcp_trace_db_history_last_db_recover_si_vme_dma_eop_xdc_e2str_sddone_fdctimeout_fdc_debug_insmntque_limcopy_ncr5380_cmd_timeout_db_line_ether_delmulti_st_loadquirks_bridge_init_bridge_rtfind_sbdrop_shm_nused_sys___sysctl_db_symatoff_amd7930_halt_input_nfsrv_wakenfsd_nfs_writerpc_count_lock_queue_m_free_vprintf_vop_close_desc_psignal_db_hang_am7990_setladrf_qe_ca_zs_ca_bsd_to_svr4_sigaltstack_nqnfs_callback_pppalloc_chainalloc_db_next_bpf_dtab_rtioctl_svr4_to_bsd_termios_amd7930_start_output_iommu_sc_nfs_numasync_procfs_allocvp_qe_cd_zs_cd_vop_generic_unlock_VOP_REVOKE_sbppattach_rcons_clear2eop_segm_freelist_ukopen_sadb_exts_allowed_in_vm_allocate_with_pager_umap_bypass_lf_wakelock_hmestart_sdebug_esp_dma_isactive_scanjet_read_chkdquot_nfsrv_create_igmp_slowtimo_useloopback_sys_swapon_ncr53c9x_dequeue_sttyioctl_bwtwoioctl_stmatch_hmac_ipad_buffer_nat_list_rn_init_ext2fs_reload_doasyncfree_suser_ext2fs_truncate_fdesc_init_unp_gc_dvma_base_scsi_print_sense_union_read_sogetopt_sys_sstk_vop_unlock_desc_nfs_mount_diskless_kbdopen_cd9660_lock_ncr53c9x_timeout_xyc_perror_sdgetdisklabel_cdgetdisklabel_pager_map_wanted_ips_table_deflateInit_cd9660_defattr_readdisklabel_ccdgetdisklabel_espstat_vop_revoke_desc_cd9660_link_ncr53c9x_free_ecb_memerr4m_xdc_remove_iorq_compat_43_sys_getdtablesize_svr4_sys_sysconfig_rcons_clear2eol_xdclose_nfs_bwrite_vop_open_desc_pmap_changeprot4_4c_fpu_itof_vop_reallocblks_desc_VOP_VALLOC_sys_sendmsg_sys_recvmsg_qeintr_vm_map_entry_delete_revarprequest_bridge_hash_nbigpipe_ripsrc_ip_stripoptions_union_newupper_vfs_opv_numops_be_ifmedia_upd_rdopen_oclk_get_secs_swtab_fr_ipfrttl_in_localaddr_soisdisconnecting_nfree_msgmaps_hmewatchdog_xdr_inaddr_decode_ip_natout_msdosfs_fsync_union_seek_nlinesw_sys_getpgrp_vop_readlink_desc_vop_strategy_desc_des_set_odd_parity_procfs_ioctl_killproc_lkminit_sys_sync_route_src_disk_count_xycmatch_vm_object_page_remove_ufs_bmap_sunos_sys_otimes_statmin_syscallqdivrem.o_chattach_ext2fs_sync_nat_icmpin_ip_reass_kernfs_setattr_semtot_be_ifmedia_sts_ffs_blkpref_RMD160Update_vm_object_collapse_allowed_umap_node_hashtbl_null_node_hashtbl_sosend_sys_profil_getinoquota_bpf_attachd_readde_olf_check_header_elf_check_header_qeinit_zslist_bus_map_ufs_open_pcbmap_procfs_dofpregs_db_hangon_userconf_maxdev_dequeue_randomness_ncr53c9x_variant_names_pv_changepte4m_db_machine_init_tcp_saveti_oldpvec_bpf_ifname_umap_reclaim_procfs_root_portal_reclaim_mbtypes_amd7930_round_blocksize_nfs_clearcommit_emul_elf_db_free_breakpoints_esp_new_zeroize_ah_new_zeroize_qewatchdog_union_vn_create_cluster_wbuild_userconf_modify_iso_disklabelspoof_pfkey_register_tcp_totbackoff_umap_print_ttstart_exec_aout_prep_zmagic_getdevunit_fdesc_link_blktochr_softclock_audio_initbufs_si_vme_intr_on_ssmatch_scsi_prevent_mfs_bmap_nfs_start_nqsrv_send_eviction_des_check_key_ifmedia_match_sd_ca_ktrgetheader_vinvalbuf_RMD160Transform_bridge_rttrim_deflateReset_umap_getattr_portal_getattr_time_precision_cd9660_mmap_am7990_intr_xyread_nfs_fsinfo_subkey_table_gen_msdosfs_mkdir_readep_portal_unmount_pffindtype_addupc_intr_ncr5380_scsi_cmd_sd_cd_sparc_interrupt44c_vpage_dqhashtbl_inflateEnd_cd9660_deftstamp_vmspace_alloc_ext2fs_alloc_bpf_iflist_bpfopen_null_node_hash_vn_write_ptswrite_userconf_add_cgtwoopen_amd7930match_esp_switch_ss_identify_scanner_mfs_open_leapyear_ttyopen_sunos_sys_execv_doclusterwrite_msdosfs_update_union_root_fifo_lookup_db_unread_token_rcons_delline_qsync_nfsrvw_sort_sl_uncompress_tcp_core_ppp_restart_uk_caudiv.o_sunos_emul_path_ieioctl_sysctl_dumpentry_loioctl_svr4_sys_stat_xdstrategy_sys_stat_cd9660_init_physio_audio_rint_m_clalloc_proc0paddr_chkvnlock_uk_cd_lemediastatus_be_tcvr_read_bit1_nfs_vfs_init_ptcread_sbppread_svr4_netopen_be_tcvr_read_bit2_sdopen_fifo_printinfo_xldcontrolbidle_xysize_desirednfsrvcache_ah_old_attach_nexpire_ext2fs_vfsops_vm_map_init_vrele_am7990_init_xdc_submit_iorq_eeprom_match_procfs_access_VOP_PRINT_proc0_compat_10_sys_msgsys_vm_pager_allocate_ffs_freefile_procfs_validregs_db_del_symbol_table_db_add_symbol_table___qdivrem_ledma_reset_inflateReset_spec_print_vnode_hold_list_soconnect2_userconf_cnt_db_maxoff_swift_mmu_enable_nfs_boot_getfh_ip_pcbopts_in_delmulti_db_regs_npmemarr_rd_cd_unix2dostime_bufhash_ext2fs_mountroot_VOP_GETATTR_semu_list_hmereset_rpc_call_nfsrv_errmap_null_node_create_elf_probes_vop_lease_desc_db_examine_cmd_qzero_sunos_sys_creat_svr4_sys_sigaltstack_sparc_i_nsphyattach_msdosfs_mknod_ruadd_sys_sigaltstack_fpu_sqrt_mono_time_db_term_m_retryhdr_dqinit_cpumod_bsdi_strings_svr4_delete_socket_kentry_free_pmap_page_protect_p_nfs_print_msdosfs_root_uprintf_si_ca_vnode_pager_list_union_copyup_vmcmd_map_pagedvn_want_ast_fpu_stof_cgsixclose_pppinput_audio_pint_be_get_mustek_get_status_fdcstatus_nfs_getcookie_umap_reverse_findid_si_cd_svr4_sigcode_sdunlock_getcacheinfo_sun4c_ppp_deflate_cluster_write_cttyioctl_ptyioctl_ttybg_sys_getppid_db_vars_esp_ca_sunos_sys_mknod_spec_nfsv2nodeop_p_fifo_nfsv2nodeop_p_union_islocked_maxproc_bufinit_ncr5380_wait_nrq_timo_arpintrq_esp_cd_dumplo_xdmatch_ufs_setattr_softdep_increase_linkcntumul.o_vm_page_alloc_contig_kmembase_sys_mlock_sys_adjtime_nqsrv_maxlease_revarpwhoami_isohashtbl_mountroot_fscale_dvma_free_procfs_mount_syncdelay_sys_fsync_db_read_char_bsdi_si_leattach_ufsfifo_close_nfsrv3_procs_nfs_rcvunlock_null_vfsops_audio_ioctl_startprofclock_svr4_sys_wait_userconf_pdevnam_ktrgenio_espdmaintr_ufs_dirrewrite_issignal_csignal_mbinit_mmumod_nfsrv_writegather_udbtable_rn_mkfreelist_fdesc_open_cachestats_si_vme_dma_setup_stclose_powerdown_kernfs_badop_vop_islocked_desc_ddb_sysctl_scsi_user_done_elf_read_from_minphys_fdformat_ext2fs_fsync_dqhash_mfs_doio_msdosfs_ioctl_sys_sbrk_audio_check_params_audiostartp__vm_map_print_svr4_sys_utssys_sa_hw_if_bpf_setf_sys_clock_gettime_audio_drain_ietint_vm_page_remove_vm_object_lookup_nfs_remove_rn_lookup_VOP_RECLAIM_ttyin_indent_audiostartr_pmap_is_modified4_4c_allocsys_pmap_clear_modify_p_db_find_watchpoint_malloc_process_write_regs_qsphy_ca_viking_mmu_enable_audio_read_rcons_text_pmap_dumpmmu_machine_arch_getpropstring_ufs_init_nfiles_randomwrite_qsphy_cd_sunos_sys_ioctl_mii_tick_holdrele_iso_nchstats_svr4_sys_execv_mbppwrite_wzero_fdcswintr_if_qflush_msdosfs_read_union_access_sys_poll_add_tty_randomness_add_disk_randomness_cgsix_ca_xyc_chain_ippr_ftp_pasvmsg_fdesc_lookup_pgrphash_config_init_cd9660_fifoop_p_si_find_softdep_setup_blkmapdep_incore_foundfpu_rdstrategy_route_dst_procfs_donote_maxlockdepth_db_list_breakpoints_db_set_breakpoints_cgsix_cd_kernel_regmap_store_ips_stats_sys_mkdir_db_read_line_iewatchdog_ipsendredirects_sloutput_munmapfd_ssioctl_cdunlock_nfsrvw_procrastinate_hmac_opad_buffer_esp_input_pppdumpb_va_null_ifmedia_ioctl_am7990_read_fubyte_mbpp_attach_svr4_sys_vhangup_prom_vend_zdmap_vm_page_rename_nfs_rename_unp_attach_logread_memset_svr4_sys_putmsg_amd7930_set_port_ufs_access_nfsrv_lookup_pppioctl_VOP_WRITE_isp_async_ierint_fd_set_motor_ttyinfo_ttyoutput_randomopen_esp_dma_reset_nfsspec_write_null_unlock_nclruhead_spec_write_bsd_to_svr4_speed_ev_select_sw_options_msdosfs_seek_vfs_unbusy_svr4_sys_pwrite_vm_object_shadow_ext2fs_mkdir_mfs_init_ptsstart_ttylist_v_putc_vm_sysctl_db_output_line_lkm_list_svr4_ustat_si_free_tcp_do_sack_ttyfree_ncr5380_wait_req_timo_swbuf_svr4_sys_creat_VOP_READDIR_addupc_task_msgbufmapped_bppwrite_sbus_testdma_eeprom_update_pfkey_addr_ttwrite_longjmp_vm_object_pmap_remove_fdesc_start_raw_usrreq_am7990_tint_nfs_write_dqfreelist_log_open_db_single_step_cmd_svr4_sys_time_si_obio_dma_setup_in_baddynamic_ifunit_db_break_table_xy_casdiv.o_ipfr_nattab_ipprintfs_svr4_sys_mknod_compat_43_sys_sigsetmask_sys_mknod_cd9660_bmap_tcbhashsize_tunclose_ifmedia_set_bpfread_umap_mapids_compat_43_sys_truncate_X_db_lookup_xy_cd_chkiqchg_ufs_lock_nosuidcoredump_svr4_sys_break_pmap_enu4_4c_ippr_ftp_out_thread_sleep_msg_sys_pipe_cd9660_statfs_db_prev_fb_pfour_id_kvm_uncache_iszerodev_ufs_link_ipflog_clear_dounmount_sys_read_ether_ipmulticast_min_iematch_fdcmatch_ppplogchar_mfs_mountroot_procfs_doregs_disklist_acctwatch_X_db_symatoff_cd9660_open_pmap_alloc_cpu_ch_switch_hardmemerr4m_rip_init_ifa_ifwithnet_sunos_sysent_pmap_zero_page_p_ext2fs_mknod_tty_attach_setrunqueue_rcons_delchar_tcp_newtcpcb_VOP_ISLOCKED_vm_map_remove_sunos_sys_statfs_ufs_vinit_nfs_inactive_ktrsyscall_vop_remove_desc_ether_ipmulticast_max_am7990_rint_ms_rint_module_ms2_msdosfs_sync_db_get_variable_kernel_segmap_store_esp_dma_setup_cd9660_rrip_getname_rd_sleep_pri_pfkey_init_db_machine_commands_install_am7990_watchdog_forkstat_module_ms1_frstats_ipip_input_ipv4_tunnelsetup_sockargs_userconf_argbuf_tprintf_cd9660_islocked_audio_fill_silence_db_shift_expr_db_print_position_xdioctl_sadb_exts_required_out_arpioctl_portal_lookup_lf_getlock_bwrite_vop_generic_revoke_au_get_port_si_vme_dma_start_ipport_lastauto_sys_writev_si_head_fdesc_print_audioread_svr4_sys_fstat_nfsrv_null_xdr_inaddr_encode_vfs_getuserstr_portal_start_sys_fstat_memcpy_fbrcons_rows_RMD160Init_msdosfs_mount_db_force_whitespace_db_breakpoint_cmd_svr4_sys_ioctl_xyc_remove_iorq_amd7930_query_devinfo_skipjack_forwards_ipl_unreach_sys_ioctl_kmeminit_isodirino_lewrcsr_memregattach_st_space_nqnfs_clientlease_nat_instances_procinit_ffs_write_consintr_sync_print_boottime_mbpp_ca_cgeight_ca_pmap_clear_modify4m_esp_dma_go_esp_read_reg_kbd_rint_Blowfish_expandstate_fdesc_readdir_db_restart_at_pc_sunos_sys_mount_scanjet_ctl_write_mbpp_cd_cgeight_cdstrcat.o_ch_position_ifnet_addrs_sys_getegid_db_search_cmd_ss_ca_sbppselect_esp_dma_isintr_ufs_mmap_rpc_reply_ifioctl_db_lookupudivdi3.o_makememarr_ap_sess_list_procfs_bmap_lkmexists_vop_truncate_desc_db_trace_until_call_cmd_kbdread_cgthreemmap_VOP_LOOKUP_raw_input_ptcclose_pipe_write_ss_cd_memerr_cputyp_idprom_bootpath_amd7930_device_fr_tcpidletimeout_m_devget_ncr53c9x_dmaselect_zstty_ffs_blkatoff_nfs_blkatoff_pppoutput_sys_ptrace_suiword_svr4_stream_ti_ioctl_cpu_hotfix_vm_page_buckets_cast_setkey_consinit_rcons_puts_emulinstr_ext2gennumber_procfs_open_hashinit_add_mouse_randomness_xd_ca_qecmatch_vm_pager_atop_ifmedia_add_db_stack_trace_cmd_fpu_xtof_reset_vif_sun_noname_ttrstrt_detach_loadable_swap_pager_list_iplattach_sbcompress_sleep_selwakeup_db_trap_db_delete_line_xd_cd_virtual_avail_swap_pager_free_ifa_ifwithroute_pmap_enu4m_tcp_ctlinput_deextend_allocbuf_X_db_stub_xh_runtime_ch_move_ldcontrolb_route_proto_updatefats_portal_print_probeset_sunos_sys_vhangup_pmap_enter4_4c_ipforward_rt_rtalloc_process_write_fpregs_nfs_vfsops_mbpp_rw_cgtwommap_vnode_pager_setsize_si_obio_dma_start_bridge_output_cpu_set_kpc_xdc_reset_scsidebug_luns_nfsrtton_tdb_delete_inetsw_rt_newaddrmsg_union_ioctl_m_prepend_initsiginfo_strayintr_cd_read_toc_scsi_size_vm_pager_next_vm_object_hashtable_total_pmap_clear_reference_p_nfsm_uiotombuf_bridge_rtupdate_buffers_iskmemdev_fdesc_targets_compat_43_sys_getpagesize_intrcnt_cd9660_vptofh_audioioctl_am7990_stop_mmu_3l_ufs_ihashinit_realitexpire_xymatch_cgfourteenclose_nfsm_rpchead_procfs_validfile_st_ca_svr4_sys_xmknod_nfsrv_link_rip_output_vn_closefile_wcopy_iommu_print_vm_page_free_memory_db_find_variable_sdwrite_m_pad_tcp_now_bridge_filter_vop_whiteout_desc_vop_mknod_desc_vaccess_st_cd_pmemarr_pfkey_sendup_vm_object_enter_rt_setgate_cpumatch_unknown_des_set_key_in_canforward_db_show_arptab_rawcb_uk_switch_ffs_reload_esp_old_attach_pgshift_be_put_in_pcbnotifymiss_msdosfs_access_reinsert_syncer_maxdelay_memchr_maxsmap_db_lbuf_end_msdosfs_bmap_sw_ca_union_lease_fdesc_write_lkmclose_amd7930_trap_tcxioctl_in_pcblookup_nchash_sw_cd_umap_node_create_db_map_current_svr4_sys_fpathconf_pmap_clear_modify4_4c_romgetcursoraddr_soo_ioctl_sys_fpathconf_sbus_ca_kentry_data_fix_incksum_msdosfs_open___moddi3_VOP_CREATE_add_net_randomness_db_read_token_cd_set_mode_union_advlock_acctchkfreq_spec_lookup_VOP_ABORTOP_scsi_inquire_eeprom_take_ext2fs_inactive_nfsrv_noop_ipstate_log_win2unixfn_sbus_cd_sunos_sys_lstat_trap_type_qe_mcreset_vm_pager_init_fdesc_reclaim_vm_pageout_db_read_variable_lenocarrier_cdwrite_fixtick_swapinit_vgone_db_istab_firstchild_udp_sysctl_setregs_sigcode_segm_lru_qereset_cp_time_sys_mount_vhold_ptcwakeup_sys_nosys_pgrp0_mbppopen_cgeightopen_ufs_rmdir_encdebug_null_bwrite_ticks_start_update_ether_addmultianddi3.o_put_expiration_cd9660_sync_pv_size_want_resched_mii_phy_probe_sbusreset_igmpstat_userconf_totdev_rcons_cnputc_emul_svr4_slioctl_bpfioctl_fc_lfcempty_fdesc_unmount_cache_purgevfs_itimerfix_shmsegs_svr4_sys_utimes_pmap_rmk4_4c_swappagerops_ext2fs_mount_nfsrv_zapsock_nv2tov_type_udp_input_pipeclose_sys_utimes_db_ed_style_ffs_fragacct_led_blink_ipqmaxlen_compat_43_sys_sendmsg_compat_43_sys_recvmsg_cd9660_quotactl_ncr53c9x_done_vm_pager_has_page_tcp_timers_fdesc_inactive_unp_connect_pmap_protect_p_setroot_ipl_inited_semundo_clear_logselect_pfind_inside_udp_ctlinput_unixdomain_ktrpsig_qcopy_tcp_iss_createde_fdavail_randomread_probe_switch_dqsync_nfsrv_init_kernfs_vfsops_cd9660_specop_p_if_attach_dma_isintr_lemediachange_vm_map_reference_Blowfish_encipher_udp_usrreq_power_ca_probeget_cache_print_mem_no_hypersparc_mmu_enable_ms1_mmu_enable_nfs_setattrrpc_union_check_p_shmid_n2o_sys_unmount_vop_bmap_desc_ccdioctl_db_stop_at_pc_db_putstring_power_cd_ext2fs_blkatoff_procfs_init_VOP_VFREE_vm_map_inherit_db_command_loop_sysctl_iflist_fr_checkp_compat_43_sys_getpeername_sys_getpeername_compat_43_sys_creat_db_lex_stopprofclock_sys_getfh_ulmin_sbppclose_bestart_sparc_led_blink_loadav_ext2fs_cgupdate_rn_search_m_cd1400_compute_baud_svr4_emul_path_memregmatch_mfs_inactive_ufs_inactive_union_mount_sync_inactive_doclusterraz_qsphy_reset_fdmatch_dev_pager_list_ifconf_nullfs_statfs_kthread_create_deferred_elf_copyargs_romboot_lebufattach_ricoh_is410_sw_object_bypasses_sys_geteuid_vm_object_count_idle_u_mbpp_start_rcons_bell_db_stub_xh_st_rewind_deflate_ulmax_async_daemon_ss_quirk_patterns_st_quirk_patterns_scsi_quirk_patterns_tcp_mss_null_islocked_ffs_vfsops_compat_43_sys_setreuid_audio_close_db_dot_mbppselect_npagers_ext2fs_valloc_nqnfs_lease_updatetime_vnops_vfs_rootmountalloc_fuswintrskpc.o_fr_tcpstate_m_gethdr_brelvp_db_last_non_space_db_putchar_nfsrv_symlink_breada_linesw_cd9660_read_panic_openpromclose_cgfourmmap_fdesc_vfree_fdesc_getattr_mixer_ioctlstrcmp.o_fbclose_chclose_unp_dispose_hardupdate_audio_clear_cgthreeopen_cd9660_rrip_getsymname_xyioctl_ttysleep_kbd_ascii_time_tolerance_breadn_vm_object_remove_pmap_removeashldi3.o_mmopen_vm_page_unwire_nfsrtt_union_fsync_prtactive_db_watchpoint_alloc___iordi3_svr4_sys_lstat_sdstart_ext2fs_vinit_ext2fs_statfs_softdep_update_inodeblock_msdosfs_fhtovp_sys_lstat_vndstrategy_spifattach_ext2fs_vfree_m_get_assert_wait_fifo_select_fifo_badop_ncr5380_abort_locnames_in_losing_siginit_lockinit_X_db_nsyms_virtual_end_aps_free_cd9660_seek_amd7930_getdev_tty_detach_nexecs_db_output_position_vmmap_rdwrite_kmap_free_rpc_auth_kerb___umoddi3_putphysbuf_db_free_watchpoints_m_adj_xdc_start_st_load_m_pullup2_db_printsym_raise_config_rootfound_ttcompatgetflags_stattach_cd9660_vget_ksymsopen_nfs_writebp_procfs_link_m_cat_m_copym2_allcftables_sys___semctl_compat_43_sys_fstat_kbd_repeat_start_des_is_weak_key_mfchashtbl_msdosfs_init_scanc_max_linkhdr_msioctl_amd7930_start_input_logclose_panicstr_sbus_attach_getvnode_disk_attach_db_cmd_list_am7990_meminit_nfsrv_remove_tcp_usrclosed_lf_addblock_cache_lookup_mainbus_match_amd7930_open_brelse_pmap_enk4m_cdstart_fdstrategy_vm_object_cache_trim_rn_search_stop_db_set_variable_in_pcbnotify_union_dowhiteout_null_bypass_crcopy_sys_sendto_fr_udptimeout_tcp_xmit_timer_fc_lmdistance_mbstat__remque_ssminphys_ufs_ihashrem_nfsrv_read_findwin95_nqsrv_unlocklease_igmp_init_vfs_getnewfsid_sys_flock_netisr_db_listbreak_cmd_romhalt_in_addmulti_union_mkdir_kernfs_open_bdwrite_ttselect_sys_rename_fifo_ebadf_pffasttimo_sys_msync_biowait___one_cmpldi2_dma_reset_pgdelete_svr4_netattach_svr4_ttold_ioctl_sun_dkioctl_dma_enintr_sdattach_nfsm_srvfattr_kernfs_epoch_fr_authend_limit0_cd9660_setattr_vput_sbpp_ca_etext_mii_mediachg_sl_compress_setup_ifa_ifwithaf_kernfs_xwrite_vn_select_logpri_sys___osemctl_cache_purge_sunos_sys_fcntl_pmap_extract4_4c_rcons_init_ffs_setblock_db_sym_init_nfsfifo_close_pageout_daemon_fifo_close_spec_fsync_sbpp_cd_nfsrv_rename_vndthrottle_swapconf_kbdioctl_led_sc_quotaoff_cd9660_root_vref_softdep_load_inodeblock_nat_ioctl_sys_connect_nsphy_ca_fbrcons_cols_lastdosdate_netcon_boothowto_db_symiter_pmap_phys_address_pmap_page_protect4m_dqget_nfsm_strtmbuf_hostid_sys_setpgid_cd9660_vget_internal_m_retry_nsphy_cd_softdep_setup_directory_add_nullfs_vptofh_ncr5380_intr_raster_textn_vm_page_bootstrap_ufs_dirbad_fr_authexpire_ppp_compressors_m_getclr_q_to_b_trap_console_font_fixed_ufs_start_soreceive_exit1_sys_getitimer_oldmon_w_cmd_blf_ecb_decrypt_msdosfs_lock_kmemusage_ncr53c9x_intr_sbppmatch_nam2blk_xyc_tick_union_mknod_cpu_ca_bzero___negdi2_sunos_sys_unmount_cgfouropen_maxslp_around_rn_addroute_msdosfs_link_ptcselect_ttydefchars_fuword_statintr_fr_active_putc_execsw_vmeprint_swcleanlist_null_print_kernfs_mount_mountlist_slock_ifinit_cpu_cd_msgpool_cgeightmmap_cpumatch_viking_netcls_crfree_db_single_step_sbpp_rw_cnioctl_fdioctl_nfsstats_bpf_mcopy_relookup_msdosfs_inactive_procfs_inactive_attach_loadable_ieintr_VOP_RMDIR_bucket_compat_43_sys_setregid_vop_generic_abortop_cd1400_read_reg_dma_setup_ufs_ihashins_union_copyfile_start_init_vn_default_error_ncr5380_init_bpp_ca_pmap_zero_page4_4c_scsi_get_xs_mapdev_sys_lseek_sys_select_audio_ca_unavail_end_vm_page_queue_active_au_get_gain_mmmmap_ext2fs_vptofh_sys_close_vndstart_ncr53c9x_init_audio_init_ringbuffer_bpp_cdstrlen.o_ap_free_ipsp_kern_sysvshm_map_audio_cd_cgfourteenioctl_procfs_checkioperm_shutdownhook_list_sys_semget_svr4_sys_waitsys_ufsspec_write_nfs_xdrneg1_union_statfs_portal_symlink_vop_access_desc_db_endlpstrncasecmp.o_cdattach_db_show_callout_scsi_donestrcpy.o_cn_rxc_out_fdc_namei_hme_caurem.o_enc_softc_kernfs_xread_lbolt_VOP_BWRITE_audio_default_ieinit_cpu_attach_nextgennumber_umap_rename_hme_cd_ip4stat_iplclose_slinput_tbinput_sigexit_unsleep_compat_43_sys_gethostname_nfs_getcacheblk_dqrele_ufs_print_nfs_reconnect_ipl_disable_lkmioctl_compat_43_sys_sigblock_svr4_to_bsd_speed_swstrategy_inflateSync_union_whiteout_procfs_validfpregs_pmap_rmu4_4c_in_revarpinput_revarpinput_led_ca_svr4_sys_alarm_vm_map_startup_VOP_MKNOD_arc4random_db_help_cmd_vdumppages_ss_patterns_myetheraddr_vmebus_sc_skpc_sys_chmod_allproc_sema_db_list_watchpoints_db_set_watchpoints_led_cd_regs_nsphymatch_pmap_free_pages_ext2fs_rmdir_mfs_start_msdosfs_mmap_m_split_sys_chdir_cd_ca_sunos_sys_ustat_cred0_selrecord_in_setpeeraddr_ttwakeup_time_myleintr_ufs_ihashget_tcp_rttdflt_setstatclockrate_db_eregs_cd_cd_sunos_sys_ptrace_svr4_sys_fcntl_fbrcons_init_mainbus_model_removede_nchashtbl_vfs_sysctl_VOP_SETATTR_sys_fcntl_cd9660_rrip_offset_sd_crazymap_audio_init_record_mtty_attach_mustek_attach_bpf_freed_vfs_op_init_soabort_fpproc_sccs_cgsixmmap_looutput_kernfs_inactive_fifo_inactive_be_ca_ctx_alloc_dvma_mapout_getcacheinfo_sun4_encioctl_bridge_rtage_union_close_db_search_ssstrategy_ext2fs_check_export_ufs_check_export_kernfs_vfree_tunattach_semu_be_cd_svr4_sys_semsys_st_read_kernfs_init_sys_chown_au_set_lr_value_msginfo_loadfpstate_sbappendcontrol_shmfork_sys_reboot_scheduler_check_exec_audioclose_db_evars_eeprom_give_udpcksum_ip_directedbcast_zlib_version_db_tab_stop_width_ihash_get_expiration_lookup_msginit_VOP_STRATEGY_db_tok_string_raster_op_sysctl_vnode_db_watch_table_tick_makefstype_raster_bitmask_amd7930attach_turbosparc_cache_enable_cypress_cache_enable_hypersparc_cache_enable_viking_cache_enable_ms1_cache_enable_ipseczeroes_icmpmaskrepl_vop_blkatoff_desc_vm_page_max_wired___udivdi3_be_tcvr_write_be_tcvr_read_led_cycle_ufs_create_dead_write_vntblinit_shifthz_arp_ifinit_ukattach_mustek_rewind_scanner_unp_discard_spec_ioctl_emul_find_pmap_rmu_p_lesetutp_VOP_FSYNC_ttsetwater_rootdev_ie_setupram_rpc_mismatch_fr_timeoutstate_spec_inactive_config_scan_db_breakpoint_alloc_mfs_print_bridge_rtflush_vfs_free_netcred_nextc_pmap_zero_page4m_nfs_asyncio_in_broadcast___assert_vgetmemchr.o_si_dma_poll_tcxclose_ip_maxqueue_netio_sysctl_doproc_pmap_pinit_xs_free_list_fdhash_sysctl_rdint_trace_req_ifnet_mbppread_module_unknown_vm_pager_get_soo_close_nfs_valloc_des_encrypt_hardclock_sys_clock_settime_sbppioctl_vm_pager_sync_pmap_reference_ipsec_esp_network_default_level_ipsec_esp_trans_default_level_ipsec_auth_default_level_bridge_start_lastseconds_vm_object_reference_bigadj_isofncmp_crdup_bridge_rtdaddr_config_search_time_freq_ch_ca_msghdrs_svr4_stream_get_dqref_tcp_outflags_bremfree_svr4_sys_pread_xdcmatch_scsidebug_targets_rn_match_constty_elf_load_file_zswrite_in_control_tdbh_union_check_ch_cd_svr4_sys_rdebug_devicepagerops_nfs_pathconf_thread_block_pidhash_tcp_maxidle_llinfo_arp_updatepri_stty_compute_baud_vm_page_queue_inactive_union_allocvp_vmcmd_map_readvn_ovbcopy_auiop_st_interpret_sense_scsi_interpret_sense_ext2fs_flushfiles_ffs_flushfiles_nfs_statfs_iprintf_fdinit_compat_43_sys_lstat_numccd_bufpages_openpromioctl_nfs_strategy_bridge_broadcast_vfs_opv_descs_fdfree_fbioctl_chioctl_bpfclose_kernfs_link_slclose_tbclose_VOP_PATHCONF_audioselect_sys_unlink_vop_reclaim_desc_ipe4_input_in_ifaddr_VOP_MKDIR_sync_fsync_db_sstep_print_svr4_sys_fchroot_ext2fs_direnter_pmap_enk4_4c_si_obio_dma_stop_sys_setitimer_X_db_isym_isp_lostcmd_pmap_rmk_p_iommu_enter_nfs_attrtimeo_vop_bwrite_desc_vop_update_desc_mntvnode_slock_sd_get_optparms_fddump_auxio_regval_ipstat_union_setattr_oclock_ca_randomselect_ncr53c9x_select_mem_access_fault4m_svr4_sys_ulimit_raster_op_nosrc_noclip_st_touch_tape_dmtext_winChksum_msgbufp_audiogetinfo_sync_crash_fr_scanlist_vnode_free_list_slock_oclock_cd_beattach_bpf_bufsize_portal_vfsops_umap_vfsops_disk_resetstat_pmap_copy_page_p_alldevs_leavepgrp_compat_43_sys_sethostname_vop_generic_bwrite_vndwrite_vmes_scan_ext2fs_mountfs_exec_setup_stack_xyc_xyreset_nsphy_reset_mfs_initminiroot_ip_srcroute_fatentry_copyargs_sunos_sys_sigreturn_svr4_error_rpc_autherr_delete_flow_sys_sigreturn_crget_bread_ccdclose_msgmaps_sunos_sys_setpgrp_cluster_newbuf_db_lp_rn_newpair_logioctl_disk_detach_route_cb_sem_nbuf_svr4_sys_shmsys_subnetsarelocal_sir_nsphy_service_shm_find_segment_by_shmid_vop_write_desc_shminfo_ippr_ftp_in_db_error_sys_chflags_nswapmap_nullop_nbootpath_xdc_xdreset_pil_to_vme_vm_pager_put_pages_nfs_sysctl_fr_addgroup_proc_targets_shminitsrandom.o_st_identify_drive_ipport_firstauto_vmcmdset_extend_ncr53c9x_poll_svr4_sys_gettimeofday_ufs_pathconf_pppasyncrelinq_bpf_catchpacket_pipe_ioctl_parentdev_matches_cfdata_dev_matches_cfdata_sys_gettimeofday_esym_pmap_clear_reference4m_xdc_ioctlcmd_db_skip_to_eol_cpcb_cgtwoputcmap_procfs_lookup_ipc_n2o_tputchar_resettodr_mii_phy_reset_kmem_malloc_mbutl_kbd_docmd_mfs_strategy_ufs_strategy_arp_rtrequest_procfs_freevp_clalloc_mixer_close_db_search_symbol_db_le_X_db_search_symbol_nbpg_pv_link4m_bestop_ndqb_ipc_o2n_soo_select_tickfixinterval_nqfhhashtbl_tcprexmtthresh_fs_posix_sysctl_clfree_cd1400_enable_transmitter_xyclose_soclose_fifo_ioctl_ncr5380_wait_phase_timo_pmap_bootstrap_kdvma_mapin_ufs_direnter_vm_object_cached_list_nfsm_mbuftouio_arp_maxtries_null_lookup_kernfs_get_rrootdev_shm_last_free_kmemstats_getcpuinfo_iommu_match_nqnfs_prog_arpt_prune_sysctl_ntptime_db_lc_fbopen_chopen_ext2fs_dirempty___cmpdi2_umap_unlock_vsunlock_audio_write_db_qualify_lmin_dmamatch_scanjet_special_ffs_sbupdate_loif_lf_split_compat_43_sys_mmap_db_history_X_db_sym_init_romprop_ipport_hifirstauto_fd_ca_lesetaui_fdesc_pathconf_logwakeup_sttyattach_fbnode_vm_pages_needed_lock_cdread_rpc_auth_unix_uipc_usrreq_diskerr_VOP_IOCTL_fd_cd_max_protohdr_sparc_db_command_table_dvma_malloc_fdchwintr_softdep_setup_inomapdep_ip_dosourceroute_kernfs_statfs_soconnect_db_command_table_dma_ca_lmax_spifmatch_svr4_sys_signal_xystrategy_ifpromisc_lasttime_rdattach_dma_go_getquota_ipe4_zeroize_compat_43_sys_lseek_db_inst_count_rmalloc_kern_sysctl_dma_cd_main_svr4_to_bsd_sig_msclose_nfs_vptofh_ah_input_bioops_firstc_fdrelease_eopnotsupp_ie_ca_delay_sddkdriver_ffs_valloc_phys_map_chkdq_nfsspec_access_nqsrv_instimeq_unp_externalize_lkm_nofunc_svr4_sendsig_mfs_rootbase_route_output_cinit_ie_cd_maxfiles_nfsnodehash_kernfs_root_sbappendaddr_cfree_msopen_berint_qestart_cdsize_ppp_timeout_free_fbmmap_ie_map_in_ifinit_msdosfs_create_semu_alloc_lockstatus_db_readline_db_last_addr_st_decide_mode_grow_iplcrcinit_ipfr_inuse_union_newlower_vmtotal_fdesc_ioctl_extent_alloc_region_db_unread_char_pv_flushcache_nfsrv_getcache_rawcbtable_pppasyncctlp_sys_setsid_svr4_sys_pgrpsys_des_key_sched_arpt_keep_msdosfs_mountfs_VOP_LEASE_bereset_fdciop_ffs_statfs_inflateIncomp_isp_intr_lortrequest_union_readlink_pmap_rmk4m_beqint_fc_purge_audio_select_db_loop_count_pmap_protect4m_deflateInit2_db_lbuf_start_timer_ca_imin_dead_print_svr4_elf_probe_sunos_sys_fchroot_svr4_trap_vm_pager_put_nfsm_adj_exec_map_kbdclose_cgfourteenopen_fr_tcpclosed_iplioctl_unp_internalize_sys_setuid_numvnd_timer_cd_mii_add_media_ipforwarding_VOP_BALLOC_svr4_sys_utime_ufs_dirempty_dehash_audioprobe_iptime_vnode_pager_uncache_domainnamelen_ksymsread_imax_pmap_copy_disabled_cnopen_fdopen_sunos_sys_mctl_pager_eva_inflateInit_sys_clock_getres_svr4_sys_pathconf_svr4_jerq_ioctl_chmatch_kmem_free_wakeup_sys_issetugid_sys_pathconf_isp_init_xyc_ioctlcmd_sigprop_ktrops_cpu_match_ufs_lookup_nfsv3_type_raw_init_prefetch_mttywrite_ah_old_output_nat_lookupredir_tcp_quench_bawrite_enxio_edatabzero.o_pmap_copy_page4_4c_xycintr_chkiq_msqid_n2o_fixjobc_kill_user_windows_ntohl_setptesw4m_put_flow_ipq_inflateInit2_if_down_dead_ebadf_pgrphashtbl_mmrw_cgsixopen_ppp_dequeue_userconf_show_attr_vop_link_desc_VOP_ACCESS_svr4_sys_setegid_sys_shmctl_sys_setegid_chgproccnt_db_clear_watchpoints_scsibus_ca_cnclose_fdclose_pmap_update_bpf_setif_kernfs_read_rrootdev_shmexit_cngetc_xyc_entoact_nat_table_tcp_fasttimo_nfs_symlink_time_constant_kthread_run_deferred_queue_audioprint_scsibus_cd_pagertab_SHA1Transform_if_up_sunos_sys_mmap_sadb_exts_allowed_out_ffs_sysctl_cd9660_select_end_st_crazymap_umapfs_mount_bcmp_msgbuf_raster_text_msdosfs_pathconf_procfs_pathconf_ktrcsw_biodone_iplh_deget_vm_object_list_lock_fpu_cleanup_ukmatch_mii_pollstat_intr_fasttrap_ext2fs_update_ipfr_heads_ipfr_slowtimer_ip_randomid_fc_fileextends_tinfo_t_db_expression_copyoutstr_auxregbisc_softdep_flushfiles_inetctlerrmap_semlock_holdernegdi2.o___ucmpdi2___lshldi3_msdosfs_strategy___main_xyc_e2str_ipfr_unload_bpfwrite_ktremul_vop_setattr_desc_cpmemarr_icmp_sysctl_tcp_sysctl_au_get_lr_value_cnt_ifmedia_list_add_vm_cache_lock_version_fdalloc_sys_oshmctl_sys_ntp_gettime_cmask_db_max_width_config_found_sm_cpumatch_sun4_wildcard_rt_tables_extent_destroy_endtsleep_db_nsymtabs_ffs_tcxmmap_cpumatch_hypersparc_dirchk_route_init_sohasoutofband_npty_cfroots_zsclose_vm_map_deallocate_vm_object_deallocate_enoioctl_closef_sys_write_sunos_sys_open_swift_cache_enable_sun4_cache_enable_nfssvc_sockhead_db_prom_cmd_fd_types_pager_map_vm_map_entry_dispose_ext2fs_sbupdate_iplt_lf_getblock_sys_xfspioctl_spec_badop_ch_exchange_rt_setmetrics_dead_read_setrunnable_betint_mii_phy_auto_fdstart_turbosparc_hotfix_ufs_close_ipv4_input_lf_clearlock_sys_socketpair_ap_ok_vn_syncer_add_to_worklist_vfs_opv_init_getc_fdcopy_falloc_bematch_pfkeyv2_parsemessage_vm_pager_remove_ffs_mountfs_ip_natunload_routesw_fifo_bmap_vmebus_translate_sbus_translate_blf_key_ether_output_umapfs_statfs_vfs_allocate_syncvnode_cluster_read_dk_establish_ienab_bis_4_4c_svr4_sys_socket_vm_page_activate_ext2fs_write_nfsv2_type_nfsrvlruhead_nfsrv_readlink_sys_socket_pfkeyv2_expire_mfs_badop___lshrdi3_cdevsw_securelevel_ccdwrite_ddb_regs_mbpp_match_sunos_sys_wait4_vm_map_simplify_entry_nqsrv_getlease_devout_cd9660_readdir_ccdintr_ntohs_ffs_vptofh_nfsm_disct_fdesc_mount_schedcpu_fdc_ca_fb_attach_qeattach_dmmin_fr_defaultauthage_fifo_open_si_vme_dma_stop_desireddquot_hztodivdi3.o_beinit_st_write_filemarks_tcp_usrreq_sl_softc_kernfs_start_coredump_fdc_cd_min_cpumatch_sun4c_ext2fs_symlink_icmpstat_tcpstat_dosdirempty_devcls_vm_allocate g2 @V ,(` U(  gh 8  * *`  * ؒ  @ @@ ˀg@+ @T  @( &  >@    *@ * @ *@ &` `  `* +  ` *  :@]>`  `@V @S㿘  @L&  㷐 U@ R`@4 @L``@G@* 2` @ : g `  @ ,(` ,h' 2h` '@8' w" @'@@   B<@& @hB <@2@2&     ":0 " 0  @  : ` :??0  $2`"`"`  :`0 p  @c@% 8 'pt@b , #\ $#`ab   @`?  2 H "`؀` 2@C  " ذ?㽠P  @,x 'P $` $` $`  $` $$` ($` ,@$` 8 t@ $`  ab  h `$#\#`@ ?  2  x && &&& 0&$&(  D@&, 㺈 ? ?a b?  (`? #\$#`@b ?  2  `  d@Òhd .@ ?nfsread: short packet, %d < %ld 0 ' #  #  #  #  $#  ($#  ,# # $# $# (ab $L ,#\#`@ ? L `"`H 2" ؒ?@T@|0  "@ 2 H"`ذ?㿘@ 2& 2 "` ,`"`6  1c 2 ?& &` ` !"`"` ?nfs_open: must mount first. 㷈 1b b @B  N n`/2N N /" N ` 0 \ @; x   $<N  /   I  N  /.Ȕ >.0 . 29 1@@ $) `` &`;@@ߔO /@" x@ x @ x N  ` 1&` "@ x@ x㿘  "& @ x&  nfs_read: hit EOF unexpectantly㿘' # 2! 2% @}   ݖ? `  !T @ ; @  & B> 2&       D": 0 0   @  :  ` : ??0   ,04(2`:2` <"` @"`D :`0 㿐`@O`0@```@Ԓ`@n`` @h,@ ` @% @`x `` * `d `0, 2`0`0@"`x @ *` @ ?" ? 6" ?%`0@5㿘` `.`@ 8 W& `@&@`,F D @>`h?  "9& @ 0$@``d@  0, 2 0@ր$ @ @@,`ɬ& 㿐   `Pe<@p  4`0*:  8  2`0 8e<`0e<eD `L  Ȁ)t 2; @n`0$  " @1 `d   +   0 @-$ $  $&@&   b 8   @   " & 㿐`@ѐ  `<@@.  0 "  2  @  2  &*@ B`<@@@8Ԑ2 ``@͐ 㻀 @  Ц@ Ô &`@ @ $  ``` @2 e\F!T@ `0@@eg 0   `t@`$ `  'b  L@  @5<`/2L@`L@ /"`L@"s   ג  / ``4e `L@  /,@P谒 X,@/ S (  2HL@@ $D  A ;@ Ie( 8@ \ 0 T䰒 ) @ ` 0`  d( @ #O /' '  L@  @  `0@ V @ P@ M Ё㿘 `&   " ` 0@ <    `` 0@ 1 `@ .@ + Ё 㿐 %`@@8 ``@F @ @@ B<@2&     ":0 " 0  @  : ` :??0 2`"` "` :`0㿐`   <<@`@@82.@``@.@.?,   " #" @ @ B <@  @  @ B<@ rarp: bad socket. %d No response for RARP request O   @ 0K? @  . 7Ɛ(3` +` +` 3`` 3``~3` `"p3` `3` `bD3` `2 4#\@Ζ .  @  ?` 22b8`b82 b8 @ 0 , ? @  ,??"a 2"8 $`㿘 ,h @Ԙ 5㿐@ 2!"`  5@2?@ 2?`(2?`&2?` 2 ? `@  ??bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p la"'ТА $`$` $` ' 2b8X@'䀢 X??$ab  ,` ?#`2 !#\#`@#@   @ b#(<?# 1a! 2@Q! a4!'*@k2 ` #P@ I#?' 1 " ܐ 1a@ ? 2"X 1bh@wX  ? 1@a ? ? 9 P'' 1a 1 @H 2C?@ @? :?ab , ` 1?2 #`ᔘ"#\"#` @x#@ 4' 2 H"`ؐ '@( 2?@I 2?#'@ ? ?㿘`&"@  &@  㿘 &   ? @&@ .@& @"  #d d  e  f g #" ?+d +e+f+gd "@#callrpc: error = %d 㿐\@?; 4`'?'?? @ Y '?ܐ '? `?` 1"@#"'?" "" ""&#\ $ ! @?  2` @`` &@ <# 2 H"`ذ?recvrpc: reject, astat=%d, errno=%d 㿘! 2$ ؐ@W  1@"耢@2?``2 ?`` `  @ $ ذ??"@?2 1 2p(  ? ?    ? 2  #  # ( 1p    getport: %s㾐a"@2 o'?''#  # # p#\ #`  5   p'0 # 2`! @y"@ H$`ذ?  @*`( 2 @bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %d㿘`W !\*` 4G4G4Gd4Gd4GL4G4Gd4G@4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4GX4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4G(4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4G44Gd4Gd4Gd4F4F4F4F4F4F1 /#1 ,#1 )#1 & 1 # 1   01  @1  X1  p1  1  1  1   1 !1 1! @a㿘  ,  ". /.".+."&  "!".. 0?   0 @͠L  0 0ް 0sendudp: bad write (%d != %d)x  @+<* @*@@ &4` ,`  ,` $`  @$`4`  6 4 4 '`'`'`  '` @' @4` 4 &$`$`$`  $`   ,!  @ @ 1`a@'ܖ@( @?  @Breadudp: huge packet, udp len %ld x@ݘް {ހ( (  u?@}p?2n?<@ 2g? 2c?6` <`]@{ 2Y? &U?``  2M?` @& 4  "` @2>?` 6` % "p@x1?' ' '  '  @V'`@=4  $$ $ $ ?$ $$ $ $ $ ` ??sendrecv: short write! (%d < %d)㿘  ) 2 <\-  % '?@ @@, 4 2  ؀   $@$Ԧ`l  *` "JЄ  *  (Ї8*`J. 75 "J2/?`"8" ?#  0 `(?`d((  `dh(* ( ?#㿘@㿘1 1!P.  .? @  0.@ 8 ?@  0.@ .  0?.?.`4  "@ ((*8"@ Є (@㿐 "= N -N $*` .! ؒ?*` @N  . ɒ?#*` @N  .    J   @ (       ` ` `  (  `` (݀2 :?# :* arpwhohas: overflowed arp_list! arp: no response for %s  , @ ,!H@ 'h@@E`@ ` 3 ,aH  &aH @Ő"Ɛ @ . 7Ɛ(3` +` +`3` 3` 3`   3`  ~3` #3`h3` jc3` h$@ 4#\a .? hl! "8'l@ ``4`` `aH4` ` &aH4`㿘 ,h@r(㿐@ 2-"`(2*?@ 2&?`(2"?`&2?`  @??` ,aH *` * ,`@ ??㿘@ /`(+`&'` # `@z   `6`` `6`6`` 6``6`6` 6` (6`  6`  2`  .2`@`㿘 2` 2` 2` .*`*`*`*`*`2` 9 ??㿘8  @-    ,ah@&  "` ?` ?7 1X  ,P : `0 `(   ((( 1!X" @ `  ?  2 @  㿘'H'L'P'T 1ap 'X @"ap@H @#`exit㿘 #㿘  2"@, @ " @  , 㿘@@z㿘@ 㿘 < " ? 2 1 2 @&  D@;  $   ؀`$ <?$ 8 D$ ?$  @`$㿘אԐ* А* ̐?. ?$`8㿘  ,! , @  "    & &"   & L`& ?& `?O& 8  ` ?>& 8  ``* }?`??` `r ` `h `"  < ]   < 2?& 81.1.3㿘@Ғ?,`*@ P 1ax.  "@  @ P? (@C 8 `@&`D &@&`@e0 @`@ P@+?㿘  2 "`?.  2b@   1!x.  @ D@@ P@ 㿘 1!x.  8?? ?2$  ?$8$ ' 2L "88 " @$ $ @$"$"$$ @  4؀ $<" $&@$$$<S < $ؐD@ $؀ $<D$@ $$8 H@ c" $H H ?$88 2 @N$$ @ G$H8 2  < 2  2L H@ 5" $H&㾘  2 -  2b@   1@ 0!x-  `L @?2$`$`" `  2f c 2b  @ F `#@   @ ?@ `D@H P? (@  8$`D$@$`@3 `7@ 5` @ f,@* a !ٔ:  2  Y@d  `0ݐ Y"`ذ??㿐 .  2"@   2 ."`"'@   (0  8   ` 2 "`   B<   2 "`&?㿐  2"@  `    2 B"`$$ $ '” 26$`  - "`J 2 +`'$@$$ c@  1"( @€ ``#``"   @$ 2" ذ?㿘 .  2"@   2 "   2  Y :@ B : Y?? "`      㿘  .  2"@  2 $"`2  " @  `  ` @`$ 2" ؀ 2 " ذ? 1( ጝ㿘'L'P'T'X! 1$! !p@L!*㿘'H'L'P'T'X  @ H㿘  @8 "| `N@`%` N@ `* 4f4g4g4h4h4h4h4h4h4h4f4h4h4h 4h`4h4h4g4h4h@4h4h4ht L@v `ϒ L  ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@` - @1 N@@) N@@! |N@ 0 x @ oN@ % g lc0123456789abcdef㿈  @> @ ,@ՠ  ?L?|/-\㿘 1 ሐ!@ ``J "ꥐ 2(@@    @*0    @*` , ?@ * @:@ @?  ,b "b" @  "@ ,?"  @@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &   J@   J@J`   J "  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2* ?: : 2@  *: @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@㿘 ?` 2"`0"``"`  2 "` @  㿘 "? `"? $ 2` ? " (@ ( $€ &  㿘"M?N 12I?8 D?2 @? &   (& & ( $ 2 (  H& $ (    )& "  `"   "`  ( ?"     %!H @F*  "` ?㿘 unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check㿘 "Q?  "M? H` ?? ` ? "*` 4{ 4{4|<4|4|4}04}4}4~@4~4~4444 `) $   $  @"`  $  "@  " 2    " "( " ` $  $  @ `$` * y  $@ "@   $@$@ ` $  $   * "`$  "@ `ϒ $   $  *` "$  "@ ` $   $  *` "$  "@ ` $   $  ` "` $   $ 0 "@?  "@ "X $ "`  @?   " 5" " s @ `  $"@ "@ `a $  $   * "`$  "@ `N $   $  *` "$  "@ `9 $   $  *` "$  "@ `$ $   $  ` "` $@  " "h$   "` " ??㿘    "#?  ?@N 0  ? $ 06 * ?&@@ǔ   "@㿘 ??`2@09  "@"  .?   8$  @`#@   $#@$$ " $$  "@?㿘 " ?   ?  @z     㿘" <&? 8`(`$€  2& @ ֒&&  (&  8& 4& 0 & <&`0㿘 (   @ "$  (  % & $ (    & (& ,& 8& 0  ( $€ $ ( $€ invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeath@`  4 0 "? ,"   !`  ! `*` 444h4444444 i? *``  & 4  "  ( "+44 `4$@ &@@  & & & &`@j?4&4 && #x&`& & &`@T?#? *`` <2`?# @ @  &#&`& & &`@5?&  @ cc   `& & &`@2=  , ` 0 ( @ "?"`2+ & 4@ Ȕ 4 0 "@? ," , ` 0 ( @ "?"`2  & & &`@ 8% %@" &   2 &? *``  ?, & 4  `a& #&`& & &`@?`( `    & & & &`@?4&  &  l? *`` 4  *``* " & 2  @ `   *  * "@&  &     $@, "& `(`$€ "&& & &`@H &   4  `a | 0# # @,  ? *`@ ,   * @`  `4 $@ * "  M&   ?    @  ? *`@ 4$@*$@   4 @ 4  ! @    `(`$€ &&`& & &`@ڔ?2  * ?* " &    4  `a * & ''  #\ !4  ` $`#`#d@ښܠ`(`$€  ?"&& & &`@@1 2 & & & &`@?&& & &`@`$  &`&@@5& 4|  @#@`  4 0 "? ,"   &&& 4@ 0 4@  4& & &`@K && & &`@A & & &`@9?& & &`@1& & &`@)& & &`@!& & &`@& & &`@& & &`@ & & &`@?`$  "`"@" 4@㿘 `(`$€ (`(`$€ $`(`$€ 㿘 ( (& 4& 0`?w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z- ##`Z G: # @2(` @2(` @2(` @2(` @2(` @2(` @2(` @(`2: # @(`2:㿘?#6 `Z "V. !#?8& `@ `              @͒` @`ϒc˒c񀦠.  inflate 1.1.3 Copyright 1995-1998 Mark Adler  #+3;CScspp !1Aa  0@` Ȓ'L'P'T'X''''''''''''''''\ @?(@` @2@X%&@  .   .  *  ) ?) 8&@  (.    + )  ??  '4? 8@? `  0@  `. @h(% @ *@,0 ? h'0'p p*??"',*L*  $@"+@@ ,  (`@d @  d+@`(d'%%//&1"@8 '.   X%4"/h-`@  /@L   `/@'` T(LP/@ P(`'"1 +@.    (` +@6 +@&+@ 2???eY  2?oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths tree㿀' (    2#\#?#`#d#h    ?? '" '  '@ 2 ( '"(' ? ( $€oversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengths㿀d`' (!    2#\R?#`#d#h! % %#5 ? 2 #\?? '#-$ + ''#0#`#d#h,  & &\ x  ? 2 (?? '#P $ ? '#p '#$ ? ( $€0 ( $€  ," ,  "@ ," 0"㿘 (    "* * " " invalid literal/length codeinvalid distance code㿘@`   4 0@ " ? ,"  0#`  ("P*` 4x4<40444484H44Ѐ!*` ) & & @&``$  &`&@& 4    @՚@`  4 0@  "@ ? ," 8 $  $ $ $  @ *`h *`@ *  *   4 $@ $  $  @ $ $  $U   $$ (!&`& & &`@`? @ *`3 *`@ *$@  4  $  $ $  $ @ *` *`@ *  *   4  $@ $ $  B$ @2 $ * 9$ $ (!&`& & &`@ ? @ *` *`@ *$@  4  $  $ ( #@ " ,"@#@   "$ 26  ,@   0 ( @ " ?" 2$ & 4@ 4 0@ "@ ? ,"  ,@   0 ( @ " ?" "&  ?+@  ,` ( ? $ $ 2=  ,@   0 ( @ " ?" 2+ & 4@ 4 0@ "@ ? ,"  ,@   0 ( @ " ?" 2  & & &`@` ?+@`{$`& 4`@j 0 4@  4& & &`@B $& & &`@8 & & &`@0?& & &`@(& & &`@ & & &`@& & &`@& &`@ & & &`@?`$  "`"@@" 4㿘`$`(€invalid distance codeinvalid literal/length code㿘` `4`0` `,  0 *. .`(   (( `  ? 6!. `6r!`!.`   6(    (  `6:!`: !(   !.`" `(& 6&. .  `,@  @. `(. Z!`@2  .`(( 1 @#@'(`!"` "`#P?`@`  .`((` ? 6!.& * 1 @8@'(`!"` "`#( #1  @8@'(`!"` "`#?!` >  1 @8@'(`!"` "`# '##"`4㿘 0 4@`  ,"`8 " ``"&`@&` 8 <& <&`0Ĕ ,@@ ' 4  (& 4 4`" 8 " ``"&`@&` 8 <& <&`0@&` & 042T4546<464647p44!4!4#04#84#4(4*4+84+4+4,x4 4$4 44 4 44 44 4444444   4x@` 0123456789abcdef/4 `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??4L 4A4[0!4L- 4Ő54m:4HC4qI4HR4L[4 f4#u4jz4 4 (44=@4p 4Ŕ 4Ř44v4tX 4Š44>4L+4,84Q0B4`K 4 X4RPc4p@k4v44M4p4|4V4J44(4O(4z4e 4$4$4 14(;4*F4eN4UY 4(f4!t48 4`4B04q4& 4h4>47444T4XH4Cx!4.4$< 4E4& S4+8] 4h4P(x44+4 44'4#044d4,x4iH48440 4h4 (+ 4p:4 F4U4X(^4h44r46<| 44644E04444H4W 44e47p4$44?t240G42TQ4a4x4m4v4w4,4?44h44 4x 4Ȁ4 4ȸ 4i4+ 4p*474c?4?(R4iZ4i 4ȼq4dy44;t4X4#4d 44W4444Wd4!4 D4  4#84@#4X* 424b94p@4lJ4V(U4 `4xo4|4444\|4$44A464h 4 4 4P4O<4\ 44W4L 4j&4L04_7 4T>4\E4Y 4Xh4o4j v4X}4, 4` 444h4G4q4 44a 4ɰ44y4  4ɴ  4ɸ 45 )4 94# I 48 O 4@ V4 ]4 d4 k4 z4 4 4 4 4 4 4 4( 4( 4( 4X 4 ( 4 ( *4 ( <4` H4 R4 a4 s4p 4À 4 4 4 4Ð 4 4ð 4 4 48 4 4 4 ,4x 64x E4x W4 `4# f4, l48 s4;( 4? 4Cx 4C 4G 4H 4Q0 4R 4U 4W 4W` 4W` 4W 4X( 4a 4b 4c 4d 4ep 4i 4i &4j .4j 54m ;4p@ D4p M4p U4q _4q h4q o4tX v4v }4w 4 4 4H 4 4p 4 4 _getsecs_rpc_fromaddr_open_dvma_mapin_gateip.rem_adler32.urem_sendudp_getprop_netif_put_nfs_getrootfh.div_devopen_socktodesc_obp_close_bp_getfile_inflate_codes_new_bp_server_addr_strtab_inflate_codes_free.umul.udiv_hostname_getchar_xdr_string_encode_inflate_trees_bits_nfs_readdir_in_cksum_pgofset_hostnamelen_arpwhohas_strcmp_net_close_inflate_trees_dynamic_inet_addr_strlen_inflate_set_dictionary_ether_sprintf_readudp_inflateSetDictionary_nfs_open_inet_ntoa_inflate_sprintf_netif_debug_freelist_netif_close_net_open_nfs_close_printf_sendether_file_system_cd9660_close_inflate_trees_fixed_swapip_rpc_pmap_putcache___ashrdi3_nfs_readdata_domainname_xdr_string_decode_ufs_readdir_putchar_inflate_copyright_arp_reply_zcfree_strncpy_netdev_sock_nfs_lookupfh_rpc_xid_nfs_readlink_nfs_read_strtablen_ip_convertaddr_obp_strategy_nfs_seekstart_nfs_root_node_nfs_mount_cd9660_write_inflateSyncPoint_prom0_iclose_nfs_stat_twiddle_rarp_getipaddress_hz_getdevtype_rootip_net_mountroot_rpc_pmap_list_prom_ioctl_inflate_codes_zcalloc_rpc_port_obp_xmit_ufs_read_promvec_ufs_seek_obp_recv_strerror_prom0_close_file_system_nfs_inflate_flush_arp_num_closeall_bootfile_vprintf_ufs_stat_prom0_strategy_prom_getether_xdr_inaddr_decode_inflate_blocks_free_ufs_open_nfs_stat_types_inflateEnd_netmask_inflateReset__rtt_rpc_call_inflate_blocks_sync_point_file_system_ufs_dvma_init_dvma_free_prom_boothow_prom_si_getpropstring_prom_bootdevice_memset_nfs_write_rootpath_cd9660_open_olseek_xdr_inaddr_encode_memcpy_get_crc_table_nameip_oclose_inflate_mask_bp_whoami_cputyp_cd9660_stat_pgshift_rpc_pmap_num_memcmp_prom0_iopen_inflate_fast_panic_cd9660_read_netif_open_prom_open_cd9660_seek_peekchar_etext_ifname_oopen_bzero_getticks_readether_prom_init_inflateInit2__inflateSync_ndevs_loadfile_dvma_mapout_read_inflate_blocks_reset_arp_list_rpc_pmap_getcache_ufs_write_prom0_recv_errno_sockets_esym_intoa_nbpg_nfsys_exit_main_free_sendrecv_lseek_debug_close_inflate_blocks_new_domainnamelen_crc32_alloc_edata_cngetc_fbuf_end_dvma_alloc_bcea_gets___main_netif_get_version_oread_prom_bootfile_file_system_cd9660_inflateInit__prom0_xmit_bp_server_port_dbuf_ufs_close_inflate_blocks_cd9660_readdir_myip_files_devswsrt0.oboot.ogcc2_compiled.___gnu_compiled_cconf.ogcc2_compiled.___gnu_compiled_cdvma.ogcc2_compiled.___gnu_compiled_cnet.ogcc2_compiled.___gnu_compiled_c_open_countnetif_sun.ogcc2_compiled.___gnu_compiled_c_netif_prompromdev.ogcc2_compiled.___gnu_compiled_c_filestore.6_bootstore.7_prom0_fake_saveecho_pv_putchar_sun4_idprom.44_dtab_stringbuf.51_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.60version.ogcc2_compiled.___gnu_compiled_ccd9660.onfs.oufs.orarp.obootparam.orpc.ostrncpy.ostrerror.ogets.onet.oin_cksum.oarp.oether.omemcmp.oglobals.oexit.ocloseall.ocread.oread.oopen.olseek.oclose.oprintf.omemset.omemcpy.oalloc.osdiv.orem.ostrcmp.ostrlen.obzero.oashrdi3.o__main.ourem.oudiv.oumul.oinflate.oinfblock.ocrc32.oadler32.oinftrees.oinfcodes.oinffast.oinfutil.oXh 4 `@# ` 2"" $@` `T@ 0#X 2b@"@H*/+ + 1"c  0  "#X +"#d * +"#\!` +"#`@>> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x 㿘@"@ ,  @  2!` L@ % 2 !% 2+ 2/ 2- 2`x  `@!@mMḀ 2%` @! @dM` 2@G   2@  a(@x $x !8@@@nBad format %d+%d+[%d+%d]=0x%x boot: short read x%@f < ?@ ?# @!2?3 a/?@ ?# @!% a!?@ ?# @!  a ?@ ?# @ 2   `"  " @v"?@ ?# @!  ܀a ` @܀ 2 @?@?# @! a ?@ ?# @! "a  @" .@`@2.@ "@4@ݒ 2m @@(  .@  `耢 D .@.`.` ".`@ `@耢 2E @# 1b@  ; b.@ .` .` .`b쀤   ?`@2& @ "@ 2` ?@  "P "@Ԓ@` +#X  1#   2 !PĀb10"@?  +XĈ`Ī` Đ`IJ` dvma_mapin㿘? #@(1? @#@1?dvma_mapout㿘 #@(1 @#1㿘@ " ْ㿘 @㿘 0#X 2 0@  +"c 2  @/  0cX "cX㿘 0cX ? "cX +@{#boot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐' +@ ?7 2! "8 А@t'@@  ) 2   1@a a# 1ch ,p@   2! ch!@U'@ch@|'  2  2 ؁ 2  2 㿘 2    2 @Ɣ  0#`" $ @   "`ذ?  2  ? 2 㿘 ;  < 㿘  +c @@L   @A" ?  promprom0㿘 +#X  1@ 1# (* 2 2"  0@#p 2"aK` -  2* K   2! J  8*   0c"K  *K ) K  * 1#` ` 2"!@ `%J@ -! @ 2 2 *:  d` s axJ@x J@  x#aT @"xJ@  @Can't open device `%s' Can't open network device `%s' 㿘@  +cX @ @ !$`  "h 1#`  2 ` `$@ 2$@  !4$`  !$`  2  @ʐ!04% 2@ߐ $`&` 2! 1 1"( +c@ M  @!0"( +ch@   +c@  + "c + +cX`#Ȑ $$ 㿘# 1c   ` ༟* `c   '@`20,6 * '@ 㿘  ƒ& & $& (`   €ɒ " '@ 㿘 ` @  1#` (`(`@0@ 㿘   @ & ? $ 1 *@ 㿘 1#  4㿘 1#  8 ?2xmit: not a network device 㿘 `,  @!?K`S`?㿘  ,5 €>㿐 1`  #  #O`P/O O /O㿘㿐 1#     O ?X/O O /O㿐 1#  / 0T@㿘  㿘 1# t㿘@ +@c㿐 1#    1X 1# p%x mac-address drop swap 6 cmoveX +#X # 1 0 c  c  Њ@*@` 0 #.@# .` .` .` .` .`c` `€0  `@c |@ielefdxyxdstsddevice_typeblocknetworkbyte㿘 1#` ! +`@ @Xb @ub '  @mb   @eb(   #`#N@J2N`J@" 2 node %x property %s length %d > %d 㿘 1# `€ ` 0#(@ 㿘 0cޖ ??" .Invalid controller number prom_iopen: "%s" error=%d 㿘) 1 ?D    2  @B 8$ $  $ $`  @G#* @ *`@`@F $0` "`$4` " @D$ @  &    % @  㿘# 1`    @ 4 "$` & 4$`prom_mapin: length=%dprom_mapin: invalid maptype %d㿘 +#\* @ !@T ,    , 8      @?!А    ,  +#\< +#d@;@ ?*@Ԣ &@ ` +#` , @ 1 0 ?( , H L\ T ` X` P d l  t$ p  1 *2.0 @ ` J@(8(8    `J/`? `2? ` `!J J@  * `J2# &  J@;. .2J`;  `J@; @Є  <` CD001㿐 (@? # @ ,(` (  a @_  `   * @h逦`   *`*@ *  @ @ * *`  * h @&(g 8@@ ,` `   ``  * *` *  ` M`; @:8L  *  0 2  !!   @  *` * *     L  *  " M  ! M ˀ  . .. catchmod0 cp dd df edexpr0hostnameB ln lskill0mkdir0 mt mv pax tarcpio0 pwd rm ksh shstty0sleep0sync0test0[ ... . .. chflags chgrp܀ ftp gzip܀ gunzip  gzcat܀ sed  sort܀ tip  build܀ vi@ basename cksum܀ sum cut getopt grep܀ egrep܀ fgrep܀ netstat rsh strings tset܀ reset܀ less܀p more܀ ...444 p444 4 x,4 :4L4Y4j4 4 4 P4`S4444B4P}_dvma_mapin_block_count.urem_devopen_obp_close.udiv_pgofset_sprintf_netif_debug_freelist_printf_putchar_obp_strategystart_prom0_iclose_io_twiddle_prom_ioctl_promvec_prom0_close_closeall_vprintf_block_size_prom0_strategy__rtt_dvma_init_dvma_free_prom_boothow_prom_si_prom_bootdevice_memset_memcpy_cputyp_pgshift_prom0_iopen_panic_progname_prom_open_etext_bzero_prom_init_block_table_ndevs_dvma_mapout_loadboot_nbpg_exit_main_free_debug_alloc_edata_end_dvma_alloc___main_prom_bootfile_devswsrt0.obootxx.ogcc2_compiled.___gnu_compiled_ccloseall.ogcc2_compiled.___gnu_compiled_cdvma.ogcc2_compiled.___gnu_compiled_cpromdev.ogcc2_compiled.___gnu_compiled_c_filestore.6_bootstore.7_prom0_fake_saveecho_pv_putchar_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.32/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/alloc.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/exit.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/printf.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/memcpy.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/memset.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/__main.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/bzero.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/urem.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/udiv.o@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx84 `@# ` "L" $@` `T@   bL@i"@H*/+  "b  0  "# "#Ԑ * "#̊!` "#@ bootxx%s: can't open device㿐@;#@  "aa @ "   @ޒ`@+  @ #Ȁ  "@@%s: alloc failed%s: block table corrupt%s: read failure%s: short read㿐! @z#ؤ   ! @`#ܢ @E #) ?#,`2  !@   ؟  !@ @؀@` "@z 2`@?@2 @a aa2 `@` c܀@ IJ@?  Ĉ`Ī` Đ`IJ` dvma_mapin㿘? #@(1? @4#1?dvma_mapout㿘 #@(1 @" 1㿘@ " ْ㿘 @  promprom0㿘 #Ȁ  @ "   ""@ `"@ J*@J` )J  *@Can't open device `%s' 㿘@  cȰ @@ "`  "@`"@`$@ 2$    b@@!x0  $   #Ȁ c`$`$` 㿘# b   ` ༟* `b   '@`20,6 * '@ 㿘  1& & $& (`   €4 " '@ 㿘 " `@ 0(@ 㿘 @ $ ? $  !*@ 㿐 "  / 0T@㿘  㿘 " tInvalid controller number prom_iopen: "%s" error=%d 㿘) !Ā ?D    " @6 8$ $  $ $`  @ * @ *`@`@F $0` "`$4` " @$ @  & !İ  %!@  㿘# aĀ    @ 4 "$a & 4$aāprom_mapin: length=%dprom_mapin: invalid maptype %d㿘 #̑* @ "@@            @y"X      #< #Ԛ@;@ ?*@Ԣ &@ ` #  @   ?( , H L\ T ` X` P d l  t$ p   *  ?@ * @:@ @?  ` "`" @  "@ ?"  㿘'H'L'P'T aȀ 'X "aȐ@4H @$ exit㿘 !0 ( ԝ㿘'L'P'T'X! $! !P@L!*㿘'H'L'P'T'X  8@ H㿘  8@8 "\ `N@`%` N@ `* 4444t4t4t4t4t4t4t44t4t44@4t4t44t4 4t4t4T L@v `ϒ L  ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@` - @1 N@@) N@@! |N@ 0 x @ oN@ % g lc0123456789abcdef㿈  @ @ ,@  ?L?|/-\㿘  А! ``J " @@    @*0    @*`2( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" 4444444d44x4   4L444#4,4x74P=4F4 hO 4\4f4 n48w4d44 44(4 444h4 444`4p4 4! 4* 4@;4C4`K4S4\4i4 p4z4444444$444 844  4D4 4 4L4`4 4H4%4,454D4V4ha4hp4h4p4p4p444#!/bin/sh # $OpenBSD: binstall.sh,v 1.3 1998/02/18 08:17:46 deraadt Exp $ # $NetBSD: binstall.sh,v 1.3 1996/04/07 20:00:12 thorpej Exp $ # vecho () { # echo if VERBOSE on if [ "$VERBOSE" = "1" ]; then echo "$@" 1>&2 fi return 0 } Usage () { echo "Usage: $0 [-hvt] [-m] net|ffs directory" exit 1 } Help () { echo "This script copies the boot programs to one of several" echo "commonly used places. It takes care of stripping the" echo "a.out(5) header off the installed boot program on sun4 machines." echo "When installing an \"ffs\" boot program, this script also runs" echo "installboot(8) which installs the default proto bootblocks into" echo "the appropriate filesystem partition." echo "Options:" echo " -h - display this message" echo " -m - Look for boot programs in (default: /usr/mdec)" echo " -v - verbose mode" echo " -t - test mode (implies -v)" exit 0 } PATH=/bin:/usr/bin:/sbin:/usr/sbin MDEC=${MDEC:-/usr/mdec} set -- `getopt "hm:tv" "$@"` if [ $? -gt 0 ]; then Usage fi for a in $* do case $1 in -h) Help; shift ;; -m) MDEC=$2; shift 2 ;; -t) TEST=1; VERBOSE=1; shift ;; -v) VERBOSE=1; shift ;; --) shift; break ;; esac done INSTALLBOOT=${INSTALLBOOT:-$MDEC/installboot} if [ ! -x $INSTALLBOOT ]; then INSTALLBOOT=/usr/mdec/installboot; fi DOIT=${TEST:+echo "=>"} if [ $# != 2 ]; then Usage fi WHAT=$1 DEST=$2 if [ ! -d $DEST ]; then echo "$DEST: not a directory" Usage fi SKIP=0 case $WHAT in "ffs") DEV=`mount | while read line; do set -- $line vecho "Inspecting \"$line\"" if [ "$2" = "on" -a "$3" = "$DEST" ]; then if [ ! -b $1 ]; then continue fi RAW=\`echo -n "$1" | sed -e 's;/dev/;/dev/r;'\` if [ ! -c \$RAW ]; then continue fi echo -n $RAW break; fi done` if [ "$DEV" = "" ]; then echo "Cannot find \"$DEST\" in mount table" exit 1 fi TARGET=$DEST/boot DEV=`echo $DEV | sed -e 's/a$/c/'` vecho Boot device: $DEV vecho Target: $TARGET $DOIT dd if=${MDEC}/boot of=$TARGET bs=32 skip=$SKIP sync; sync; sync vecho $INSTALLBOOT ${VERBOSE:+-v} $TARGET ${MDEC}/bootxx $DEV $DOIT $INSTALLBOOT ${VERBOSE:+-v} $TARGET ${MDEC}/bootxx $DEV ;; "net") TARGET=$DEST/boot.sparc.openbsd TMP=/tmp/boot.$$ vecho Target: $TARGET vecho Copying to temporary file. cp ${MDEC}/boot $TMP; chmod +w $TMP vecho Stripping $TMP strip $TMP vecho Creating header magic. printf '\01\03\01\07\060\200\0\07' | dd of=$TARGET bs=32 conv=sync vecho Concatenating boot code. dd if=$TMP of=$TARGET bs=32 skip=1 seek=1 rm $TMP ;; *) echo "$WHAT: not recognised" exit 1 ;; esac exit $? sun-24|Sun 24-line window:\ :co#80:li#24:tc=sun: sun-17|Sun 17-line window:\ :co#80:li#17:tc=sun: sun-12|Sun 12-line window:\ :co#80:li#12:tc=sun: sun-1|Sun 1-line window for sysline:\ :es:hs:\ :co#80:li#1:\ :ds=^L:fs=\E[K:ts=^M:tc=sun: sun-e|sun-nic|sune|Sun Microsystems Workstation without insert character:\ :ei@:ic@:im@:\ :tc=sun: sun-c|sun-cmd|Sun Microsystems Workstation console with scrollable history:\ :li#35:\ :te=\E[>4h:ti=\E[>4l:tc=sun: vt320-k3|MS-Kermit 3.00's vt320 emulation:\ :am:es:hs:km:mi:ms:xn:\ :co#80:it#8:li#49:pb#9600:vt#3:\ :AL=\E[%dL:CC=\E:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SR=\E[%dL:UP=\E[%dA:ae=\E(B:al=\E[L:\ :as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[0$~:ec=\E[%dX:ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E F\E[?1l\E[?7h\E[r\E[2$~:k0=\E[21~:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M^J:rc=\E8:\ :sc=\E7:se=\E[27m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[1$}\r\E[K:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l\E[?5h\E[?5l\E[?5h\E[?5l:ve=\E[?25h:\ :vi=\E[?25l: vt320-k311|dec vt320 series as defined by kermit 3.11:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=3\E[L:as=^N:bl=^G:cd=\E[J:ce=\E[K:cl=\E[;H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E[?3l:rc=\E8:rf=/usr/share/tabset/vt100:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt50|dec vt50:\ :bs:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cr=^M:do=^J:le=^H:nd=\EC:\ :sf=^J:ta=^I:up=\EA: vt50h|dec vt50h:\ :bs:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:do=^J:\ :le=^H:nd=\EC:sf=^J:sr=\EI:ta=^I:up=\EA: vt52|dec vt52:\ :bs:\ :co#80:it#8:li#24:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\EG:as=\EF:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :\ :cr=^M:do=\EB:ho=\EH:kb=^H:kd=\EB:kl=\ED:kr=\EC:ku=\EA:\ :le=\ED:nd=\EC:nw=^M^J:sf=^J:sr=\EI:ta=^I:up=\EA: vt61|vt-61|vt61.5|dec vt61:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=\r:do=^J:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:sf=\n:sr=\EI:ta=^I:\ :up=\EA: HPX`hpx (08@HPX`hpx (08@HPX`hpx@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx  (08@H @ 7y   @@7yҪ@@P^<@`bT U7y\ `4(A7y:-;7y-7y-68A7yx7yx7yx wA7y 087y 87y 8 QA7y7y7yn * 7y BdP7y BdP7y BdP../../instbinZK 7y 7y 7y ../../instbinb 7y YX7y YX7y YX../../instbinڶZ 7y h7y h7y h../../instbin) 7y !7y !7y !../../instbin0- 7y %ER 7y %7y %../../instbin  7y )qTH7y )qTH7y )qTH../../instbin# 7y -Vp7y -Vp7y -Vp../../instbin1 7y 1\7y 1\7y 1\../../instbinuvW 7y 5^7y 5^7y 5^../../instbin{ 7y :!`7y :!`7y :!`../../instbin{ 7y Q7y Q7y Q../../instbin?mW 7y }ǐ7y }ǐ7y }ǐ../../instbin  7y $ɸ7y $ɸ7y $ɸ../../instbin]J 7y (7y (7y (../../instbinXN?f 7y -7y -7y -../../instbinlq: 7y 1-07y 1-07y 1-0../../instbinw 7y 4C7y 4C7y 4C../../instbin>`7 7y 8E7y 8E7y 8E../../instbin:  7y ~}7y ~}7y ~}../../instbin 7y  7y  7y  ../../instbin1w[j 7y ւH7y ւH7y ւH../../instbin' 7y X7y X7y X../../instbina 7y 7y 7y ../../instbin۵ 7y 7y 7y ../../instbin{o 7y 87y 87y 8../../instbin`!7yK, m7yK, m7yK-;csL!7yK2p7yK2p7yK3ߠmm!7yL GX7yL GX7yLHpg _!7yL 7yL 7yL#w!7yLv7yLv7yL#w!A!7yL'H7yL'H7yL#wwt=2!7yLy7yLy7yL#w" !7yL07yL07yL#w!7yL:G7yL:G7yM53vmm7x]7U\7yM'uhpxp` RPMK> yǶS&(ӸNX~>d^hq🱠s1 c8zL_"rbM`I{oe] ra N0S1~$~H;zR:3]v/' =ΎD#Q soMx+Au"Kv6м MV%L :S_yb4¾Ke[}Y0gi2O`0^?1x[ _M\ۖa%axɣ of왻BVۅa)7i0$<drv&/a0.IotP+u g e'J;; ?4U'oB3IŘ<0(́L^A~8 ө'#- @~Ь.D h\# $OpenBSD: dot.profile,v 1.12 1998/10/15 07:33:31 deraadt Exp $ # $NetBSD: dot.profile,v 1.1 1995/12/18 22:54:43 pk Exp $ # # Copyright (c) 1995 Jason R. Thorpe # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export HISTFILE=/.sh_history umask 022 set -o emacs # emacs-style command line editing # XXX # the TERM/EDITOR stuff is really well enough parameterized to be moved # into install.sub where it could use the routines there and be invoked # from the various (semi) MI install and upgrade scripts # terminals believed to be in termcap, default TERM TERMS="sun vt* pcvt* pc3 dumb" TERM=sun if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES # mount kernfs and re-mount the boot media (perhaps r/w) mount_kernfs /kern /kern mount_ffs -o update /kern/rootdev / # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? 9600 # get the terminal type _forceloop="" while [ "X$_forceloop" = X"" ]; do echo "Supported terminals are: $TERMS" eval `tset -s -m ":?$TERM"` if [ "X$TERM" != X"unknown" ]; then _forceloop="done" fi done export TERM # Installing or upgrading? _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall, (U)pgrade, or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi Xh 4 `@# ` 2"" $@` `T@ 0#X 2b@"@H*/+ + 1"c  0  "#X +"#d * +"#\!` +"#`@>> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x 㿘@"@ ,  @  2!` L@ % 2 !% 2+ 2/ 2- 2`x  `@!@mMḀ 2%` @! @dM` 2@G   2@  a(@x $x !8@@@nBad format %d+%d+[%d+%d]=0x%x boot: short read x%@f < ?@ ?# @!2?3 a/?@ ?# @!% a!?@ ?# @!  a ?@ ?# @ 2   `"  " @v"?@ ?# @!  ܀a ` @܀ 2 @?@?# @! a ?@ ?# @! "a  @" .@`@2.@ "@4@ݒ 2m @@(  .@  `耢 D .@.`.` ".`@ `@耢 2E @# 1b@  ; b.@ .` .` .`b쀤   ?`@2& @ "@ 2` ?@  "P "@Ԓ@` +#X  1#   2 !PĀb10"@?  +XĈ`Ī` Đ`IJ` dvma_mapin㿘? #@(1? @#@1?dvma_mapout㿘 #@(1 @#1㿘@ " ْ㿘 @㿘 0#X 2 0@  +"c 2  @/  0cX "cX㿘 0cX ? "cX +@{#boot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐' +@ ?7 2! "8 А@t'@@  ) 2   1@a a# 1ch ,p@   2! ch!@U'@ch@|'  2  2 ؁ 2  2 㿘 2    2 @Ɣ  0#`" $ @   "`ذ?  2  ? 2 㿘 ;  < 㿘  +c @@L   @A" ?  promprom0㿘 +#X  1@ 1# (* 2 2"  0@#p 2"aK` -  2* K   2! J  8*   0c"K  *K ) K  * 1#` ` 2"!@ `%J@ -! @ 2 2 *:  d` s axJ@x J@  x#aT @"xJ@  @Can't open device `%s' Can't open network device `%s' 㿘@  +cX @ @ !$`  "h 1#`  2 ` `$@ 2$@  !4$`  !$`  2  @ʐ!04% 2@ߐ $`&` 2! 1 1"( +c@ M  @!0"( +ch@   +c@  + "c + +cX`#Ȑ $$ 㿘# 1c   ` ༟* `c   '@`20,6 * '@ 㿘  ƒ& & $& (`   €ɒ " '@ 㿘 ` @  1#` (`(`@0@ 㿘   @ & ? $ 1 *@ 㿘 1#  4㿘 1#  8 ?2xmit: not a network device 㿘 `,  @!?K`S`?㿘  ,5 €>㿐 1`  #  #O`P/O O /O㿘㿐 1#     O ?X/O O /O㿐 1#  / 0T@㿘  㿘 1# t㿘@ +@c㿐 1#    1X 1# p%x mac-address drop swap 6 cmoveX +#X # 1 0 c  c  Њ@*@` 0 #.@# .` .` .` .` .`c` `€0  `@c |@ielefdxyxdstsddevice_typeblocknetworkbyte㿘 1#` ! +`@ @Xb @ub '  @mb   @eb(   #`#N@J2N`J@" 2 node %x property %s length %d > %d 㿘 1# `€ ` 0#(@ 㿘 0cޖ ??" .Invalid controller number prom_iopen: "%s" error=%d 㿘) 1 ?D    2  @B 8$ $  $ $`  @G#* @ *`@`@F $0` "`$4` " @D$ @  &    % @  㿘# 1`    @ 4 "$` & 4$`prom_mapin: length=%dprom_mapin: invalid maptype %d㿘 +#\* @ !@T ,    , 8      @?!А    ,  +#\< +#d@;@ ?*@Ԣ &@ ` +#` , @ 1 0 ?( , H L\ T ` X` P d l  t$ p  1 *2.0 @ ` J@(8(8    `J/`? `2? ` `!J J@  * `J2# &  J@;. .2J`;  `J@; @Є  <` CD001㿐 (@? # @ ,(` (  a @_  `   * @h逦`   *`*@ *  @ @ * *`  * h @&(g 8@@ ,` `   ``  * *` *  ` M`; @:8L  *  0 2  !!   @  *` * *     L  *  " M  ! M ˀ  g2 @V ,(` U(  gh 8  * *`  * ؒ  @ @@ ˀg@+ @T  @( &  >@    *@ * @ *@ &` `  `* +  ` *  :@]>`  `@V @S㿘  @L&  㷐 U@ R`@4 @L``@G@* 2` @ : g `  @ ,(` ,h' 2h` '@8' w" @'@@   B<@& @hB <@2@2&     ":0 " 0  @  : ` :??0  $2`"`"`  :`0 p  @c@% 8 'pt@b , #\ $#`ab   @`?  2 H "`؀` 2@C  " ذ?㽠P  @,x 'P $` $` $`  $` $$` ($` ,@$` 8 t@ $`  ab  h `$#\#`@ ?  2  x && &&& 0&$&(  D@&, 㺈 ? ?a b?  (`? #\$#`@b ?  2  `  d@Òhd .@ ?nfsread: short packet, %d < %ld 0 ' #  #  #  #  $#  ($#  ,# # $# $# (ab $L ,#\#`@ ? L `"`H 2" ؒ?@T@|0  "@ 2 H"`ذ?㿘@ 2& 2 "` ,`"`6  1c 2 ?& &` ` !"`"` ?nfs_open: must mount first. 㷈 1b b @B  N n`/2N N /" N ` 0 \ @; x   $<N  /   I  N  /.Ȕ >.0 . 29 1@@ $) `` &`;@@ߔO /@" x@ x @ x N  ` 1&` "@ x@ x㿘  "& @ x&  nfs_read: hit EOF unexpectantly㿘' # 2! 2% @}   ݖ? `  !T @ ; @  & B> 2&       D": 0 0   @  :  ` : ??0   ,04(2`:2` <"` @"`D :`0 㿐`@O`0@```@Ԓ`@n`` @h,@ ` @% @`x `` * `d `0, 2`0`0@"`x @ *` @ ?" ? 6" ?%`0@5㿘` `.`@ 8 W& `@&@`,F D @>`h?  "9& @ 0$@``d@  0, 2 0@ր$ @ @@,`ɬ& 㿐   `Pe<@p  4`0*:  8  2`0 8e<`0e<eD `L  Ȁ)t 2; @n`0$  " @1 `d   +   0 @-$ $  $&@&   b 8   @   " & 㿐`@ѐ  `<@@.  0 "  2  @  2  &*@ B`<@@@8Ԑ2 ``@͐ 㻀 @  Ц@ Ô &`@ @ $  ``` @2 e\F!T@ `0@@eg 0   `t@`$ `  'b  L@  @5<`/2L@`L@ /"`L@"s   ג  / ``4e `L@  /,@P谒 X,@/ S (  2HL@@ $D  A ;@ Ie( 8@ \ 0 T䰒 ) @ ` 0`  d( @ #O /' '  L@  @  `0@ V @ P@ M Ё㿘 `&   " ` 0@ <    `` 0@ 1 `@ .@ + Ё 㿐 %`@@8 ``@F @ @@ B<@2&     ":0 " 0  @  : ` :??0 2`"` "` :`0㿐`   <<@`@@82.@``@.@.?,   " #" @ @ B <@  @  @ B<@ rarp: bad socket. %d No response for RARP request O   @ 0K? @  . 7Ɛ(3` +` +` 3`` 3``~3` `"p3` `3` `bD3` `2 4#\@Ζ .  @  ?` 22b8`b82 b8 @ 0 , ? @  ,??"a 2"8 $`㿘 ,h @Ԙ 5㿐@ 2!"`  5@2?@ 2?`(2?`&2?` 2 ? `@  ??bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p la"'ТА $`$` $` ' 2b8X@'䀢 X??$ab  ,` ?#`2 !#\#`@#@   @ b#(<?# 1a! 2@Q! a4!'*@k2 ` #P@ I#?' 1 " ܐ 1a@ ? 2"X 1bh@wX  ? 1@a ? ? 9 P'' 1a 1 @H 2C?@ @? :?ab , ` 1?2 #`ᔘ"#\"#` @x#@ 4' 2 H"`ؐ '@( 2?@I 2?#'@ ? ?㿘`&"@  &@  㿘 &   ? @&@ .@& @"  #d d  e  f g #" ?+d +e+f+gd "@#callrpc: error = %d 㿐\@?; 4`'?'?? @ Y '?ܐ '? `?` 1"@#"'?" "" ""&#\ $ ! @?  2` @`` &@ <# 2 H"`ذ?recvrpc: reject, astat=%d, errno=%d 㿘! 2$ ؐ@W  1@"耢@2?``2 ?`` `  @ $ ذ??"@?2 1 2p(  ? ?    ? 2  #  # ( 1p    getport: %s㾐a"@2 o'?''#  # # p#\ #`  5   p'0 # 2`! @y"@ H$`ذ?  @*`( 2 @bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %d㿘`W !\*` 4G4G4Gd4Gd4GL4G4Gd4G@4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4GX4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4G(4Gd4Gd4Gd4Gd4Gd4Gd4Gd4Gd4G44Gd4Gd4Gd4F4F4F4F4F4F1 /#1 ,#1 )#1 & 1 # 1   01  @1  X1  p1  1  1  1   1 !1 1! @a㿘  ,  ". /.".+."&  "!".. 0?   0 @͠L  0 0ް 0sendudp: bad write (%d != %d)x  @+<* @*@@ &4` ,`  ,` $`  @$`4`  6 4 4 '`'`'`  '` @' @4` 4 &$`$`$`  $`   ,!  @ @ 1`a@'ܖ@( @?  @Breadudp: huge packet, udp len %ld x@ݘް {ހ( (  u?@}p?2n?<@ 2g? 2c?6` <`]@{ 2Y? &U?``  2M?` @& 4  "` @2>?` 6` % "p@x1?' ' '  '  @V'`@=4  $$ $ $ ?$ $$ $ $ $ ` ??sendrecv: short write! (%d < %d)㿘  ) 2 <\-  % '?@ @@, 4 2  ؀   $@$Ԧ`l  *` "JЄ  *  (Ї8*`J. 75 "J2/?`"8" ?#  0 `(?`d((  `dh(* ( ?#㿘@㿘1 1!P.  .? @  0.@ 8 ?@  0.@ .  0?.?.`4  "@ ((*8"@ Є (@㿐 "= N -N $*` .! ؒ?*` @N  . ɒ?#*` @N  .    J   @ (       ` ` `  (  `` (݀2 :?# :* arpwhohas: overflowed arp_list! arp: no response for %s  , @ ,!H@ 'h@@E`@ ` 3 ,aH  &aH @Ő"Ɛ @ . 7Ɛ(3` +` +`3` 3` 3`   3`  ~3` #3`h3` jc3` h$@ 4#\a .? hl! "8'l@ ``4`` `aH4` ` &aH4`㿘 ,h@r(㿐@ 2-"`(2*?@ 2&?`(2"?`&2?`  @??` ,aH *` * ,`@ ??㿘@ /`(+`&'` # `@z   `6`` `6`6`` 6``6`6` 6` (6`  6`  2`  .2`@`㿘 2` 2` 2` .*`*`*`*`*`2` 9 ??㿘8  @-    ,ah@&  "` ?` ?7 1X  ,P : `0 `(   ((( 1!X" @ `  ?  2 @  㿘'H'L'P'T 1ap 'X @"ap@H @#`exit㿘 #㿘  2"@, @ " @  , 㿘@@z㿘@ 㿘 < " ? 2 1 2 @&  D@;  $   ؀`$ <?$ 8 D$ ?$  @`$㿘אԐ* А* ̐?. ?$`8㿘  ,! , @  "    & &"   & L`& ?& `?O& 8  ` ?>& 8  ``* }?`??` `r ` `h `"  < ]   < 2?& 81.1.3㿘@Ғ?,`*@ P 1ax.  "@  @ P? (@C 8 `@&`D &@&`@e0 @`@ P@+?㿘  2 "`?.  2b@   1!x.  @ D@@ P@ 㿘 1!x.  8?? ?2$  ?$8$ ' 2L "88 " @$ $ @$"$"$$ @  4؀ $<" $&@$$$<S < $ؐD@ $؀ $<D$@ $$8 H@ c" $H H ?$88 2 @N$$ @ G$H8 2  < 2  2L H@ 5" $H&㾘  2 -  2b@   1@ 0!x-  `L @?2$`$`" `  2f c 2b  @ F `#@   @ ?@ `D@H P? (@  8$`D$@$`@3 `7@ 5` @ f,@* a !ٔ:  2  Y@d  `0ݐ Y"`ذ??㿐 .  2"@   2 ."`"'@   (0  8   ` 2 "`   B<   2 "`&?㿐  2"@  `    2 B"`$$ $ '” 26$`  - "`J 2 +`'$@$$ c@  1"( @€ ``#``"   @$ 2" ذ?㿘 .  2"@   2 "   2  Y :@ B : Y?? "`      㿘  .  2"@  2 $"`2  " @  `  ` @`$ 2" ؀ 2 " ذ? 1( ጝ㿘'L'P'T'X! 1$! !p@L!*㿘'H'L'P'T'X  @ H㿘  @8 "| `N@`%` N@ `* 4f4g4g4h4h4h4h4h4h4h4f4h4h4h 4h`4h4h4g4h4h@4h4h4ht L@v `ϒ L  ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@` - @1 N@@) N@@! |N@ 0 x @ oN@ % g lc0123456789abcdef㿈  @> @ ,@ՠ  ?L?|/-\㿘 1 ሐ!@ ``J "ꥐ 2(@@    @*0    @*` , ?@ * @:@ @?  ,b "b" @  "@ ,?"  @@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &   J@   J@J`   J "  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2* ?: : 2@  *: @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@㿘 ?` 2"`0"``"`  2 "` @  㿘 "? `"? $ 2` ? " (@ ( $€ &  㿘"M?N 12I?8 D?2 @? &   (& & ( $ 2 (  H& $ (    )& "  `"   "`  ( ?"     %!H @F*  "` ?㿘 unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check㿘 "Q?  "M? H` ?? ` ? "*` 4{ 4{4|<4|4|4}04}4}4~@4~4~4444 `) $   $  @"`  $  "@  " 2    " "( " ` $  $  @ `$` * y  $@ "@   $@$@ ` $  $   * "`$  "@ `ϒ $   $  *` "$  "@ ` $   $  *` "$  "@ ` $   $  ` "` $   $ 0 "@?  "@ "X $ "`  @?   " 5" " s @ `  $"@ "@ `a $  $   * "`$  "@ `N $   $  *` "$  "@ `9 $   $  *` "$  "@ `$ $   $  ` "` $@  " "h$   "` " ??㿘    "#?  ?@N 0  ? $ 06 * ?&@@ǔ   "@㿘 ??`2@09  "@"  .?   8$  @`#@   $#@$$ " $$  "@?㿘 " ?   ?  @z     㿘" <&? 8`(`$€  2& @ ֒&&  (&  8& 4& 0 & <&`0㿘 (   @ "$  (  % & $ (    & (& ,& 8& 0  ( $€ $ ( $€ invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeath@`  4 0 "? ,"   !`  ! `*` 444h4444444 i? *``  & 4  "  ( "+44 `4$@ &@@  & & & &`@j?4&4 && #x&`& & &`@T?#? *`` <2`?# @ @  &#&`& & &`@5?&  @ cc   `& & &`@2=  , ` 0 ( @ "?"`2+ & 4@ Ȕ 4 0 "@? ," , ` 0 ( @ "?"`2  & & &`@ 8% %@" &   2 &? *``  ?, & 4  `a& #&`& & &`@?`( `    & & & &`@?4&  &  l? *`` 4  *``* " & 2  @ `   *  * "@&  &     $@, "& `(`$€ "&& & &`@H &   4  `a | 0# # @,  ? *`@ ,   * @`  `4 $@ * "  M&   ?    @  ? *`@ 4$@*$@   4 @ 4  ! @    `(`$€ &&`& & &`@ڔ?2  * ?* " &    4  `a * & ''  #\ !4  ` $`#`#d@ښܠ`(`$€  ?"&& & &`@@1 2 & & & &`@?&& & &`@`$  &`&@@5& 4|  @#@`  4 0 "? ,"   &&& 4@ 0 4@  4& & &`@K && & &`@A & & &`@9?& & &`@1& & &`@)& & &`@!& & &`@& & &`@& & &`@ & & &`@?`$  "`"@" 4@㿘 `(`$€ (`(`$€ $`(`$€ 㿘 ( (& 4& 0`?w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z- ##`Z G: # @2(` @2(` @2(` @2(` @2(` @2(` @2(` @(`2: # @(`2:㿘?#6 `Z "V. !#?8& `@ `              @͒` @`ϒc˒c񀦠.  inflate 1.1.3 Copyright 1995-1998 Mark Adler  #+3;CScspp !1Aa  0@` Ȓ'L'P'T'X''''''''''''''''\ @?(@` @2@X%&@  .   .  *  ) ?) 8&@  (.    + )  ??  '4? 8@? `  0@  `. @h(% @ *@,0 ? h'0'p p*??"',*L*  $@"+@@ ,  (`@d @  d+@`(d'%%//&1"@8 '.   X%4"/h-`@  /@L   `/@'` T(LP/@ P(`'"1 +@.    (` +@6 +@&+@ 2???eY  2?oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths tree㿀' (    2#\#?#`#d#h    ?? '" '  '@ 2 ( '"(' ? ( $€oversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengths㿀d`' (!    2#\R?#`#d#h! % %#5 ? 2 #\?? '#-$ + ''#0#`#d#h,  & &\ x  ? 2 (?? '#P $ ? '#p '#$ ? ( $€0 ( $€  ," ,  "@ ," 0"㿘 (    "* * " " invalid literal/length codeinvalid distance code㿘@`   4 0@ " ? ,"  0#`  ("P*` 4x4<40444484H44Ѐ!*` ) & & @&``$  &`&@& 4    @՚@`  4 0@  "@ ? ," 8 $  $ $ $  @ *`h *`@ *  *   4 $@ $  $  @ $ $  $U   $$ (!&`& & &`@`? @ *`3 *`@ *$@  4  $  $ $  $ @ *` *`@ *  *   4  $@ $ $  B$ @2 $ * 9$ $ (!&`& & &`@ ? @ *` *`@ *$@  4  $  $ ( #@ " ,"@#@   "$ 26  ,@   0 ( @ " ?" 2$ & 4@ 4 0@ "@ ? ,"  ,@   0 ( @ " ?" "&  ?+@  ,` ( ? $ $ 2=  ,@   0 ( @ " ?" 2+ & 4@ 4 0@ "@ ? ,"  ,@   0 ( @ " ?" 2  & & &`@` ?+@`{$`& 4`@j 0 4@  4& & &`@B $& & &`@8 & & &`@0?& & &`@(& & &`@ & & &`@& & &`@& &`@ & & &`@?`$  "`"@@" 4㿘`$`(€invalid distance codeinvalid literal/length code㿘` `4`0` `,  0 *. .`(   (( `  ? 6!. `6r!`!.`   6(    (  `6:!`: !(   !.`" `(& 6&. .  `,@  @. `(. Z!`@2  .`(( 1 @#@'(`!"` "`#P?`@`  .`((` ? 6!.& * 1 @8@'(`!"` "`#( #1  @8@'(`!"` "`#?!` >  1 @8@'(`!"` "`# '##"`4㿘 0 4@`  ,"`8 " ``"&`@&` 8 <& <&`0Ĕ ,@@ ' 4  (& 4 4`" 8 " ``"&`@&` 8 <& <&`0@&` & 042T4546<464647p44!4!4#04#84#4(4*4+84+4+4,x4 4$4 44 4 44 44 4444444   4x@` 0123456789abcdef/4 `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??4L 4A4[0!4L- 4Ő54m:4HC4qI4HR4L[4 f4#u4jz4 4 (44=@4p 4Ŕ 4Ř44v4tX 4Š44>4L+4,84Q0B4`K 4 X4RPc4p@k4v44M4p4|4V4J44(4O(4z4e 4$4$4 14(;4*F4eN4UY 4(f4!t48 4`4B04q4& 4h4>47444T4XH4Cx!4.4$< 4E4& S4+8] 4h4P(x44+4 44'4#044d4,x4iH48440 4h4 (+ 4p:4 F4U4X(^4h44r46<| 44644E04444H4W 44e47p4$44?t240G42TQ4a4x4m4v4w4,4?44h44 4x 4Ȁ4 4ȸ 4i4+ 4p*474c?4?(R4iZ4i 4ȼq4dy44;t4X4#4d 44W4444Wd4!4 D4  4#84@#4X* 424b94p@4lJ4V(U4 `4xo4|4444\|4$44A464h 4 4 4P4O<4\ 44W4L 4j&4L04_7 4T>4\E4Y 4Xh4o4j v4X}4, 4` 444h4G4q4 44a 4ɰ44y4  4ɴ  4ɸ 45 )4 94# I 48 O 4@ V4 ]4 d4 k4 z4 4 4 4 4 4 4 4( 4( 4( 4X 4 ( 4 ( *4 ( <4` H4 R4 a4 s4p 4À 4 4 4 4Ð 4 4ð 4 4 48 4 4 4 ,4x 64x E4x W4 `4# f4, l48 s4;( 4? 4Cx 4C 4G 4H 4Q0 4R 4U 4W 4W` 4W` 4W 4X( 4a 4b 4c 4d 4ep 4i 4i &4j .4j 54m ;4p@ D4p M4p U4q _4q h4q o4tX v4v }4w 4 4 4H 4 4p 4 4 _getsecs_rpc_fromaddr_open_dvma_mapin_gateip.rem_adler32.urem_sendudp_getprop_netif_put_nfs_getrootfh.div_devopen_socktodesc_obp_close_bp_getfile_inflate_codes_new_bp_server_addr_strtab_inflate_codes_free.umul.udiv_hostname_getchar_xdr_string_encode_inflate_trees_bits_nfs_readdir_in_cksum_pgofset_hostnamelen_arpwhohas_strcmp_net_close_inflate_trees_dynamic_inet_addr_strlen_inflate_set_dictionary_ether_sprintf_readudp_inflateSetDictionary_nfs_open_inet_ntoa_inflate_sprintf_netif_debug_freelist_netif_close_net_open_nfs_close_printf_sendether_file_system_cd9660_close_inflate_trees_fixed_swapip_rpc_pmap_putcache___ashrdi3_nfs_readdata_domainname_xdr_string_decode_ufs_readdir_putchar_inflate_copyright_arp_reply_zcfree_strncpy_netdev_sock_nfs_lookupfh_rpc_xid_nfs_readlink_nfs_read_strtablen_ip_convertaddr_obp_strategy_nfs_seekstart_nfs_root_node_nfs_mount_cd9660_write_inflateSyncPoint_prom0_iclose_nfs_stat_twiddle_rarp_getipaddress_hz_getdevtype_rootip_net_mountroot_rpc_pmap_list_prom_ioctl_inflate_codes_zcalloc_rpc_port_obp_xmit_ufs_read_promvec_ufs_seek_obp_recv_strerror_prom0_close_file_system_nfs_inflate_flush_arp_num_closeall_bootfile_vprintf_ufs_stat_prom0_strategy_prom_getether_xdr_inaddr_decode_inflate_blocks_free_ufs_open_nfs_stat_types_inflateEnd_netmask_inflateReset__rtt_rpc_call_inflate_blocks_sync_point_file_system_ufs_dvma_init_dvma_free_prom_boothow_prom_si_getpropstring_prom_bootdevice_memset_nfs_write_rootpath_cd9660_open_olseek_xdr_inaddr_encode_memcpy_get_crc_table_nameip_oclose_inflate_mask_bp_whoami_cputyp_cd9660_stat_pgshift_rpc_pmap_num_memcmp_prom0_iopen_inflate_fast_panic_cd9660_read_netif_open_prom_open_cd9660_seek_peekchar_etext_ifname_oopen_bzero_getticks_readether_prom_init_inflateInit2__inflateSync_ndevs_loadfile_dvma_mapout_read_inflate_blocks_reset_arp_list_rpc_pmap_getcache_ufs_write_prom0_recv_errno_sockets_esym_intoa_nbpg_nfsys_exit_main_free_sendrecv_lseek_debug_close_inflate_blocks_new_domainnamelen_crc32_alloc_edata_cngetc_fbuf_end_dvma_alloc_bcea_gets___main_netif_get_version_oread_prom_bootfile_file_system_cd9660_inflateInit__prom0_xmit_bp_server_port_dbuf_ufs_close_inflate_blocks_cd9660_readdir_myip_files_devswsrt0.oboot.ogcc2_compiled.___gnu_compiled_cconf.ogcc2_compiled.___gnu_compiled_cdvma.ogcc2_compiled.___gnu_compiled_cnet.ogcc2_compiled.___gnu_compiled_c_open_countnetif_sun.ogcc2_compiled.___gnu_compiled_c_netif_prompromdev.ogcc2_compiled.___gnu_compiled_c_filestore.6_bootstore.7_prom0_fake_saveecho_pv_putchar_sun4_idprom.44_dtab_stringbuf.51_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.60version.ogcc2_compiled.___gnu_compiled_ccd9660.onfs.oufs.orarp.obootparam.orpc.ostrncpy.ostrerror.ogets.onet.oin_cksum.oarp.oether.omemcmp.oglobals.oexit.ocloseall.ocread.oread.oopen.olseek.oclose.oprintf.omemset.omemcpy.oalloc.osdiv.orem.ostrcmp.ostrlen.obzero.oashrdi3.o__main.ourem.oudiv.oumul.oinflate.oinfblock.ocrc32.oadler32.oinftrees.oinfcodes.oinffast.oinfutil.o @ `  @D, @'!$@+#@  /@X / "% % @<@Ĕ@`Ƃd??/usr/libexec/ld.soNo ld.so Failure reading ld.so Bad magic: ld.so Cannot map ld.so crt0: update /usr/libexec/ld.so ld.so failed h#H`$   ǖ ? $             ?@ ?# @! ?܀a ?@ ?# @  ܀`     #H? " #\#`? ؀@  ?# @! 06@@! 2? ?c @ ̀@ 0%@ @ ̀@? ?c @! @ 0 @ @! @ #d#h0   #d#h0  #d#h  Ŕ  - !$#H? #H  (%  "`#H#\#`?؀@ ?# ! ! ?@ ?# @ ?L@`G?@ ?# @!  5@@! /? ?c @ ̀@ #@ @ ̀@? ?c @! @"  @ @! @# #@?? ?@ ?# @!  3 @@! -? ?c @ ̀@ ! @ @ ̀@? ?c @! @ `  @ @! @` @   #d#h  Ř s ?   (m  j䀢!   H`  #\#`#d#hHP?   (J  G#H$  $ !@ $ #H` $ ?2   @. ! ` ?2    h"   "#p@ "cp㿘#p€ 㿘#p "? @㿘#p€ 㿘#p ?Service unavailable㿐#p`  `  ?1 !H  @  *`:`J " _block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] 㿘!  @ ~b(@ s a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrap㿈@5/   +!#!)! ' % @ 1⸀?5? .* ,`,,,,,,,l,,,,,,t,,,,,,,,|a\%aH%!L$$@ a\"bH@ a\"bLxɐ! #& #!naH#`* @ "c !"`, !'"!X ' ' '   @ ۚ ?  @ גbȀ   b@ Ӕ  "  "ؐ"$aH #  # @ Ő"! , @ "!!X @ #!!H @ #1!!H @ b !H!"!L @ b؀ !H @ c0  ! "aL @ c8! ,@袒 !!@ t !X @    !X @ }cX#@ @ ` @  # 2"@!X  @ qch @ q  !X @ ZcX "@ k  b @ Mc@ c@ b耢   @ @c@ P nlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x 8#b@   #   b  "     @ ߰ 0@ ʒ  #X@ ؒ @ ג   @ Β0gȔ  D@ 4, D, 4` @< 2* @ *  @     (@ 0F@ : Ȁ ̀  @@ 03@ !!L    @!,# >?@?# @! a ?@ ?# @ ?M@`2H?@ ?# @! 2 6@@! 1? ?c @ ̀@2 #@ @ ̀@? ?c @! @"  @ @! @# #?? ?@ ?# @! 2 4@@! "/? ?c @ ̀@2 !@ @ ̀@"? ?c @! @   @ @! @2 ?@ ?# @! ?a? ?c @! @ ?+" @ @! @?!" " ? ?c @! @  @ @! @##? "? ?c @! @  " @ @! @" " b`! "D!`  ` "0  "c  P   x    @ i@ s@ S5 !  #  "T  @ 9!!L      ! @ + !@ '!!T"  @ !0@!&  & &@!!L `  %s: devread: lseek%s: devread: read㿘. >@   @"`@ @  `@ statfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect block8@    cX@ @  % aP@ H D #""@"LH#!"  `0* "@`0!!T'  a`@ r㈀ !x@ e`0  )!%bH!D㈑* , `"@ P `0 bH # @ C!0Ԑa@ 9   a@ 2   a@ 4@ \  a@ @ C   `@ @ %!#x !@ @ 0  @ a @ 8 @ 7   @ 1,@   @ - @ % x `" 0+@  d , @  x c*  0" 0 :`@ B @8 !!T ! a`@ɔ 0+ "c " @( (3!+aD d*@,`㈀`"a@ ` `  쀤+ c @!@c "8@X 0"X t@   -!'D d*@,`c`"@j `  t@ 뀤 # @X! a`@W 㿘bP   "P $"P?"P "P㿘 # #`   `   #, @?, @#㿘 cx  "cx &  @      㿘S @ & F` @  & & `@ & :`  @Ғ   @ € #@ C@ `@ €  #@ #@ @ ` #@ :  @ & F` @  & & `@ & :`w ?p #@? ?#   2@   @2 "@  T R . 3 + 6 . 6  .   @ "B ` @  ""€ `@ ":` ;  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@82     `pI`|6`'x81`*\``Jt``(`!t`0``|aHa NaMa$7`a0+Pa<BaH",aTa`Hal tax=HaL@a)\a@a-Pa$aa ;(4B%/ =#M->6?!@))&! 6 % $'( B"5*2 ,"I#+$C&-'1*3.+<,0.E/:0H1L27485A7P899:<F=>K?@ACGDOEDGNHIJJKLMNOPQRST` )a" (0(h8a>bSal[bxb(`aa )\`bX?  `aT?1`9`A JbV dbLo`xaH  cb``a`a0 ,abT1X 0 (Q/ @8`|@a$FbHP D]cj:hyaxA Ha La< P T@a``p`+aaa ( cH X `@" \__DYNAMIC_dlctl_err__err_open_boot_optind_dlopen.urem__GLOBAL_$F$__cmpdi2_calloc__GLOBAL_$F$_exit_dummy_decl__exit_dummy_decl_dlclose_getopt.umul.udiv_verbose_dlerror__errx__GLOBAL_$F$__do_global_dtors___do_global_dtors___DTOR_LIST_____CTOR_LIST___strcmp__warn___do_global_ctors_printf_sysctl_nowrite___progname_block_size_p_isofseblk_strncmp__warnx_cpumodelstart__GLOBAL_$F$__udivdi3_nl_strerror__err_fstatfs_fprintf_write_proto_malloc__exit_dummy_ref_loadprotoblocks_block_count_p___sF_warnx__warnx_etext_environ_atexit_sync_isofsblk_block_table_warn__warn_loadblocknums_read___udivdi3_karch_fsync_hflag_nlist_errno_max_block_count_errx__errx___cmpdi2_fstat_exit_atoi_main_free_lseek_close_dlsym_edata_dev_end___main_optarg@Qc``(Q```dE FI(Nx0@t``㿠㿠㿠㿠㿠㿠㿠㿠 㿠 㿠 㿠 㿠 㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠㿠$OpenBSD: crt0.c,v 1.2 1997/06/24 17:15:53 tholo Exp $cl**)b|e  e?P - e4? - eP@( - e|e  e @8|e  e|e  eA@ - edumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: unknown|unknown terminal type:\ :gn:tc=dumb: pcvtXX|pcvt vt200 emulator (DEC VT220):\ :am:km:mi:ms:xn:\ :it#8:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:\ :ac=++\054\054--..00``aaffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:im=\E[4h:\ :k1=\E[17~:k2=\E[18~:k3=\E[19~:k4=\E[20~:k5=\E[21~:\ :k6=\E[23~:k7=\E[24~:k8=\E[25~:kD=\E[3~:kH=\E[4~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:\ :r1=\Ec\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m:\ :ve=\E[?25h:vi=\E[?25l: pcvt25|dec vt220 emulation with 25 lines:\ :co#80:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28|dec vt220 emulation with 28 lines:\ :co#80:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35|dec vt220 emulation with 35 lines:\ :co#80:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40|dec vt220 emulation with 40 lines:\ :co#80:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43|dec vt220 emulation with 43 lines:\ :co#80:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50|dec vt220 emulation with 50 lines:\ :co#80:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: pcvt25w|dec vt220 emulation with 25 lines and 132 cols:\ :co#132:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28w|dec vt220 emulation with 28 lines and 132 cols:\ :co#132:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35w|dec vt220 emulation with 35 lines and 132 cols:\ :co#132:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40w|dec vt220 emulation with 40 lines and 132 cols:\ :co#132:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43w|dec vt220 emulation with 43 lines and 132 cols:\ :co#132:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50w|dec vt220 emulation with 50 lines and 132 cols:\ :co#132:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: pc3|IBM PC BSD/386 Console:\ :tc=bsdos-pc: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt100nam|vt100-nam|vt100 no automargins:\ :am@:xn@:tc=vt100-am: vt100-vb|dec vt100 (w/advanced video) & no beep:\ :bl@:vb=\E[?5h\E[?5l:tc=vt100: vt100-w|vt100-w-am|dec vt100 132 cols (w/advanced video):\ :co#132:li#24:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-am: vt100-w-nam|vt100-nam-w|dec vt100 132 cols (w/advanced video no automargin):\ :co#132:li#14:vt@:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-nam: vt100-nav|vt100 without advanced video option:\ :sg#1:\ :mb@:md@:me@:mr@:sa@:se=\E[m:so=\E[7m:ue@:us@:tc=vt100: vt100-nav-w|vt100-w-nav|dec vt100 132 cols 14 lines (no advanced video option):\ :co#132:li#14:tc=vt100-nav: vt100-s|vt100-s-top|vt100-top-s|vt100 for use with top sysline:\ :es:hs:\ :li#23:\ :cl=\E[2;1H\E[J:cm=\E[%i%+^A;%dH:cs=\E[%i%i%d;%dr:\ :ds=\E7\E[1;24r\E8:fs=\E8:ho=\E[2;1H:is=\E7\E[2;24r\E8:\ :ts=\E7\E[1;%p1%dH\E[1K:\ :tc=vt100-am: vt100-s-bot|vt100-bot-s|vt100 for use with bottom sysline:\ :es:hs:\ :li#23:\ :ds=\E7\E[1;24r\E8:fs=\E8:is=\E[1;23r\E[23;1H:\ :ts=\E7\E[24;%p1%dH\E[1K:\ :tc=vt100-am: vt102|dec vt102:\ :mi:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4l:im=\E[4h:tc=vt100: vt102-w|dec vt102 in wide mode:\ :co#132:\ :r3=\E[?3h:tc=vt102: vt102-nsgr|vt102 no sgr (use if you see snowflakes after highlight changes):\ :me=\E[m:sa@:\ :tc=vt102: vt125|vt125 graphics terminal:\ :cl=\E[H\E[2J\EPpS(E)\E\:tc=vt100: vt131|dec vt131:\ :am:bs:xn:\ :co#80:it#8:li#24:vt#3:\ :RA=\E[?7h:SA=\E[?7h:bl=^G:cd=50\E[J:ce=3\E[K:\ :cl=50\E[;H\E[2J:cm=5\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :do=^J:ho=\E[H:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=2\E[5m:md=2\E[1m:\ :me=2\E[m:mr=2\E[7m:nd=2\E[C:nw=^M^J:\ :r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:sc=\E7:\ :se=2\E[m:so=2\E[7m:sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:\ :us=2\E[4m: vt132|DEC vt132:\ :xn:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4h:im=\E[4l:ip=:sf=\n:tc=vt100: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\EOB:kh=\E[1~:kl=\EOD:kr=\EOC:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: vt220-w|vt200-w|DEC vt220 in wide mode:\ :co#132:\ :r3=\E[?3h:tc=vt220: vt220d|DEC VT220 in vt100 mode with DEC function key labeling:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:k5@:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :tc=vt220: vt220-nam|v200-nam|VT220 in vt100 mode with no auto margins:\ :am@:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: vt220-8|dec vt220 8 bit terminal:\ :am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:bl=^G:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%dX:\ :ei=\E[4l:ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=\177:kd=\EOB:kh=\E[H:kl=\EOD:kr=\EOC:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :nw=\EE:rc=\E8:sc=\E7:se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:\ :st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: vt200-js|vt220-js|dec vt200 series with jump scroll:\ :am:\ :co#80:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:dm=:do=^J:ed=:\ :ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E[61"p\E[H\E[?3l\E[?4l\E[?1l\E[?5l\E[?6l\E[?7h\E[?8h\E[?25h\E>\E[m:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kb=\177:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :nw=^M\ED:r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :rf=/usr/share/tabset/vt100:se=5\E[27m:sf=\ED:so=5\E[7m:\ :sr=\EM:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m: vt320nam|v320n|DEC VT320 in vt100 emul. mode with NO AUTO WRAP mode:\ :am@:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: vt320|vt300|dec vt320 7 bit terminal:\ :am:es:hs:mi:ms:xn:\ :co#80:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%dX:\ :ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:sc=\E7:se=\E[m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ts=\E[1$}\E[H\E[K:ue=\E[m:\ :up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: vt320-nam|vt300-nam|dec vt320 7 bit terminal with no am to make SAS happy:\ :am@:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :r2=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320: vt320-w|vt300-w|dec vt320 wide 7 bit terminal:\ :co#132:ws#132:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :r2=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320: vt320-w-nam|vt300-w-nam|dec vt320 wide 7 bit terminal with no am:\ :am@:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :r2=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320-w: vt340|dec-vt340|vt330|dec-vt330|dec vt340 graphics terminal with 24 line page:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=\E[L:as=^N:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=\177 kcub1=\EOD:kd=\EOB:\ :ke=\E[?1l\E>:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:\ :l3=pf3:l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:\ :nd=\E[C:nw=^M\ED:r1=\E[?3l:rc=\E8:\ :rf=/usr/share/tabset/vt300:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ts=\E[2$~\E[1$}\E[1;%dH:\ :ue=\E[24m:up=\E[A:us=\E[4m:vb=200\E[?5h\E[?5l:\ :ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt400|vt400-24|dec-vt400|dec vt400 24x80 column autowrap:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:\ :cd=10\E[J:ce=4\E[K:cl=10\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:fs=\E[$}:ho=\E[H:\ :ic=\E[@:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:rc=\E8:sc=\E7:se=\E[27m:\ :sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=200\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt420|DEC VT420:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\E[B:ke=\E>:kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/share/tabset/vt300:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt420pc|DEC VT420 w/PC keyboard:\ :@7=\E[4~:F1=\E[23~:F2=\E[24~:F3=\E[11;2~:F4=\E[12;2~:\ :F5=\E[13;2~:F6=\E[14;2~:F7=\E[15;2~:F8=\E[17;2~:\ :F9=\E[18;2~:FA=\E[19;2~:FB=\E[20;2~:FC=\E[21;2~:\ :FD=\E[23;2~:FE=\E[24;2~:FF=\E[23~:FG=\E[24~:FH=\E[25~:\ :FI=\E[26~:FJ=\E[28~:FK=\E[29~:FL=\E[31~:FM=\E[32~:\ :FN=\E[33~:FO=\E[34~:FP=\E[35~:FQ=\E[36~:FR=\E[23;2~:\ :FS=\E[24;2~:FT=\E[25;2~:FU=\E[26;2~:FV=\E[28;2~:\ :FW=\E[29;2~:FX=\E[31;2~:FY=\E[32;2~:FZ=\E[33;2~:\ :Fa=\E[34;2~:Fb=\E[35;2~:Fc=\E[36;2~:\ :S6=USR_TERM\072vt420pcdos\072:k1=\E[11~:k2=\E[12~:\ :k3=\E[13~:k4=\E[14~:k5=\E[15~:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:k;=\E[21~:kD=\177:kh=\E[H:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\:tc=vt420: vt420pcdos|DEC VT420 w/PC for DOS Merge:\ :li#25:\ :S1=%?%p2%{19}%=%t\E\023\021%e%p2%{32}%<%t\E%p2%c%e%p2%{127}%=%t\E\177%e%p2%c%;:\ :S4=\E[?1;2r\E[34h:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:S6@:\ :me=\E[m:sa@:\ :tc=vt420pc: vt420f|DEC VT420 with VT kbd; VT400 mode; F1-F5 used as Fkeys:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:\ :k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :kD=\177:kh=\E[H:l1=\EOP:l2=\EOQ:l3=\EOR:l4=\EOS:\ :tc=vt420: vt510|DEC VT510:\ :tc=vt420: vt510pc|DEC VT510 w/PC keyboard:\ :tc=vt420pc: vt510pcdos|DEC VT510 w/PC for DOS Merge:\ :tc=vt420pcdos: vt520|DEC VT520:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k0=\E[29~:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:r3=\E[?67h\E[64;1"p:\ :rc=\E8:rf=/usr/share/tabset/vt300:sc=\E7:se=\E[m:sf=\ED:\ :so=\E[7m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: vt525|DEC VT525:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k0=\E[29~:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:r3=\E[?67h\E[64;1"p:\ :rc=\E8:rf=/usr/share/tabset/vt300:sc=\E7:se=\E[m:sf=\ED:\ :so=\E[7m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: sun-il|Sun Microsystems console with working insert-line:\ :am:km:ms:\ :co#80:li#34:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:IC=\E[%d@:\ :K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ic=\E[@:im=:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kD=\177:kN=\E[222z:kP=\E[216z:kb=^H:kd=\E[B:kh=\E[214z:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:md@:me=\E[m:mr=\E[7m:nd=\E[C:\ :r2=\E[s:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;m:\ :se=\E[m:sf=^J:so=\E[7m:ta=^I:u8=\E[1t:u9=\E[11t:ue@:\ :up=\E[A:us@: sun-ss5|Sun SparcStation 5 console:\ :AL@:al@:tc=sun-il: sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :tc=sun-il: sun-s|Sun Microsystems Workstation window with status line:\ :hs:\ :ds=\E]l\E\:fs=\E\:ts=\E]l:tc=sun: sun-e-s|sun-s-e|Sun Microsystems Workstation with status hacked for emacs:\ :hs:\ :ds=\E]l\E\:fs=\E\:ts=\E]l:tc=sun-e: sun-48|Sun 48-line window:\ :co#80:li#48:tc=sun: sun-34|Sun 34-line window:\ :co#80:li#34:tc=sun:@Z@  oH gH cH _HJHdH SH GH OH GH CH ?H ;H 7H 3H /H  H H H  H H  H H H H H H H ܡH ءH &H H !H "H #H $ߡH %ۡH &סH 'ӡH (ϡH )ˡH *ǡH +áH ,H -H .H /H 0H 1H 2H 3H 4H 5H 6H 7H 8H 9H :H ;H <H ={H >wH ?sH @oH AkH BgH CcH D_H E[H FWH GSH HOH IKH JGH KCH L?H M;H N7H O3H P/H Q+H R'H S#H TH UH VH WH XH Y H ZH [H \H ]H ^H _H `H aH bH cH dߡH eۡH fסH gӡH hϡH iˡH jǡH káH lH mH nH oH pH qH rH sH tH uH vH wH xH yH zH {H |H }{H ~wH sHH kH gH cH _H [H WH SHHH GH CH ?H ;H 7H 3H /H +H 'H #H H H H H H  H H H H H H H H H H H ߡH ۡH סH ӡH ϡH ˡH ǡH áH H H H H H H H H H H H H H H H H H {H wH sH oH kH gH cH _H [H WH SH OH KH GH CH ?H ;H 7H 3H /H +H 'H #H H H H H H  H H H  H  H  H  H  H  H  H  H  ߡH  ۡH  סH  ӡH  ϡH  ˡH  ǡH  áH  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  {H  wH  sH   H  gH  cH  _HJHdH  SH  GH  H  GH  CH  ?H  ;H  7H  3H  /H   H H H   H  H   H  H  H  H  H  H  H  ܡH  ءH WH  H ! H " H # H $ ߡH % ۡH & סH ' ӡH ( ϡH ) ˡH * ǡH + áH , H - H . H / H 0 H 1 H 2 H 3 H 4 H 5 H 6 H 7 H 8 H 9 H : H ; H < H = {H > wH ? sH @ oH A kH B gH C cH D _H E [H F WH G SH H OH I KH J GH K CH L ?H M ;H N 7H O 3H P /H Q +H R 'H S #H T H U H V H W H X H Y H Z H [ H \ H ] H ^ H _ H ` H a H b H c H d ߡH e ۡH f סH g ӡH h ϡH i ˡH j ǡH k áH l H m H n H o H p H q H r H s H t H u H v H w H x H y H z H { H | H } {H ~ wH  sH H  kH  gH  cH  _H  [H  WH  SH H H  GH  CH  ?H  ;H  7H  3H  /H  +H  'H  #H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  ߡH  ۡH  סH  ӡH  ϡH  ˡH  ǡH  áH  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  {H  wH  sH  oH  kH  gH  cH  _H  [H  WH  SH  OH  KH  GH  CH  ?H  ;H  7H  3H  /H  +H  'H  #H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  ߡH  ۡH  סH  ӡH  ϡH  ˡH  ǡH  áH  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  {H  wH  sH   H  gH  cH  _H JH dH  SH  GH H  GH  CH  ?H  ;H  7H  3H  /H  H  H  H  H  H  H  H  H  H  ݡH  ١H  աH  ѡH  ͡H  H H H "H #H $ߡH %ۡH &סH 'ӡH (ϡH eH ǡH +]H ,H -H .H /H 0H 1H 2H 3H 4H 5H 6H 7H 8H 9H :H ;H <H ={H >wH ?sH @oH AkH BgH CcH D_H E[H FWH GSH HOH IKH JGH KCH L?H M;H N7H O3H P/H Q+H R'H S#H TH UH VH WH XH Y H ZH [H \H ]H ^H _H `H aH bH cH dߡH eۡH fסH gӡH hϡH iˡH jǡH káH lH mH nH oH pH qH rH sH tH uH vH wH xH yH zH {H |H }{H ~wH sHH kH gH cH _H [H WH SHHH GH CH ?H ;H 7H 3H /H +H 'H #H H H H H H  H H H H H H H H H H H ߡH ۡH סH ӡH ϡH ˡH ǡH áH H H H H H H H H H H H H H H H H H {H wH sH oH kH gH cH _H [H WH SH OH KH GH CH ?H ;H 7H 3H /H +H 'H #H H H H H H  H H H H H H H H H H H ߡH ۡH סH ӡH ϡH ˡH ǡH áH H H H H H H H H H H H H H H H H H {H wH sH >;;;;; ;(;0;8H )@`  >! !3 >00+0;"+(+0΁` 0΁1 !>&;8>0)@09`")@ )@0΁` 0΁1"; > 9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P-> %)> x %"+/> ->+cP>[!`"!#t@>)#;x ;"`;" @D@Ҋ@@2 @ 0P -@ @ @"P/> P-> %)> x %"+/> ->+cP>[!`"!#t@;x҂@ ;Ԃ@`;"i  ւ@ ؂@ " +?P `* -` @t x ``-` @ tx  P -@ @ @"P/> P-> %)> x %"+/> ->+cP>[!`"!#t@;x;>!,; ;`#h#l;;;;@R``htxp ;`#h#l;;;;@``htxW )>)!d@)>)! P -@ @ @"P/> P-> %)> x %"+/> ->+cP ;`@;h#t;x;;;;;`@P;`htx />p->+cPۜP -@ @ @"P/> P-> %)> x %"+/> ->+cP ;`@;h#t;x;;;`;;@;`htxʁ -?P -@-P -@ @ @"/>p/> />p6PP-> %)> x %"/>p/> />pP;x>[!`"!@;,/,;@ ;`,)>!;h %)>  #p "`@ xy  +?P`-@-?P- %0P -@ @ @"/>p/> />p6PP-> %)> x %"/>p/> />pP;x>[!`"!@;,/,;@ ;`,)>!;h %)>  #p "`@ @`x P -@ @ @"/>p/> />p6PP-> %)> x %"/>p/> />pP>[!`"!?P * * ;`@;h09P -@ @ @"/>p/> />p6PP-> %)> x %"/>p/> />pP>[!`"!?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@`h ?P `*  P -@ @ @"/>p/> />p6PP-> %)> x %"/>p/> />pP>[!`"!?p " ?P "  ;`@>!,;h@`h ?p " a @/>  @̀-> $)> x %->+cP-> JP @ H ,@`#>`$` (08 @̀;)> 00+0;"+0+0 `  05-! % >&p 8 >0-@0=`"-@-@0 `  05-"U  ->%- +cP ;`@;h #t;x;`;;;;@;`htx ->& 0! H,@` !`hpx (08@HPX @̀H,@`%> $ (08 @̀@ @̀  H ,@`#>`$` (08@̀X2P?@ @̀;'>00/0?"/0/0 `  05-!$>& 8>0-@0=`"-@-@0 `  05-"  ?  H,@`#>` $` (08@̀ ->  @{P->"/>74  ! H,@` ! (08@HPX @̀>x `?* `"" * `@">  * `@&* *  ֊@* "``'1@'0@ )>+>%@#'$(  `   c  mt@ >   >  @@   >  @@ #>%> d`@%  '`@`@ 7  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%bt@>" >" ( *>" ,!`>" 0H(  /  >x ==>PH >" 4>">d`@+?"@!>2$"H``>)"c  !>%#\!>'"P$ $ >%#| 2> " > " > " > "! >#""p>#"">#"">#"#>$"!>$"!>$""$>$""L>)""L>)""T0>*"!ā@u @Id#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP   d#@+`;h;p;x;;;;;;;;;;;;;@H@@ `hpx d P   > *>& >&@;"pcopyinstr>@ * > >&@-"copyoutstr >&c #  J@*@`  ?"@ 2"#   J*@`4  ?"@ 2">&@#pcopystr> * > >@ *> >&#Ԏ@" >" >"   >4``6  >p` >  !!`>w @D>% P`" P>[!`"! >' >>!p`2$j0>'@䦐 >'@䣐 >'@䠐 switch rqswitch wchanswitch SRUN>' >: H>p" (o!p`j>L >@:">)Ē"2J "2 J    "2 J  J " >2a+  @ #@"   *@ * hH- >B"!d `!p"C"j >* `" j ` *@  ( !>0!` (08 2㿠@>`` Ъ@@"Т@: H"  h`>   >>'" " " ?" ?> >>'" " > >>'" " > >>'" " > ؀ >>'" "" > >>'" 2" > >>'" 2" > >>'" *" >>'c" `2 `2`2" >>'c" `2*`22`2"" @>'c" Њ@" " @""@" "`""@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"` 2@"" R"`2@"" "`"@"" R"`2@2J?*H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x 0000H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$Ԃ#҂@"$Ԃ#҂@"$Ԃ#҂@"$Ԃ#҂@%ւ&؃$Ԃ#҂@%ւ&؃>)Ē "2 J "2 J   "2 J  J a>` """"""""""""""""@2?# * 2  `c  @ `>L? @ 3 >!\ c@  Њb@&""""  >c @ @>)c ``44: " longjmp botch@" `&"`㿠>*@"6 0drivevectoffsetslotluntargetphyleveladdrstates->%s%sGOT_BUS GOT_TGT SENT_CDB XFRD_DATA GOT_STS GOT_SNS XFR_CMPLT status->Disconnect Sync_xfr Parity Bus_Reset Device_Reset Aborted Timeout Negotiation Config WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNon-Participating0x%xPort DiscoveryWaiting Port Discovery ACKPort LoginWait Port Login ACKProcess LoginWait Process Login ACKLogged InPort UnavailableProcess LogoutWait Process Logout ACKPort LogoutWait Port Logout ACK21001080%s: unknown chip rev. 0x%x- assuming a 1020 10201020A10401040A1040B%s: Differential Mode %s: Ultra Mode Capable chip reset timed out%s: MBOX_BUSY never cleared on reset NOP test failedMailbox Register test didn't completeRegister Test Failed%s: F/W download failed at word %d ram checksum failure%s: skipping f/w download failed to set CLOCKRATE%s: setting input clock to %d ABOUT FIRMWARE command failed%s: Board Revision %s, %s F/W Revision %d.%d loadedresident%s: in 64-Bit PCI slot %s: Last F/W revision was %d.%d 㿈 f  X . f*@(& X2   T`@  7@ܒ@6 ^* @6 ^ X & X T`@ [  >+!2  T>+! ` 2 @ v"@ `€  ?` >+>,!*` ! @Д>+"  . [ (>+"( . [ (>+"0  >+"8 >+"@ . [ <4` T€`v! >+"H@઒ @  @ *@$@ T€` *  Xa2  >+"`@  <4`@@  # @ @@*@$@ T ," `@*4` T `" [@ [   T  d T `"  T `B  T   d T `   T `@  T `  # [  T@  T@ € "  Tv d?< [>+@bx0   T`@` d [ 1  T`* @€  *`2  T! @€   *`2 T! @€ @  @*`2`.`0 T T`@  T `" [@ [  T    T #>+ # T@€* 2  2 7 d?< Tb@ߡ 0@e@>+@'b0 [ > 77"7/"7?7!7)!7@F耢>+@ b07"@/"@?#@!@)!@>+@b0 T $ "  Y  "5 X T $ /   7 T &7 T` ,  @7@>+ T $   7 T`&@7@>+@c00{ X2  >+#H@   7 T & "7@Ȓ [ "  `   47 @7@>+@{ch   X2  >+# @ܒ  7@@>+@bc05>+# >+#>+# @޿ [   T@€  >, @ޱ  ^* @* 6 \>,  2@ޠ @J f  . f%s: can't setup dma mailboxes failed to set initiator idfailed to set retry count and delayfailed to set async data setup timefailed to set active neg statefailed to set tag age limitfailed to set selection timeout%s: failed even to set defaults for target %d %s: failed to set device queue parameters for target %d, lun %d set of response queue failedset of request queue failed㿈@ސ T @ >."@! 0  [ " `@)02   `. T 072 @ 7>.@b0 27 7 @ 7耤@>.@}b0֐ 672 @ 7耤>.@lc0Ő 572*2  @ 7耤@>.@Xc(0 37 @ 7耤>.@IcH0 17@ w7耢@>.@:ch0 91 6 8  9 6N \! 7777@ U耢!7777@ J耢>.# @y-# @r"4 \   67772 @ "7耢>. &7*@$``! 7 7!|7!~77@ 7>/@Œ`0. l 7 @7!x7!z77@ 7耢>/@` 0. j j. k f  . f%s: bad frame length (%d) from NVRAM- using %d %s: too many retries to get going- giving up INIT FIRMWARE failed㿈  `"h 8@  .!C666?* 2 '@>0  @ؖ$6 6 .  .  q6.+ 3`3 .+ 3`3 .+ 3`3 .  .3  .3  . @ 2 $. @.* 2`2 .* 2` 2 .* 2` 2 . .2 . . .  @6$ 6&!z6(!x 6* "l!~60 !| 62 `777 7777@ -7耢@    @ @>0 @   @  @    >0 @@ 0>0@ϒa0  Ȑ `/ j j/ k/ l f / f f  / f.  ` h72 V*2 2 %s: Firmware State %s -> %s %s: GET LOOP ID failed %s: Loop ID %d, ALPA 0x%x 㿈 `  >1  >"@ ` c'>1!P* p|ňŔŠŬŸ>+ h>+ x>+ >+ >+ >+  >+  >+ Ȑ>+@` ` `( >1" *` ,8DP\htƀ>+ h>+ x>+ >+ >+ >+  >+  >+ Ȑ>+@Ò`@ۑ ` `  ܐ dd-Ɛ" ` 2? 7@ D@>1>1 ,`  `,` @l   @g ?%s: adapter not ready %s: unsupported cdb length (%d) %s: Request Queue Overflow %s: Request Queue Overflow+ %s: out of xflist pointers %s(%d.%d): START%d cmd 0x%x datalen %d 㿈 % ,  f2   >1#h@# 7  [  `4>1 ` >1# @ %  [ $ ` `* *      @7"@  `ؔ  % ,  f " T@ڐ T@+€`, j j k /` ?/ `!p*`  X2  Q>1M# f $@  , ,` ,`  T``, k` ?2 / X2  />1+#Ȑ `!p* @@k @ ,@ [  ,`,`,` m`, m,`p @?@, X2  >1#@z  % ,{ " p$` [ " % (  `* @`("4`   "4`  4`  ,` [  ,`  4` ,`   ` X2     ` `   $>2 @<#\ @#4`*     4` f `  4` T @ ," p% , T`, k h h2   h*  `@4 h f  f , f %s: isp_control unknown control op %x isp_control SCSI bus reset failed%s: driver initiated bus reset Target Reset Failed%s: Target %d Reset Succeeded %s: isp_control- cannot find command to abort in active list %s: isp_control MBOX_ABORT failure (code %x) %s: command for target %d lun %d was aborted 㿈 >3"|* Μ(Ϝl|>3i! f , f 7 [   ` 7 7@ L@>3@ a0`?>3!X@u Z  7.7 7@ 3@>3@ axG?>3! @[ f  , f0< `p @  ?` @ >3!@E *?7   * 7 :7@7>3!@- ? `>3 `" @$   @  %s: isp_intr isr=%x %s: isp_intr sees 0x%x why intr? isr %x iptr %x optr %x %s: not RESPONSE in RESPONSE Queue (type 0x%x) @ idx %d (next %d) %s: rqs_flags=%x%s: internal queues full %s: bad header %s: bad request packet %s: bad request handle %d %s: NULL xs in xflist (handle %x) %s: unknown return %x %s: cnt %d rsd %d %s: ARQ failure for target %d lun %d %s(%d.%d): FIN%d dl%d resid%d STS %x Skey: %x BUT NOT SET XS_ERR=0x%x  T @€  [`,`2  `0,`2 `2 T"  X2  >4 @v  @€ K T@€@ *`2  >4 @]  T  4*`@H2` T  &?* p" p$ ( $  , X T  h2   -  h h2 ? h*  `@6 h- x"   T`@ l T` €/ww 2 [ X2  >4 ,`2`@  [  T    T w >+   /w !t, @ ` @w"G T ` 2C T>4   w@Τ `  25 T>4!0@Ē ` >4!H@׽ ` >4!h@׵ ` >4!x@׭` ?* >4!@ף  T p 2" p>4!@ט @  T`w` w`  f . f $ , ` , X [ ` @`  4֔  $ ,` " , f . f  `*  " ` 2  , $ ,`  4 `  4`  , 2 ` X 2 ` $ , `>4 , 2 [` @. [ $ ,!@5  , 2 [ $ , [ "``$ ((" $`$ ( X2  >4 $!`@  $ " X T ` X2 X ,  2  X `>4 `"@ $ , X2  4  ' , # ` $    (>4#\ X"0@#`` @" ,>4 6@֐"X , " ,>4@ϐ"h ,>4@ː"x h2   -  h h2 ? h*  `@6 h- x"  w ʤ w T`  T€`. j w@. l x,` "` `@" `@,` %s: Internal FW Error @ RISC Addr 0x%x %s: Request Queue Transfer Error %s: Response Queue Transfer Error %s: timeout initiated SCSI bus reset %s: device reset %s: extended message underrun %s: SCAM interrupt %s: stalled SCSI Bus after DATA Overrun %s: SCSI Bus reset after DATA Overrun %s: LBD->HVD Transition 0x%x %s: fast post completion of %u %s: CTIO done %s: LIP occurred %s: Loop RESET %s: Port Database Changed %s: unknown async code 0x%x 㿘   <   >6   d >7  \  h>6>7 w>6    _  c>7Ő  h>6  e>6>7    "_[>6  >7  >7  "      >7  I  !"`>7>7 @O 0! T€`* >6"Ȓ @Մ2@ $v?k"i# T€`j>6#@@p  f . faG#hT#R#>6O#M#`!>7 T € * F2 T€` T€`, * 2  X2` ``2>7 0 +# P `  f * f@0  @ >7 x f . f@0 f`. f>7 @   @ %s: other response type %x %s: Request Queue Overflow other response 㿘`>8? @  %s: Selection Timeout for target %d %s: command incomplete for target %d lun %d, state 0x%x %s: DMA error for command on target %d, lun %d %s: transport error %s: bus reset destroyed command for target %d lun %d %s: command aborted for target %d lun %d %s: command timed out for target %d lun %d %s: command overrun for command on target %d, lun %d %s: status overrun for command on target %d, lun %d %s: message not COMMAND COMPLETE after status on target %d, lun %d %s: No MESSAGE OUT phase after selection on target %d, lun %d %s: EXTENDED IDENTIFY failed on target %d, lun %d %s: target %d lun %d rejected INITIATOR DETECTED ERROR message %s: target %d lun %d rejected ABORT message %s: target %d lun %d rejected MESSAGE REJECT message %s: target %d lun %d rejected NOP message %s: target %d lun %d rejected MESSAGE PARITY ERROR message %s: target %d lun %d rejected BUS DEVICE RESET message %s: target %d lun %d rejected IDENTIFY message %s: target %d lun %d had an unexpected bus free %s: HBA attempted queued transaction with disconnect not set for target %d lun %d %s: HBA attempted queued transaction to target routine %d on target %d %s: HBA attempted queued transaction for target %d lun %d when queueing disabled %s: invalid IOCB entry type detected %s: internal queues full for target %d lun %d status 0x%x %s: SCSI phase skipped (e.g., COMMAND COMPLETE w/o STATUS phase) for target %d lun %d %s: Auto Request Sense failed for target %d lun %d %s: Wide Negotiation failed for target %d lun %d %s: SDTR Message failed for target %d lun %d %s: Bad LVD Bus condition while talking to target %d lun %d %s: Port Unavailable for target %d %s: port logout for target %d %s: port changed for target %d %s: port busy for target %d %s: comp status %x ` `+#>: ܓ*` h0h,D\tLL 8p LLLLLL,` ">8 X2  >8 `!P@˒  !x   +  @3 ݐ  `>8 `!>8!@ҵ x>*@ޒcP` !x>*c`>*@Ԗh` "x>*c`>*@ʖx` $x>*c`>*@` (x>*c`>*@Ҷ` @ x>*c`>*@ҫ` @x>*c`>*@Ҡ` @x>*c`>*@ҕȐx>*c`>*@Ҍx>*@҆` x>*@}` x>+@t` x>+@k` x>+@b` x>+@Y(` x>+@P8` @x>+@GH` x>+@>Xx@9@ x&  X2  >8 ` `"@  f . f  `>8 `"8 X2  >8 ` `"h@   [  `&( `>8 `Ȑ" `>8 `" `>8 `# `>8 `#P `>8 `# `>8 `# `>9 `  `>9 ` 8 `>9 ` p `>9 `  `>9 `  `>9 `! `>9 `!H [ "&,`&&( `>9 `s! `>9 `m! `>9 `g" >9"x@q   `>9 `"X@g X  &, `>9 `M" `>9 `G#8 `>9 `#p@N  [ "i&, f . f  `*` `?Ȑ*2` *  " `>9 `#@.  [ H  f . f  `*` `?Đ*2` *  2" `>9 `#@ *  X2  >: ` @   >: ` @@   >: `  ` >: ` @  >: ` @  &,%s: fast posting handle 0x%x not found 㿘`* p " p><!p@ɒ 0$ ( $  , X T  `@" %s: bad command %x %s: no parameters for %x %s: isp_mboxcmd could not get command started %s: isp_mboxcmd timeout #2 %s: isp_mboxcmd timeout #3 %s: isp_mboxcmd timeout #4 %s: mbox cmd %x failed with INVALID_COMMAND %s: mbox cmd %x failed with HOST_INTERFACE_ERROR %s: mbox cmd %x failed with TEST_FAILED %s: mbox cmd %x failed with COMMAND_ERROR %s: mbox cmd %x failed with COMMAND_PARAM_ERROR %s: mbox cmd %x failed with error %x 㿘@  76@ $s><" >"0 `2   ><"8@ 0   T@^ d  T % # T@€@ "G?K d T@€ ( T@€ @*`ܓ2` T   T@ ǐ0Ó*`@" T< T  T   T@`N>="<*` <|\` T`6``  T` 6` `  T` 6` ` T`6`` T`6`` T`6`` T`6` T`@6@ T`@ T   [  T    T  @ T 0#P T@€ @  0쇐 d< T><"#P T@€  v d T@€ < T><ܐ" # T@€*2 `  ><0" T   T`@ ; d T`F>>!x*` \@$ T€`6` T€` 6`  T€` 6`  T€`6` T€`6` T€`6` T€`6` T@€6@ T`@ T  @ @<><  @") X" @)>< @& `A` @    @F @ `2` @$  @8 `(`2  1><"#><#P # ` d$ j )><# @D00><"X"@: 0@ ><`><# @@+couldn't GET FIRMWARE STATUS%s: %d commands on completion queue couldn't GET DEVICE QUEUE STATUS%s: lost command for target %d lun %d, %d active of %d, Queue State: %x lost command㿀 7@>?/`Pꀢ>? p@ߒ `'` # 7`   * 7耢>?``    >? @ͼ#\>?a@J%s: %s biu_conf1=%x biu_csr=%x biu_icr=%x biu_isr=%x biu_sema=%x risc_hccr=%x cdma_conf=%x cdma_sts=%x cdma_fifostat=%x ddma_conf=%x ddma_sts=%x ddma_fifostat=%x sxp_int=%x sxp_gross=%x sxp(scsi_ctrl)=%x mbox regs: %x %x %x %x %x 㿘>?"  @i [   T!>?"(  T!>?"@€%>?* @T2`  T€P*  T €4`*  T €4 * @:2'@ T!>?€"x* @.2` [ g T@ `  T%>?€*   T`$€4`*   T`&€4 * @2 `@ T%>?€*   T`D€4`*   T`F€4 * @2` T%>?€*  T`€4`*  T`r€4 * @˗2 T@  T)>?€#*  T`€4*  T`€4*  T`€4`*  T`€4 * @̖3` T `@%s: active requests Active Handle %d: tgt %d lun %d dlen %d 㿘 p "`>@"@n    >@ `" $@d```?GET FIRMWARE STATE failed㿈 [ -  ` i7@   @    @  @ >@  ߠ >@c0,` %s: failed to %cet SCSI parameters for target %d %s: tgt %d flags 0x%x period %d off %d 㿀 f [ . f`>A `' h* `2`  8772 o2  7*@ " f  . f2` w (7 *@"*7@  s  g@\  f . f*  P2 *  ` 2`  2 2 X2    X2   >A  @˒ ?!* 22 ,` * * @"2``  @4䀢 *  * *  @ "   d'%s: already have dparms could not GET ACT NEG STATE 㿈 X$" $2  >A#x@B 0& X Y @2 [@R  [ $ `  2`!2` *`  *` *` :@ ` %7@" X2  >A@#   $ *@ 2 * $* 2  * @$ ?#?! "=4 1!4  [ (  ?* 2  :      $  Y @26` (7,`7@2*`4 `d *`    $  2` `*` $ ?* 2  :(  [ 8` 2` ` @ $ ` @@*@* @$ [ *@*@` $ 4 4 ,  , ,  ,  <# ```   "``%s: isp_restart cannot restart ISP 㾘 ,  p ?" "p( f2    f2    f  . f f2   >B#P@7  ,  "  "  h2     h h2 ? h*  `@6 h ",$  " (`@"   ?ޓ, %s: invalid NVRAM header %s: invalid NVRAM checksum %s: version %d NVRAM not understood truefalse%s: NVRAM values: Fifo Threshold = 0x%x Bus Reset Delay = %d Retry Count = %d Retry Delay = %d Tag Age Limit = %d Selection Timeout = %d Max Queue Depth = %d Async Data Setup = 0x%x REQ/ACK Active Negation = %s Data Line Active Negation = %s Data DMA Burst Enable = %s Cmd DMA Burst Enable = %s Fast MTTR = %s %s: not supporting QFRZ option for target %d %s: not disabling ARQ option for target %d Target %d: Enabled %d Throttle %d Offset %d Period %d Flags 0x%x %s: Adapter WWN 0x%08x%08x %s: BOOT DEVICE WWN 0x%08x%08x Max IOCB Allocation = %d Max Frame Length = %d Execution Throttle = %d Retry Count = %d Retry Delay = %d Hard Loop ID = %d Options = 0x%x HBA Options = 0x%x %s: NVRAM is valid 0'D [ !    D@ !S@D P"  X!?>C !=6  D@    @ `  >CD ؒ@ȣr?>CD @șh?D[ v`*  `2   * $* 2 * @$, , , ?# @ * @$[  2`  4  @    @ ` $ * 2 * @$*@ 2  * $* 2  * $* 2 * @$, D* @4 * @4 * * @$X2  i>C!0@">C!H2`@ `>C @!p>C @!>C @!>C @ !>C @">C @"8>C"`2`@ ` >C">">"@ 2  >C">">"@ 2  >C">">"@ؐ 2  >C#>">"@ː 2  >C#(>">"@Ǿ  ?#?!       D*@ 2 * $  * * @$   @ * @$   @* @$ [ 2` 4  @ "@$  2`   @2`   @ $ 4   !4   >C#PD@m $4    >C#D@`  "  (4     4     4   @  4  2     4 DX2  >C # #\3`3` 3`3` @( `  n D    >CD#''Ē *  +`''' '' 4 ('', 'Х,'ԗ5-ؖ Э-''Ȱ @. @ؗ6`@и @Ȼ.`@@@D`@'8@ABCDEFG' *  +`''' '' 4` ('',  ',`'4, ,5@-@ @-@@@@ >D Ĕ @Ƃ * @0* @0 ( ( (( D0X2  ,>C@c!0>D@^ 8>D@Y X>D @T x>D @O >D @J >D@E >D@@ >D>@<!DX2  >D!8@2 㿘 T  x  T  p  [  `f`?a `&&6* 2 <    T S  T `K  T C <<6 *`6 T  3  T@€   6&   T ` `$ T   2  * @6states->%s%sGOT_BUS GOT_TGT SENT_CDB XFRD_DATA GOT_STS GOT_SNS XFR_CMPLT status->Disconnect Sync_xfr Parity Bus_Reset Device_Reset Aborted Timeout Negotiation Config WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNon-Participating0x%xPort DiscoveryWaiting Port Discovery ACKPort LoginWait Port Login ACKProcess LoginWait Process Login ACKLogged InPort UnavailableProcess LogoutWait Process Logout ACKPort LogoutWait Port Logout ACKisp㿘>H!& D>H!& H& @>"& 4 D f& < [  . f` ~. . `. - ` . .  `. -@2  . , .  . . [  < 2 >I В X>X& X+ " @{* (>`@l 㿘 <?#@@& <@㿘  H /* % f2   =  T  | f2    [  T    T H 0 a& , f [  , f`  T  T  T  > [` T    T `   H 0% @$    h h2 ? h*  `@4 h h , ? & ,H 0 㿘" 눐`  k#贆 %s: isp_watch failed to abort command 㿘H /* %  ?"?Ť!`p"!  "  " "4 > "bԐ;  "  >I @ے {> ?ܢ`>bԀ ? "bԠ  `  @ 2 " f . f>I>aX В*" @zn* X"& XH 0㿘H /* % T    X">I @z X =& XH 0, 16 bit wide , Tagged Queueing Enabled , 16 bit wide, Tagged Queueing Enabled %s: Target %d at %dMHz Max Offset %d%s%s: Target %d Async Mode%s%s: SCSI bus reset detected %s: Loop DOWN %s: Loop UP %s: Name Server Database Changed 㿘H /* %`] >J (.` (@)H)T)`)|)l [ M `.`" `2  #  " >I ( >G " >G "">I">I#`#!>I#8@k *  3 @ 0>I#` @0>I #>I#>I#>I#@ޒ H 0 leam7990_config: weird memory size %d: address %s %s: %d receive buffers, %d transmit buffers am7990_config: can't establish shutdownhook㿘@  < & (>N#& >O!& >N#4& ? "6 \ (@ݐ@ P @l !0 8&!0!0 @  @ @"  >J@@@ " @!0&!4 &!8&!4 &!8&!4 &!8 &!4  &!8&!4 &!8>J@! !>J@`!В@T>J!4!!8@N >O"@Β &! >J@ސ"&!L !4&!P!4*  !8&!T* &!X*` * &!\㿘H o*@g@H 0h \! 77 ͢ ̑* @7 ϐ ( Ε*@ 7 ђ З* @7&!<&!H!,&!D!P&!@@7!42?* 7!,!T@7!82?* 7!L ܟ !4 6!8Ж !X, !, 7Е2/Ӕ /Ҕ:77!P  ܟ !4f!8 Ȗ !\, !, 7ȕ2//ʔ077!T  ܟ !8f㿘   %s: controller failed to initialize 㿘   ݐ d `"!$@!$  b!,!L   , 2  4  d   a" € !?2  € !  !B6 Z \ (`@ {@6 \ >K"@E  `@㿘  ;>H 8+>O%>->#P =H /* 'V*`@`?2`H 0  "gVH /* '`@"@> !2` ?* *   P"@` $P $` H 0 CV@H /* 'V*`@`?2`H 0  "%VH /* '`@"@> !2` ?* *   P"@` $P $` H 0 V* @ 2{ ; <"  <㿐 >cT@   4 H /* '>H`8` 2`H 0 $$  $  4  @w  ( @ $ $  b'  z$ >H 8+>- & >cT@Ȕ   4 H /* ' 4H 0 $$  $ 4  @ ɢ l :9H /* 'cP   @cP$ >O @" > !2`  *  ?$  %cPH 0  "  $ ($ $ $  4   2(8 $   @&%㿘%F 2 p t & t P & p`` @Ӓ@   (@ɔ%s: overflow %s: receive buffer error %s: dropping chained buffer 㿐!<, *  !P,    7 @   >M!@   >M!   >M"@  t & t!X@ /:77  ܟf!4 Đ &!<%s: transmit buffer error %s: underflow %s: lost carrier %s: excessive collisions, tdr %d 㿐!H f!@!T,     2[&!@ \ ;6 \ @; @>M#H@>M#h@+ 0@h0D!`>M@#x@ @  &  >M# @   &  | & |    " x  &  x & x!8 " !H? &!H&!@@ (!H "6 Z%s: memory error %s: receiver disabled %s: transmitter disabled 㿘 €  I  @ * 2  | & |( t & t >N!@ p'   >N!@  t`b" t  $>N!@  |`U" |  "ː"" + %s: device timeout 㿘 >Nc @+  T`5& Tmissing buffer, no_td = %d, last_td = %d 㿐 4 $@ @ZaD,*  aT, ` "   4$6 4aH>NaD@7#p "=$aD  & & $  ?& "1$aD ( "@"a\@ 6 2 / 077`ܟ  ` Ha8 aHa8  $aH 4$6 4$aD㿘H /* '  (@z   H 00\!2@ !1@4 ! @ !@"4D 0!5@40 !6@0 094 44  #@ 0+@  244 ? 440@@ 4d  ! !@D H 0㿘ؐ㿘 4!2<"6`6`6`6@   *;n #  @d  &?    @23 <2`2*  @ * @# $OpenBSD: install.md,v 1.27 1999/04/02 05:17:37 millert Exp $ # $NetBSD: install.md,v 1.3.2.5 1996/08/26 15:45:28 gwr Exp $ # # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # # machine dependent section of installation/upgrade script. # # Machine-dependent install sets MSGBUF=/kern/msgbuf HOSTNAME=/kern/hostname MDSETS="xbin xman xinc xcon" if [ ! -f /bsd ]; then MDSETS="kernel ${MDSETS}" fi # an alias for hostname(1) hostname() { if [ -x /bin/hostname ]; then /bin/hostname $1 else if [ -z "$1" ]; then cat $HOSTNAME else echo $1 > $HOSTNAME fi fi } md_set_term() { test -n "$TERM" && return echo -n "Specify terminal type [sun]: " getresp sun TERM=$resp export TERM } md_makerootwritable() { # Was: do_mfs_mount "/tmp" "2048" # /tmp is the mount point # 2048 is the size in DEV_BIZE blocks if [ ! -w /tmp ]; then umount /tmp > /dev/null 2>&1 if ! mount_mfs -s 2048 swap /tmp ; then cat << __EOT FATAL ERROR: Can't mount the memory filesystem. __EOT exit fi # Bleh. Give mount_mfs a chance to DTRT. sleep 2 fi } md_get_msgbuf() { # Only want to see one boot's worth of info sed -n -f /dev/stdin $MSGBUF <<- OOF /^Copyright (c)/h /^Copyright (c)/!H \${ g p } OOF } md_machine_arch() { cat /kern/machine } md_get_diskdevs() { # return available disk devices md_get_msgbuf | sed -n -e '1,/^OpenBSD /d' \ -e '/^sd[0-9] /{s/ .*//;p;}' \ -e '/^x[dy][0-9] /{s/ .*//;p;}' } md_get_cddevs() { # return available CDROM devices md_get_msgbuf | sed -n -e '1,/^OpenBSD /d' \ -e '/^cd[0-9] /{s/ .*//;p;}' } md_get_partition_range() { # return range of valid partition letters echo [a-p] } md_installboot() { local _rawdev _prefix if [ -z "$1" ]; then echo No disk device specified, you must run installboot manually. return fi _rawdev=/dev/r${1}c # use extracted mdec if it exists (may be newer) if [ -e /mnt/usr/mdec/boot ]; then _prefix=/mnt/usr/mdec elif [ -e /usr/mdec/boot ]; then _prefix=/usr/mdec else echo No boot block prototypes found, you must run installboot manually. return fi echo Installing boot block... cp ${_prefix}/boot /mnt/boot sync; sync; sync installboot -v /mnt/boot ${_prefix}/bootxx ${_rawdev} } md_native_fstype() { : } md_native_fsopts() { : } md_checkfordisklabel() { # $1 is the disk to check local rval disklabel $1 > /dev/null 2> /tmp/checkfordisklabel if grep "no disk label" /tmp/checkfordisklabel; then rval=1 elif grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 else rval=0 fi rm -f /tmp/checkfordisklabel return $rval } md_prep_disklabel() { local _disk=$1 md_checkfordisklabel $_disk case $? in 0) ;; 1) echo WARNING: Label on disk $_disk has no label. You will be creating a new one. echo ;; 2) echo WARNING: Label on disk $_disk is corrupted. You will be repairing. echo ;; esac # display example cat << __EOT If you are unsure of how to use multiple partitions properly (ie. separating /, /usr, /tmp, /var, /usr/local, and other things) just split the space into a root and swap partition for now. __EOT disklabel -W ${_disk} disklabel -f /tmp/fstab.${_disk} -E ${_disk} } md_copy_kernel() { check_kernel } md_welcome_banner() { { if [ "$MODE" = install ]; then cat << __EOT Welcome to the OpenBSD/sparc ${VERSION_MAJOR}.${VERSION_MINOR} installation program. This program is designed to help you put OpenBSD on your disk in a simple and rational way. __EOT else cat << __EOT echo Welcome to the OpenBSD/sparc ${VERSION} upgrade program. This program is designed to help you upgrade your OpenBSD system in a simple and rational way. As a reminder, installing the 'etc' binary set is NOT recommended. Once the rest of your system has been upgraded, you should manually merge any changes to files in the 'etc' set into those files which already exist on your system. __EOT fi cat << __EOT As with anything which modifies your disk's contents, this program can cause SIGNIFICANT data loss, and you are advised to make sure your data is backed up before beginning the installation process. Default answers are displayed in brackets after the questions. You can hit Control-C at any time to quit, but if you do so at a prompt, you may have to hit return. Also, quitting in the middle of installation may leave your system in an inconsistent state. __EOT } | more } md_not_going_to_install() { cat << __EOT OK, then. Enter 'halt' at the prompt to halt the machine. Once the machine has halted, power-cycle the system to load new boot code. __EOT } md_congrats() { local what; if [ "$MODE" = install ]; then what=installed else what=upgraded fi cat << __EOT CONGRATULATIONS! You have successfully $what OpenBSD! To boot the installed system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT } T)6)GX)UL)b)s)|>)))) +4))Bx)d) ,) +8)*D**"*2*= +@*Q"*d 8*o*|9* +H**2*u*8*p* |* +L*p ++V+,+7+F+Vt+fg+tc+ ]++p+H+H+H,  , ,5s|,@@,M<,V4,c (,v +P,,,l,P,, ?h,, +x,,--- +|--.-9;-E +-P-` -i -rL-}|-X--?-:-9-9.9.8|.10 .<U .L8.] .h .s .w. .c0.>H.b...T/ / //*/2t/@<|/N /[ */k/t///P//}///B/t/0ǐ00%(L04,0E0Q$0^ 0i4\0t0=@0;p00ۀ030 000H0]1`11* 18B1F1N41Y l1bR1pd1x \1 1 \1X1 1 1H1 1x2;(2 C222( 24  2H g2P2Z2s2}C2 202\22& 2 2 }2Z2 2243 3L3+34$3? 3L3_ j\3i3s$3 3 (3 03W33RX33>334 444 @4/O4@Q(4O 4]A4o D4z444 $4b<4 444P4mp55g5e5*753LX5A5JX5\C5d H5vSP5 L55555L5h5@ 6 ?6#?t6<>l6T=6k=6:469686A6l6F6 P7`47 OD7 f7.6$7< (7I ,7St7`7j t7z T7P7=7U7P7d7 ',7|778~D8$8'481x 8?pT8M8\8m8z X8 \8d8$888888 8 L8N99 L9t9&\98L9J9\ @9j9z `99 g499C(9r9499L::CH::' d:8 h:B d:O:\6:e\:tK :,: :`:#,: :, :: :nl::p;; `(;" ,;-o;90;F x;Ps;^);m |;v;(;;w;$;3; ;V;8;0l<|<d<( <9f\c(>L>t>$>0\>:|>EhT>N>d H>s̀>}> L>|0>*>I`> 0> P>D>4x>*? p??8?0=(?> t?H<?`TD RD pDhDnDLD5DD@EEE7w`E@ dEMEUjEcHEuE EMHE E[E $E0EuEEF|F  FF#fF148F;FG'|FWdFfFw xHFFTFtxFFPF +F FLFG;TGG+GBzGVӠGc GzGGDG @G G GDGGG G H@H H!H*cH> 9HH#HP HcUHu רH H?HH:H:`H9XHHhIXI I8ID ILĀIZIohIWI I IMI lI II IiIJϸJ ӐJ% @J/J:vxJCPJOFJYJh@Jp JhJN\J0J<J4J JJ`J`JJK 4K K"K) <K5 8KGKW,Kf%(KoKuGKjK FK]K\K\K@KdK <K<LLL7LC LM8LU4XL`LrTLj LL4L3LgL:L1LHLLM.M M"8M8MGQHMY MkM|,MhMMLM @MPMjMHNHNe@N(hN9TNE4NYhNgjNpeN~ xHNpN`N DN>N`NN ČN_`N HNOݸO(HO1 <ODOUO]:OqOzOO LO#pOOO\OO{OP~XP-|hPBy8PVwPksxPrPpPUPPPPTPNQM,Q*IQBIQXG|QpD0QBQAQ7QQnQPQR PRxR#vxR6RE TRWDRhpRu XR \RdRR `RR dRR>S>@S=S3= SK;S`:Sw8SSK\S/SDHSSLSxStSBT T hTT'dT1T=TH lTU pTf tTp xTzT T TT T+Tx`T T +$TT~U UU"V|U44U=8USU`Uf tUttUU@UJlUUPU>UٸU U UVc VbVdV+V;øVIVX Vb,0VpVz |V dV V<4V9VHVtVV VWpW W \W( W1 W=XWMfWX WgWt0WWnW@W\W WFdW6pWWO$X NX!XX, X7 |XJ zXY,Xg|XoV0X~PXX4X 8XxX$XX|XYYohY qtY8YBYQqhY] 6`YfdYvYlY|YYjY eY7xY\DYY<YZ+Z Z Z#Z.HZ:8ZKdZ^4ZhZr PZ|ZxZ Z|Z Z f|Z?Z>Z>[ =8[#;[:;h[O4[Y2|[e[mH[.[[` m` `'p`9`D(```j`q`(`` ``a\`(`cx`  ``ya Ya4a#4a4a=0xaE]a`aqaaVTaƔaat@aa}aRaa'bPb#7b1F$bAbLj|b_bolb}^bbBpbDb `b7b b b>c9,ch`c% c0c?PcMGc^ Xcn cx c %c c c@XcLcic  c ucZ8d ddPd)d;AXdRS|der@dsdd,d_8dPd $d4d3d dFpeRee%#e2)e<eGNePe] XelQeweee}ecece|ene eYPf (f OfHf%f. f7f?fLfYfapPfofzנff ,fXf 0f|`f fB`f 4ffg  Vgg( 8g2ŀg<aTgK DgY״gbglQgy Hgg <gPLg`g g pgdgg @h4h @hlh. Hh? hJ[lhV~8h`8ho hz hehDhrhhhhhpXh Dh@hFi8i/Pi"i,ti44i@piHHLiPNi[LiiitWli i di %i {i,ii iiqxijj. j? HjK jVTjetjn j}4j jYxjDj$jHjjtjjj k kk lk1=@k: kR$k]1dkmLkw ]<kB@k k kk k b@kftk k`hklbll|l"Ol3.(lA5lPla lmRlv l l4lwl l`ll,ltl l l_m mm m%`m0h$m? ymO hlm[mj,LmrtLmo4mm5dm Lm) m@Hmmfdmmm@,nnn2 n= PnI xnUn]Vnjntn nk$nרnؘn ntnXnnBnn3o oo",o.o6 o@,oNXoY$ofxoso{o!<o ooo0oMoo2opPp0p +p,p@ pJpULpiptQp u$p pxpAHp`ptpvp z<p@p p$qq q#hq-q6  q?qLqZqgqpjq{pq,qqxq|q $qTDq4 q(qq`r r;0r+BHr4rC5(rT@r_(rh rs,rF(rrrG\r/0r+rrlrctrcpss4s!4s20s>sXLsq s}stssssԘslsׄspss cPt  tt+t=ŀtRt\4tgtu (t ,tL@ttfdt H t2xtt#ht@t t&Xu u uu+ Lu9uMuV<u^uj\u{u 1uHurLu;uuu#u 0v ovj<v+ 8v3;v>LvM vcvx <v -v vvHvv,v4v v=Lv"wlw wPw w. w8 %wL wX Xwilws w{www w hPw`ww  w<wrw tw bxx \xx#M<x,x6 xA xP* x^xjC xxxx5x/lx(xxHx`xjyyyy,,y; $yJ@|yaytyeytyy y yy+y (yHy4,y ,z @z|z'z<bzFJ`zT8Xzf7Hzs z Hz4z'zz$z<zCz{ {U{)n{1|({DY{a{p){'<{{%@{Y{O{e{^{{?P||u|& H|1|=h|M L|]|i|v?||m|;<|n|| ||<|O} P} }}/ X}:#p}B}L}W }`Y}r0}}}J}It}88}}:}9d}S|~ v~:~t~- `~9<~M~_~j 0~vd~~~~W~\8~mh~f~Z~~ܰ `" L0 d88|K[H|m)d"j((Zϔ0Q'3p?H"PP<Ycf|t hX lgb pP. PWZP H".8LH]=l^yp| ql" \W`,H(0 t= xJVE|d ɀ{ ɄL Ɉ FI b `(&$3Q>|MY8V2l` Ɍlx#H@АLE$8P=#1? MQY ɐhdu~g1p^j, 8( __ ۨ1>V$HhQUD_ 8nƈ|K0`p ɔ*x ɘ( T8 =5| |) ʘ8d<[ F`W0eXqTz ʜ c,xd Ԭ ʠ x)|"+;JT:^ ʤm@|X +;d  1  0( \U(8GOj_ ʨlv@L< ʬk Ddd ,8EQ@Tl{R /4 X & 'c( 1T?$P`X-fq ,})LA {$8 t,  ]X& 5.AtP<[ i\t<uL vP DWܼ t>$P5pCHR `h pr"Hz1  X,\B X H" +8 7+CS a,p H}+pDr > 84  H$x3BըO ]apfnrx{ >tX| YL )0<׌ELO /|`Tq  },D .zDc  3 @%,-  8#A KalpX|WR NtHP(I|?KXCptspr}PEBXz.y0D8,[f ~HNH4@ `8$ " 6UhU^^m <Ml0T<aH $sL0@<L$Yf nTv4,O  <3B f@tp $ (48 (B ,_tq} T |$ 03@T*  4i1 <@e|HxV\lat{4li@7Tc$>u|EW' ~2XC 4Op_mjʠr0~x 8,` E ] ԰ PT$8HH PV߼hTp5Py9`?Cl J0 Դ Ը  $*@ xJ6@   ܐ 4 = 6 4 4"6 4?6`6`6`6@㿐!('؊@㿐!('؀㿐!('@㿘> #>d`@ @x !>$"@""ؐ! `"@"`"`   `  >>d   ksymread㿘` \%>#>!>@`  ``&@? &`>P@i!Pb"`"  ` 4"=` @9" ` 4 @"` ("@"`   @   @@ ` b @@"@  @   8"  @>`  "@㿐@8 .`?? *@ .   ` 2 㿐 * >@![ %s symbol table not valid ] [ preserving %d bytes of %s symbol table ] 㿘 > "" >"" ` ` ?@>P#@"0  @9?>P#&@@   (* * *  : 㿘@.` .  㿘  : #>b䀢@4 >" `"  2   @ _ " * 㿘  C >>46` "2`  2.`  "*` @@*&` &@` 2`  ` 2` "  2` "` ` * 2&& ` >䀠4 >"@ "gcc_compiled.㿘?   F/>-> ?  @4? "?J g2? >Q@c 2?? ? d D 4 '@: 䀢    2    ': V   `  && ??? @ @  ;` > $23   / ('@%"`>  >Rx J@:"J@`J@ @J@:"*@ * " *  X_db_stub_xh: no lkm for symtab (ghost?) 㿘@ "! &@>`&` &`>^! " &`&`  0 @ @, 2D>R(&`<&`@!   㿈  "@ 6 @ * @*`  @f  " 8 & ޒ &@ " @6 ?" 8 & ͐ bsd㿘@ p> >d @>RPAll breakpoints used. 㿘>b "> "bb>; >R "b@1# >"  Already set. Too many breakpoints. 㿘@@ >S@ 0 2">S@  (0 """>c" ""cNot set. 㿘># #@ "  "     2 >S@ 0$@㿘># " @В "    2 㿘@Ԑ㿘># ># >#$t@ "    7 $   P`  > "c㿘># ># >@ "   5   >"#㿘=  &&  &  & &  &   $t0>S@i ( 㿘    3No breakpoints set Map Count Address %s%p %5d * 㿘!># >S>S@=#H0@:#`# >S#@C ">S>S## @( @  >S@"#  㿘@+㿘" @!㿘  >$@>$`  >$㿘@ @ @  J" J K2 ` 2"  `@2@%-12s㿘  !>T@!@    2? No such command Ambiguous Bad modifier Count missing @G  >5`'|'x'to/ @X0`>TS" 8|  ">T|>TE"C"( `@ d`>L|  C|@ @ >T&"8>L@`80@ /@x  x>B"a>W"a>B! 'x@ @t  |>T"H@*@@Ԑ ?'t|  |2|&|xt| !># >< >5 >B "!C@>B!>5" 㿘N> `f @$`?㿘N> `f @/M`?㿘@&calloutprocsextentsobjectmapwatchesbreaksregistersalldumpcrashsynchangmanhelpbootshowpscalltracematchnextuntilccontinuesstepwatchdwatchbreakddeletewwritesetsearchxexamineprintmachine> 㿘>ǐ# ddb> 㿈>"">Ba>5><"`>5`4"'"`4>" !>U@ N ">@a">""l>U@\"@>!>c>" >5" 4㿘 @F@>5 4Bad function Too many arguments Argument missing %#n P @Ā>U(#@Ā '@Ȁ ̠ @  >U@{ ` @@  >T"#>U#@@t   Ȓȑ,   "@#\#`#dĀ#h>V@ݐ 㿘@\(㿘@\)㿘@\)㿘J@ >@p!Ѐ" >a@: = 0x%lx %-*lr%-*lx%-*lz%-*ld%-*lu%-*lo%c\%03o㿘 >5+>V)>V L¤ @~  ?@ ! >V@!><" ?`1>V"*` ](]<]<]<]<]<]<]<]<]<]<]<]<]<]<]<]<]<]<]<]<]<]<]<[[|\\,]<]<]<[]]<]<[]<]<\t]<[[\]<\P]<]<[]<\ o  l  i  f >V!@@0`Ȕ >V.! >V%! >V" >V" >V " >V"@0(   ^ b "(@ 0    ^b "(@   @ @ "L@ŐL ?<8>5" %*r%*x%*z%*d%*u%*o 㿘N >*"H> "H?* : `L*`>W" ^x_$^^_$_$_$_$_$_$_$_$_$_$^_$_$^_$_$^_$_$^_$^ @  )>W>W!>W!>W!@ >W>W!>W!@y >W>W!@s >W  ^8>V>V" "(@f>W@c!㿘@  >V@Z!ؐ@  @*`( Bad modifier bhlAddress missing Value missing Count missing 㿈@ $ @ ">L>W?# 8>W@Ӓc  >W@˒c   >W@Òc >W @@q >W#@i >W#@b ?'@  @W쀢  >W#@@0@?'@㿘 ><" Z  >< ?>5" Symbol not found Syntax error 㿘@c  >L 8@ < >X3! >2" >B! ><   >5  >W! $ @ @ @ >X0!@) >X!( @ 㿘@   2>X!  $ 2>X! ؔ $ @Divide by 0 㿐ϐ . 0<  >X!؀   >Xא#  @'@: '?@@2'@? Ѐ ΀ @ $@㿐 % @? !>X  !؀  " @'? @ $@Negative shift amount 㿐ː  0%Ő 2>Xk!  >Yd! * 2 '@T? @J $㿘ѐ㿘 N@1! Sd""d>OD>S`d":  ,* @0: `D "*  ֒>S d!>O D ϒ"  D"$ D㿘%>OD!>S d ͐" d#>Wa ǐ"a$ d$D^R 㿘`~G>Z *` jljqkjj8qkXqoxkqoxmql@qo,qkkqkqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqkX!>S d>Wa  @0<  d?$ d!>S d>O D@ް @0/J@ d $ d>Sd>W@Р  @0!  da? $ dư >Sd>OD@   d@0J d`D  $ d >Sd>W@   dJ?   da@ dJ?>S d>W!@ ؒ >S d>O D@ 0>S d>O D@" Œ   0{>W!!>S d @ t J* d @/*@/  d@/J? d@/J?c >T>S!@ "T>"P? "TT>"X@>"P ?@T? "T"TTJ  T>T>"X>"P>S!@ "T "T>W!>S" d>Ov" D"T>P>S!@  "T>W!>OT"`DJ _   `D*@`P #`D J  N>O>T>"X@ >S! >bP @TJ   "T"TT T!>"T%>Xݔ$"T1>"P>S!@ `$"TC"TX@ >W!>O"`DJ   ``D*@`P #`D J  >O D>S" d>W!>O`Dג"@ >Y#ђ !>O D>W!@ Ȓ"@>S d D "@ >"T>"\@1>O>W!>O D >"P>S!@ J"JK2 J "  2JJ >O>OD `D>"X >""T+_"D`D>W!  >X>""\>>S!X * P@ "X"X`DX>bX* "bX >"X>OD>""T*@@1"D>O D>B!@@.{ & ^">Sd@ #>S *@d@8 #>S`d!>O* D$`d`@.`$ D`d D6"@ D`d " < 㿘@ز>W"!>B"!>S" d>O" D@-v @9 >O`D*`D>W!"@㿘@  0F @   > ?㿘>5 8 x >O" >K"b >O>58 >K >` >O ``>K?H"`> `> d㿘>bd "bd@$㿘>""`>""dBad character in number Bad escape String too long Bad character 㿘0?: ?߀ ] ?Ѐ ^ 0 >" O o T  t X   x> ">2"" /  9 7 0 ?Ѐ ? ? ?Ѐ ` @?4?@d$ݰ?Ѐ  ? ?  _>\p#cӰ ?  ?  _ \B >L \  8> ?2,>\R#, >L /? ?  ?Ѐ  _ \ :2, \2, ?2,>\-#, >]& 0 `?*`>]#0 y$yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyxxxxxyyxxxpx0xx8x@xxyyyyyyyyyyyyxxx> <  .4 0 . , * ( & $ "       <   >  >]@ ?㿘>"p>bh@!> >"t@@P@h  @h@,a `@h@@,Y `h@>>"h>""p--db_more-- 㿘 >^J!@ !@,8L L @+ c"> q > bl> bl>""l>""l ?"bl>^J!` !L@, L `( 㿘>"x >"l@??߀ ] |!>@+"h >"| $"h?@ >@+ $"h>>bl"p "bl>"h>(""p @+Ր >""h>>bl"p "bl0 #>bh>bt@漣@P $bh >bh "bh@+ >h 㿘>"|>bh"@>_@  `%-12s%#*ln %s+%#lr 㿈>>a 8 3>[@>_ @  @6@V 쀢`>">_􀢀" >_>_@ؐ `">_>_@ѐ >_@ΐ >!  Ӑ>[f"܁ [after %6d] 㿘@  " @` ?  "` ` "` 4&@ 2& &@>0`؀   '"`% >0>Wa? "a>N# >_@!$>_@! >0`؀   "`ؐ   㿘>0 ؀    1>0  >Wad>2$ "ad>0 1>0 ؀ `   & @>0؀  ؁  Jp" >0  >W >N >W d>2 $>0 > J>0 " ؆p`?>N >W d>2 $>0 >  J>0 " >2  p`?>N >W d>2 $>0 > Jc>0   >W d>2 $>0 >  >  㿘>"  >#2 "  @~Q 2"?""">"" ">c`"`""` "ddb: %s symbol table was not allocatedddb: kernel symtab delete㿘 @X @7 2  >>`!@>b? "b>`@5!`"  "`>"# "@@ 㿘  ?@     2>㿐@͔ >b@*b`*`*  2@ :* * '*``1>"㿘@ 2N    @`?㿘'D@ D@  invalid symbol table name㿘 N L@ :2`,@ @ﻐ  2  : ,@>a @``L@ 怢 :   z  >"#㿐>"   @8   Ӑ   T  㿐 ?'%>$E"&ז@`$ 1 &㿐 &@  >#  &@&%s+%#r [%s:%d]%#ln㿀>"/Ҕ$>b  >a쀢 >a"@T ``>a@M"؀`@  >a@?"0>a"@:㿘>#ɘ㿘>#㿘c㿘㿘After %d instructions (%d loads, %d stores), Breakpoint at Watchpoint at Stopped at 㿐 ' >[ '>["7  >W!d` >b@ x>2!$>0>b@ݐ  >b >b @>[">Bo"aQ>["\ linestabstopsmaxwidthmaxoffradixUnknown variable 㿘` ,>b>>Ԡb>%>L @S8 bԠ *>>`8>b%>L @@8 a&   *>b6! 㿐ʐ @  㿐'D @D  㿘  "@ 㿘  @"@ No value ? 㿐 >b! >b!  >bؐ# >bѐ#ƒAll watchpoints used. 㿘>b "> "bb>M">c "b@ h >"  No map. Already set. Too many watchpoints. 㿘 >>c@ސ 0-"䀤 @Ғ "   2  >c 2 2 $>c@!0 @!0 $ @$ >>""$ "Not set. 㿘>"䀤 " "  8   @:  $@0 2>c@"No watchpoints set Map Address Size %s%p %8lx %lx * 㿘!>"䀢 >c>c@i"0@f""䀤 >c"o >c">c"  @R#  㿘[㿐  QLT㿘㿘>"؀ >"䀤 >%>B#>-cL  :  @    cL> "b؁> ؝㿘>" $` "  >- @>- #L : 8    @* 2` >"" Unknown size %#8n = %#8n Nothing written. 㿐N h  l b? >d?>d   h!X 7 7 >d!h@ F0逤 2>5>dJ!x>5" ><&"`㿘`4 ?`.>d"ԓ*` (<P>">"|>"t> "x>#L>#P@^ -㿘>J"耢`"># А  *`: ?Ѐ4 L@: @%Π L 2 L    *` *`: @: J: @% L  @% @% ( L`_2 $@% a L  @% )@% 㿐>#, R>>    -*  ***> 4@] > * "` >%>@>@X@> @Đb `J :&J    8 &J 2 >"#,>> >c,O@$  `  ? ? 5>>`+ : J@ -,>>#,J  *`:  "J   >`+ : ?*@>`"  "`>+ : ? _*>`?"`>  >  ; >  *#>> 4 &!>>#,J  >   8 *`: ?: ? * J  #>!>`>#,͔@$ `$#,`?㿘N s >N / 94 >?А "`4  cdlinemicheadphonesspeakeraudio`? audio: missing method audio: could not allocate play buffer audio: could not allocate record buffer recordmonitorsourceoutputmaster`>f@ɐ! ?>f ;>f  7>f 3>f  />f $ 2 ( ` '>f ( 2 , d >f , >f 0 >f 8 >f @ >f D  >f H >f \ 2&`,>f@! &`,&`(&`0`@@ >f&`,@x!80`X@~@  >@&`,>f@h!`0ctct&`&`&` &`&`&`ct&`&`?&a &a&a &a @W.`А@T @5@3@&a &a(.a,&a0&ad&al.ap&at&a'Ȑ H€Ȁ   >f@͒a "  Ȑ>f@’a "Ȑ ''Ȱ>#4>#T H€ %#\a >f!>f@5a#\ad>f!>f@+a䀢 Ȑ>f@铒a &aȐ 'ȁh' ,`H (€Ȁ  @} Ȑ 'Ȱ?㿘\@i &`@a } > &@@ 5 ( 6+ ,@@F 2 ``*`@ "`` @*@ "$`*@ "`4`&``@&` ( ޺` Ц =.` ;&@@ 5 ( 6+ ,@@ 2 ``*`@ "`` @*@ q"$`*@ "`4`&``@&` ( ޺` Ц㿈  '''>h@Ζ midioplmpuaudioprint: unknown type %d%s at %s㿘`" ">h  " >f " >h  !  @>h H P>h@ X>h@ x 㿘 ,a (" T"&@€&@ L   &`   @vH &` `   㿘 , P"`  (`  0@w̒ 㿘   0    @@ 㿘   0   0 @/@  㿘  0  0@q 㿘  0  0@ 㿘 ``` 0 `  @@ 㿘  0 @  㿘 ?0?@=?㿘  $ @t`4 &  @l ?& & & @& (& 0. 8. 9. : . ;@ & & & 㿘 ,א X  5   d h (" Ð &  "  5 "     ("  `` "`(,8`"`` "```"`x`  "`|audio_open: 0 precision >c  6 c*@`"y `, s  p `4 l `(€ e`$`H$`P$`T,`$`,`,`$a$a$a `4  ,`4` `4 ,`42a>tt$``$``$a` $a`$a`$a t$``$``$`` $``$``$`a >i`耢 p>i@<"h%  @I `'`'a'a'`'p`'|`'t`'x'$`\@ B$` " @`(,`4,`5$a㿘H /* % , 4  ! " ( 5  (€ H 0㿘H /* %  ,&!`4  ( H 0audio_drain: copying in progress!?! aud_dr㿘Lπ ఀ 4 ] 2,L9 $@@ђ$ @@@: H /* % $@@($H 0 1L9 >j@!,90H /* % T>j!>!X*`" * >f! $T@5! $T0@ >jH 0㿘 >#.  ,H /* %`  ܀ " !  0 ,@". ܟ@ (.  `&  ݀ " N ̀ 2 ,k 2  , `" ,@ ( ,`,@ (.  @ (`` 4 5 . 4 `. 5" & H 4 5 . 4 `. 5& H&!H 0 aud_hraud_rd㿘 >#. XL; ٰ  2i` 5 e`H /* % 0>k ȀP>f! $P ! @ )$P"@ 뀎H 0`*@7@$`` 0H 0 #H 00H 0{ #H 00sH 00l j h H /* %    ܀ >k@ܐ >k ЀP>f!$P ! @( $P 倎,9H 0 %@"@@& `*(@@@ %@ H /* % $$,9H 0`  㿘H /* % ܀   P  P@x& P ,`0@ (.  ݀  T  T@h& T ,`,@ (. ݑH 0㿘 Ѐ  ,`    X@>@c0@\#@` @``@2 ` € ($   + >l(,4ttttt<<tttttttt  U           *@`0`*@`4*@ x  @ @ 8  8x@$&@`  aud_wraudio_write: cc == 0, swcode=%p, factor=%d 㿘 >#.  L;  `2!!  %!  5    &`` B>` 2`!`. 8 `< B`>`"&`!"%!`  0H 0 #H 00 >l @#`,9  5>lH /* %$@ ؔX T>f! % T ! @ % T$@퀎 ,9H 0$ " ` "@@6@2&`* @g`  $  ( @@ : H /* % % $L:`$ %@%@@@2 @ᙒ$ ,:,9 ݀  L8 @H 0 "` `  b㿘  >. #a@  ,00!@" ( "~@"  0 "}@"N !@" ( !@ 0"!@ˠ !@> !"@"`\!@"! !@"g  !@"c  !!@}  ! @X֠ !@"!@ Ͱ "& H H "& Hİ   H /* %  "  5H 0   ݀  ` @I  5   ܀ @H 0&&H /* % &    \@" &  l d& " &H 0eH /* %    "   @@:  &   @" & & &H 0@ t<&@7@2 2.``"*@ (% (`8` €&`\@ `<  (€ " &! 2 @ (&㿘 >#. H /* %` `" 50- 5 " t@!@x@ H 0 @ @ H 0  8@H 0 㿘 >#.  ,\@ ( "0?X ",? @  &?L ; 2 (  , ;  H /* % ݀  @3H 0 ( X㿐 ,d >p ( d h#8 \ #\d  ( d>p \8(@ 2 . ܰ 㿐N π 2  ,  @6 ,  ` >o (  #  #\`  ( >o $@ 2 . ݰ 㿘 4  ,    $  $  @ު (@L ; $ ( ` Ĕ (>o  $@0 "w$ L 9 "  p, : @2$@$ @ބL 8` 4 $ 4 0 $ 0! &! ؀` Ԁ@    " @   @ (  "@  ؀ * & & & ؐ  @@:  $  $$  6( ` ؀` Ԁ@    " @   @ ( ` "@  ؀ * & & & ؐ  ` 2 5 (>o  $@ " 5 5 "!L 8 2!  @4! T  T@& T@Ԑ 8 H "!@| !  P  @ P& P@ @ H @| 㿘 4 X Z , " "(J; ` "(`d G (`(>p@80? J8  "4 "4@  $ &`dJ9 2 `d0 "0@ "" "`d 2 P (`(>p@8 " P P  P@& P@a @ H @|      " 2   2<  "   2  "   2  "  !>qX(ŜŜŜŨŨŨŨ  "     㿘 &` &`.` .`  ,`@ (€  &`2  : .`  ,`@ (€ 㿀    @Ⱀ &  :  @@⨐" & : @?2'`2'` T` ( ',`D(€ఒ L`C $耢@2`4?' Ҁ 00 +  ',`D(€ఒ % `$"`4? 'r "`` `"` @U㿘 &` ,`D (€ 2 ` & ` &` ,`D (€ ` && p '@'`v ''Җn'` , ' ,`D (€ `ܐ '` Yܔ$耢@2`4?'؀ Fؠ ?ܐ ' ,`D (€ 25ܐ ' ''`!`$耊@"``4?'Ѐ Ԥؒ@ 'ܐ '` ` @'@'؀@& .6 &&@* .@ܑ*  @"@.㿀` 2@J @?F '` > '` 4 `% `)  ''` "`$ '` 耢 2 ,  `$' ,`@ (€ @J㿀@?"1 '`   ' ,`D (€ " ` ``$"``@ `0  `$``@ `H`, `8]  `` `'`'`'`'`'`'`'`'a'a'a 'a '@?' `8?"` 'Ȥ ` ?"` '` ?"`'̤`?"`'`?"`'Ф`?"`'`?'ԤxȰ   qఒ    S ''ܠ   G ''`?  : ` ,`5,`5 `5` a  `,`5"Z`\@`(   ?'''' ?''''ܒ `5`(@  Ȁ  ?' ' ?''$`$`$a$a$a$a $`$`$`$`$`$```\"   ?   mad Y`?   `]a I?ad 8`?a ` ' 3 ad 3  `3 a  `3ߒ `p?" 0a?" 0' ' '`s/`,`D`(€  0 "$ `0,` 0 2 `0 `݀ 2 `0 `5 " `0H /* % ӐH 0  `0 "$`t,` `0 2`t `܀ 2`t `5 "`tH /* % H 0 `t? 2`t`t     ,`€`($`\$`,``?" `5   `5 "ܐ` @`( m "@`xH /* %  )``\" `5 `5   `݀  H  `5  `  `܀ H 0 .`x? ` 8 ( `@޲ $``|  `?8`@ޥ $``x?2``|?  ```" 4$` 㿀 ,`8 v  &@ &`8 &`!$ &`!! $ &`  I$ $!dD&`!0`H$!t`kM&``H`3!?"&`p' ' ' ,`D (€ 2&`p&`p $ t$  Đ" $(  " $(!$,$, ,0 ,0 Ā@ ,1 @ ,1,2,2 42  ,6 4 ,6 ,7 ,7 $  X$  &`t @r &`x @n &`| 5 &`> 6 㠅* 2,   㿘 L  L`2 @& @iޒ 0 2㿘 L   @wA  2 㿘 >#. ֒ 㿘 >. #0a@ 3 , 0 "}@0!@" 08!@ !@ 0/    @g  L"" $ L   (`8 (`H (`D€ (`@€  `` @ ( ccdattach: count <= 0WARNING: no memory for concatenated disks 㿘 4. >v@#X*  @g !> $ ؑ. *  @g #>  ؀`$a 2>>v@5#p ؀ "a@i6 a  @i0 0"# @a@ccd%d0 >w`x> * ؑ* $ $$@20 *  @gl* $ a  $-`@ٻ"$@?`  `@gQ $` `>@+ ~ `hܔ$`@,/  q  2 `  (@8  @h @h  O` @ۉ$ X:$`$`  `@ $ `  &!: @&`   & "`  " ` @h @h N  "3*` * @@:$``* @*` @*$` 2  : ` @h] @hZ 0%` @hV @hS  @`$ @"' ' @۷$*` ' @۲ '  $$ $㿘    * @f& @  2"        @f~ $$$?$?"  `  @ d$     @fb* $  *` *   @(   "  @:    *  "=$ @@$$   *` *     @* ,``# *` *  *  *  : "    *` * @* $ @ۻ$ @㿘 >#:`@B > ,`@ ؓ*` @א 7  ,`$  * L `@_`  "  @6 ,`  " H" D H$ H$ D H D $ L@㿘  >#:`@> ) ,`@ ؓ*` @ ",`&    H  H**@$ H D**@$ D H D@ @" L 㿘 G   : > *@  ؓ*` `2  <  <& 4 0& @(& 00"  *# ` `@u  <& @H /*%@ H 00@V㿐> *` * @` 8@ ``G`T` ` !"@`"  *`@`   @e"*  @}*` @ `H> ,?"`< `</ -#\@L`@`0`\`4 "`4@-@  < @ 02 < ` \`4 "`4@-`< $֦`  @!.`@"  0\`4 "`4@-  `@.`@f[ ccdbuffer㿘 `'P\``   ` P& @G@ԙ`@` `4`@ 2`@`&` `'@` 4< @!` *` @p`@, `* @@` *` @]`@`@,`* @` 2"`"* & ,@   @d= @֙ > ,@C @d3 $ ,@" % % `0 @% 0>{ % X`,% ,`% D% T@% \% <% x% |@% % P% H#>!>`8@`<  &H >y#`8$#@|K H `8%  ` 9 0@4  @c @C >`,@ @cܔ % @Ɣ   % % D% \% x`% *` *  *  *  : % '` <% <&'>,?H@ӯ@@YP@p~,@Ӥ@N8P@&8  * "@  * @"`  % 㿘`0("`<`<&`@`<`@ 8@ " @ (mirror)%s: error %d on component %d%s ccdiodone: count㿘 | > `خ .* @ {  0(%0 4 " %4>{ >{40 @Ӑ .    > ,- H ?@+@Ւ@o     @!> 8H@>c  8@} "c< @d @d @@(">{@-  %@> .ؑ* gH 0㿘 >#:`> * `ؑ* @`  >y > @e# 㿘 >#:`> * `ؑ* @`  >y >  @eȘ# x   >#:`@ > -`ؕ*@  "@"  m@"|e e@2 0  h@5 0 e f@ { e g@90"@v  r o @R j>' ,'  '@: 2'而  '   @bP*    @bJ*  y* I ! , @k " 8, @  @$. &, +  `'' ' ""  , @  @$  ,  > -`ؑ* @Z@c @c @0 > -`@ᘓ*`ܒ %  !> 8 % 耊  0>$"ܔ@ $ 80$@@Ր8@O@ϐͰ Ȱ @ Ñ-`$ L*@  D " H "@  6  @#  @c7 `@   @ @c*  @ @@c! @c #> -` ?$a,  @c a @c  a a@@8Ho o@e@ H 0Z  EB!Q  M &-`$*  @B& .= @  8  @q,$ 2@25 * -` @>y@q[` @"  " 0` 2  `$ $  㿘 #>cp 2&?  :* > * `ؕ*@  " ? *` ` ?` cp  ? 'Ԑ @''''ܐ @! 7T    @'` @"( `P@%   @'Ԕ` @"0P  @'Ɣ&   @'` @" ccdfictitious㿘 : > - `ؑ* @!@ѐ@Β" $ <  $ ($ ,$ 0  ,@ $ 4$ 8 >~`@O  4  >~`@H .4 H 4 J$ X$  $ ,  4  !W$$ @4 6  * -  @>y`@oĘ @ default label㿘   *  >~@accdlck㿘  1>~ @$ !"0@xa "    @   $ 㿘  `@&  ?& @yMSG_INMSG_OUTUNSPEC2UNSPEC1STATUSCOMMANDDATA_INDATA_OUT㿘 H @  *@$H H T @ @"C H @># `   T ? 21 H T 2  )" D D*@* H`* T ># ` `  T ? `  H *2 H4 T H `*@&㿘 H F  T @ @"B& @># ` ]  T ? 20& T 2  ( D .  H`* T ># ` `8  T ? `  H *2&4 T&㿘!" ? 6"   * ""`$  . . &# P& * H* L* T* `  T *@ `@㿘! H * H* L* P *@ ` a"㿘    @@@ " @)  @ݐ㿘 `" @   & # 2   H   `@*# &#@ `@ncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d 㿘H /* %  >@(#0     >#@   &  2`  `* *` "" @rH 0ncr5380: scsi data uio requested%s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finish㿘 >`` ` 2`d>@\ H /* %`  ` >``! @ >  >@@!H  * , `$   "` "`"`  "`$ "`4` "`?"` ` $ 2$" `@`   >@ !xH 0ncr5380_done: state=idlencr5380_done: current=0ncr5380_done: dma free did notncr5380_done: sense asked for sense %s: target %d, bad status=%d ncr5380_done: bad state㿘 2 >@ː#X` >@Ő#x  p@ " >@# ,  $,, 22  `"  #` `>  "  $,   >@#$,$ & &   * *` (""  > # @  $, 2& >@v#>   **  @B"$ ?& `@P" & ncr5380_sched: not idlencr5380_sched: current set%s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: ptr but no data in/out flags? 㿘  @@ " >@#! "">@!* ` " ``,, "ഔ" "* ` "``,, " 2&"ഠ    `@0& @ `   y>"@? 3 ,, ""&  &  `&  &# &#&#&#``"  % ,2 % ,>"@@ z% ,& &  &#&#&#&#Ā   # & `=&#; b# 3&#@  >"p@ &  "  l"    @& € "   t`" @   > @aX@=#> @A@x "> ncr5380_reselect: current set%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d 㿐 " T>@! > @#`>  T ΀ @2  D  >"0    *2 $*  >"X@; 0"x @6 H H *@ T >  #`>w  T  H* T* `  T ># ` b  T ? >"@ Y  T 2  >"@ M  P* D  />"В @ ? *, "1> &   & @&  & &#&#&#&# L*  L $*@   t`" @  0+" @0#" @   H@& *   &#&#@ P* T* `  T *@ ?& 㿘   P* H* L*H /* ' D *@ L *@ H  @  $ H  H @?  H @ 2  H *@  H " L H* L*H 0ӐT * T*H 0  ` *@  D* H *  H *y! T @$?  `m  T  H *@e T @2 H P *@ H* L* T* `   T *@0 H `*   L L $*@ %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT 㿘  P *@ H# ` #ܐ<," ?&  #&# T @ @" @># `   T ? 2 T 2   2 X " # 2   H   `@*#  &#`&  2> H`$## 2   H   `@*#  &#`'&  D` @`*  &##Ԑ `  (9#Ԁ`26#Ԁ`#Ԑ -`$  H#Ԁ 2 H#Ր @"## H* T ># `   T ? 2   H*"q T#Ԁ` ?> l*` ,LLQ#  # H   `@*\#A#Ā ". = H` 7 %  2%  &  -& #ր  >!8>!p@ # 2  H   `@*,# # ` &  H   `@*# &# H* T ># `    T ? 2   H* %s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP 㿘  P *@ H @  *@#` #А#Ȁ@|8"## &#&###  &##*#&#@ R&#>#* 0 2 >"` :     2  .#Ȧ       >"@   .# >"ȐcȐQ&# @ @U` @># ` F  T ? C` T 2   <`2## 2 #Д   H *@(# D&# * H* T ># `   T ? 2   H* ``4 T# I`` H *@"㿐  P *@  /    + / ////    @` $ , # ` &  H   `@*# &# %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding 㿘 ` @`>=#P   P4+k   >>`*` #h@* ] 2   @># 4` `   T  T 2  < >#@ % "  P & P x@* `*   d   h   @ $ " $ # ` $  H   `@*##  $#ncr5380_status: none? 㿐   P*   >& @!ȁ ncr5380_machine: state=idlencr5380_machine: no current cmdncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... 㿘 `2 >@"0  >@ߐ"P`u T @ @>@:"p $,`` @>` #?   L>"5 v d T ? T 2   $> ,      !! ! /c+='}#$>"@ # ` &  H   `@*5# &#>"@ے `&#`") X   |@ "   &  @ ` `" X#    H   `@*# &# X >#@ #    H   `@*# &#`V`  `  & >@#0``  `>#X @z &  >$(`0># T @? >  T#x@`  H* L* P *@ T* ` ` T *@2& & & & &  &#&#&#&#āFAS216FAS408ESP406NCR53C96NCR53C94ESP200ESP100AESP100out of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d 㿘&d 2&p  @U{ &&d&p 2&d  @Ur &&p&d >&p 2&>@ @0c>> P@ 0[#* &&>@ & @P . g 2& . g&*"@ *`" *   g* @>*` . h g `. g & `@.&\& X& T& L . F @>`& @vW. D&? ! \€      \€      \€   %s: unknown revision code, assuming ESP100 㿘 \ @!>#!>"@w  .&_ \  #!".&_>"@g .&_ \  !&`*>#*` (<( '''''' \€   & f \`&&  \` e  \>"@.  \` d  \` g  \   \` h %s: resetting SCSI bus 㿘 \ @> @ >#!>"@  .&_ \  [NCR_INIT(%d)] 㿘># >!0@&\ 2 & x x& |&  & & p p& t&  @Ɵ$ $ t$  t"& t 4%l@Ƒ 0  .&\` @",    @ ", (!&&X&&T %l&    `: @?  `: `!`* &**`  .&\>#!>"@~  .&_ \  0.&\@(regs[intr=%02x,stat=%02x,step=%02x] [ncr53c9x_select(t%d,l%d,cmd:%x)] 㿐` ` `,`"* %l>#  >#``@G .&\`  2 \>`!>aX@S @å#@8 \    f  &@>@Ð ,`"* &@È* &`&    2(& &  \  \  \  >  P`O` .`&|&`$  '`&&| \&& @ \   \`  e @ \` !>#!>"@  .&_ \  #!>"@  .&_ \   \ @0?`  \   >#!>"@ C C.&_ \ ! C`$?? `@  \?`?>#!>"@o B B.&_ \  B㿘H /* %&`   p &@ p" & t& p p&`@ @lH 0especb㿘H /* % p  ` #> p c@j  p ` p ` "`$ t "  & H 0[ncr53c9x_scsi_cmd] [0x%x, %d]->%d 㿘 !># `>@ # "     `>@   2$ G  b$ $ $ $ ,  $   5  $ $ $ ( $$ ,, 0H /* %$|$ |"$| \  @qH 0`  @" " @ @  @ [ncr53c9x_poll] [ncr53c9x_poll: rescheduling] 㿘># >@"""  \ @ "`@ ` "&\  ># >@i"@#贆2 \ [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)%d:%d busy 㿘># "&\>@C#x&\`" x>@~֐# )  ` `*" * %: >` "`& | "@& Ē0 # >#@  2 requesting sense 㿘` *`" * %l># `>@ @Ò  .` #* ,  ,  &`$4&`( &`,` &` &` ` $``   `*@* 4` @`  u"` 0@ x &@ x" & |& x x&`&\ q[ncr53c9x_done(error:%x)] resid=%d sense=0x%02x error=%d 㿘` *`" * %l># > ,@"> @6 , 2 `0, X` @  $ , $ ,`0 > 2`,`,n$ (0=$ ( >c `$  (`" ,>@f"0 ,`2> 4>"@"P@[`   `*@* 4` @ &\  &  .&\@  ܒ@`@D@$@` @` " `@ `  "` ` " |`@ %s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d with no nexus; sending ABORT %s: reselect: target %d, lun %d: should be busy ncr53c9x_sched_msgout %d 㿘f  f^* *@> @~֒`!>Ȑ ?``  ` 2 ` 22 > Ȓ`@~ !>`"`$`"@ ,f\$` *" * %l@` : 2 `>!`@~ `*@6``  `f``f@š@ . "* f@* & f  ` 2(f f `\ `\ `\   !># >!H@~O #!>"@~H  ,f_`\   f] @ f`,f]` @# >!H@~1 #!>"@~*  ,f_`\   f] @ f`,f]` ,f`($fL, ;$fP# >!H@~ #!>"@~  ,f_`\   f] @ f`,f]`# >!H@} #!>"@}  ,f_`\   f] @ f`,f]` ,f` [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available gotmsg(%x)cmdcomplete %s: %ld extra bytes from %d:%d msg reject (msgout=%x) noop disconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d %s:%d: async espmax sync rate %d.%02dMb/s %s: unrecognized MESSAGE EXTENDED; sending REJECT ident %s: unrecognized MESSAGE; sending REJECT %s: reselect without IDENTIFY; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET 㿘#>c >&x@}9! \@€  2&X>!@}- 0 " \&]&&x .&] \@€  c >!@}&p&x* &] c!>"@}   .&_ \  >&p&x @|!0u&x ! c >!H@| c!>"@|  .&_ \  &] @&`.&]`.&` &.&]  &&x&p ``(-> *>&x&p  >&p @ > ` >>#!>"@|  .&_ \  0>#""&\&p >@|"&\  > &p @ *`" * %l}>"* CE DDDtHHCDP>#">@|q"&P`6  ` > "(  @|d &&P ! &P $," ( .&\!>#">&a@|M"H&a  @>&] .&]  ,&  f \   \   \  >>#">@|""`>>#">@|"h $ &P`w.&\ !s$ >#">@|"x&L$(&Pg$,>#">@{"(&&L,[&&P+>c""&p&p >@{"&p  >c">  @{ސ"&p ` !> `,&p  , ,&  ` " `| ` > `">@{b&]  , ,!># >!H@{ @N#b @!@& - **@²" @ , "* &@* & , "* &@* ,@B >"@{|&] 2.  &@6 &,   ,  ,c >!H@{b @c!>"@{[  .&_ \  &] @&`.&]`@.&` ,&] .&]   f  &@W@ ,`"* &@* &`&    2(& &  \  \  \  u> #>#">@{#H>#P@{ !># >!H@z #!>"@z  .&_ \  &] @&`.&]I`&p `2># `?>#@zՒ !># >!H@z͒ #!>"@zƒ  .&_ \  &] @&`.&]`# >!H@z #!>"@z  .&_ \  &] @&`.&]` .&`>#!>"@z  .&_ \  &] .&]&&x[ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus 㿐!># >&`&X@z\"&] @&X "=&l>#!>"@zM  .&_ \   .&b'&&l  ># >&b@z6!H#!>"@z/  .&_ \  &]&` @&b.&]@ .&`# @z$&l 2& &`&&l @.&a&b  &`.&b&a*@ ?`?.&`> *` OOPPPPPP PPPPPPPOPPPPPPPPPPPPPPPPOPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPM   &d *&d *`&d* *" * %l&d *`&d *` &]`u&&l  ,  f  &@@ ,`"* &@* &`&    2(& &  \  \  \  ;&d&\  >#@@ya$   &d* &]&d .&] *@   *`" * %l   ,&d &]&d .&]  &d  &d &]&d .&] *@&d&&h&&l 8 '&h&l \  @ \   \`  e @ \` !>#!>"@y  .&_ \  #!" >"@x  .&_ \   \ @[ncr53c9x_intr] %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %x %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! %s: unexpected disconnect; resetting sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>ECB_NEXUS while in state %x backoff selector %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] selid=0x%2x %s: identify failed esp: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %d left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: STATUS_PHASE: msg %d %s: invalid state: %desp no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE %s: unexpected bus phase; resetting 㿈># " \>@w`!` \ @ 2 \ɰ @€  \. j@€   \. k@€  \. i`$`" i@ i 2! j &&T!># > i j k@w-#8 4 i -& 4 \@€  #!" >"@w  .&_ \  ` &\ >!x@w 3  a >!@u  h0@X  j @( \@€  #!" >"@v  .&_ \  - &\  2G ` +",? @,&]  .&]6 &_&\>&T!&X@v  \@€  #!" >"@v  .&_ \   ϐ&] \ .&]` @ "C j \ @?2  \>!@v   \ @ 2  j2* j&\ "& j&X`2&P&T >" i  k &l #\ 2 j>"X i  k ,?#\@vW j A>"@vP &X !># >!H@vE #!>"@v>  .&_ \  &] @&`.&]`# >!H@v) #!>"@v"  .&_ \  &] @&`.&]`.&` i` !># > j k@v" \@€  #!" >"@u  .&_ \  A >#!>"@u D D.&_ \  D&\?`V>!*` ]nl]^nX '"`,&] ">@< >@u" *`" * %l&] `.&] ` ,`&] 2>#@u  >@u#0А>@u#@> @,  "`, $ " & &  $& &\?`>#*` _h_h_<egDgDgD_$>#X@up  &T ">>#@ue#&\.&b.&a.&`  .&] "  i@&\@uQ# i &\  ># >@uB#> @,0 x $ x" & |& x x$&  &T`.&\>U# \@€  ``$ \& " \ i> j# k &X@u#\=@€ .&^!># > H@u ``>&] .&]#!>"@t  .&_ \  &\  " &\& 2&\&] .&]&\ "?&> X@tՒ   0A 2> 2>@s` p k *`" * %l>"* b0bxdlc<d>#!>"@t  .&_ \   ` 2&T>Ð > &,` ,`&] .&]!># >!H@t @#!>"@t}  .&_ \  &] @&`.&]`@q.&`>  " \& @€  b \@€     i> j #\ k @tO#`!>#!>"@tG  .&_ \  # >!H@t8 #!>"@t1  .&_ \  &] @&`.&]` ^.&`>#!>"@t  .&_ \  >  " &  >   i j #\ k @s#`  $  `* @4`!&&X(&&L,&&P .&\!@ j  k@s >#!" >"@sޒ  .&_ \  & &] i  i.&]> j! k@sĒ  \@€    \@€  ??"  \ \ €?? \@€ ,0 \@€ ># @>! 0@s > ! &P $," ( .&\!@s >#!" >"@sv  .&_ \  &>"&\@r &\ 2>2&T>@q" #>  %c4k!> >y#(#>! >p#(>l#(># @>@s:"(Ԑr&&Xc @" i>@s/"@ i&&&Xc!>"@s$  .&_ \  &] .&]c!" >"@s  .&_ \  m&>&] 2 &]>"X j  k@r &] `.&]X&" j  k@r P&# @> $@r" \@€  #!" >"@rӒ  .&_ \   >  J&|& $ \&&&&|@' \   \`  e @ \` !>#!>"@r  .&_ \  #!" >"@r  .&_ \   \ @# $   \ @  $`>#!>"@rd  .&_ \   &&X!># @>&P@rQ"#!>"@rJ  .&_ \  &P& 8 '&L \&P  @)&&X @>@r-#& 2&c!>"@r" .&_ \  &&P 8 '&L \&P  @ &&X  >$  \`  \`  e @ \` !>#!>"@q  .&_ \  #!  >" @q   .&_  \   \ @3 c @>@q#&] .&]c!>"@q  .&_ \  &&X  .&\T @ 2 \ @ 2< \ ncr53c9x_abort: not NEXUS 㿘'` &``@&`  @3`&\  !>!># >!H@qp #!>"@qi  .&_ \  &] @&`.&]` .&`!> @(H`>@kaX@#@(02 &\`@8g >@qC"U &\ DMA active%s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled p  ``*"@ *`el@8  \@€  \ ` @ > > (  , &\ 0#\ #`#d&T#h&X#l&P#p> &` 0#t &a #x#|@pϔH /* % @  >@p Ӓ 0!>@p  $,1   &T @7Ȑ>@p `  `* @$ `H 0㿘 \@€  \. j@€   \. k@€  \. i`$`" i@ i 2! j &&T># > i j k@pi#8WARNING: no memory for vnode disks 㿘 . *  @A”  >@pN#X0@>/"">" 㿘 `> :`_ >/*@ "*` @w T d 2 `d$ @S `` ` < "@  *  2` @4` @  02`   *@$  $"  `*@ " 4  8 8 $ 8 $ 4 8 4@ @A" < @=vnd devicefictitious㿘`!@`@""$ ( $ 0 d$ ,`@@$ 4@ِ $ 8$ 8 >a@  4  >a@ ` ($ <.4 H4 J$ X$  <@2` $ ,  4  !W$$ @eE4  6  *  ` >c`@P 㿘 > :`>/. *@ "*` @  "   a&    8  8**@$ 8 4**@$ 4 8 4@ @" < ` D : >/*` * @ >`#p  < T` & @ & 4 0h" 0@ٴ G` ` !"@    @P  2 D@١0 D " G (" H /* % Ȕ & $ $ Ȑ $ H 0 0"40 h" 0 @%"@ @y& @0 G` ` !"@ *  H@`' <'''' T` * : ?'' @ ($  0@ '  @Ք & 4'  @ & 4   @Y$  4  0(& 0@1" @ H /* %   $?$ $ H 0  G ` ` !"@ H*  @  @`-`  0 `Ly @'` @[@̖ @(Ħ  @ Ȁ?" @} %Ē@x *  @?Ŕ "0"< 8"8"4`@? 8?`D "D"Hȓ<  "T ,",>!"X"\ "h "l `"` d"d p"p t"t"x*"|T"@H /* %  @c   @`$ @H 0@㿘  $ (@d&  0@ \`4 "`4@=㿘 | D : *` >/b* @H /* % 4    0h$ 0@&$ 4 @ < " @@$ @ < @`(@d"  @ 2`@G`Ȁ "`0?$`H 0㿘 > :`>/* b* @`  >#> @B# 㿘 > :`>/* b* @`  >#>  @A# vnd%d   @Fܥ: > 6   h@ >/,b* @  m@"e e@ 0 "@m 0 e f@  e g@0"@ `  @}  @'t'x'TP  'P@'| &` @  `@``@`$`*2 @ 2 $` @  `  @z@b0`@``*` &` @$`>c@m> $$`$`0`(@cZ@M@C `  @     !& `<*@  `4  `8 @!o @Ӑ@co`(Ho o@@! H 0X `$Q`!O `$H  ``&` "@* ` @<&`$56 @ɐ 1`` `!@M$` 2`@2` 4  *  a `>`@Nc` ~@" 02  `" =$`  p>#p@E$ " @= ' * b8"'Ԑ'ؐ 'ܘ  ?'''` @   @4   @”@?* `>)㸀  "   " 㿘> >/*` *    ` @` ! * @*` * vndioctl: null vp㿘  ?& >`#p>@j|!(  @R @E_ & & &  >8 >/("(2? vndlck㿘 1> @$ !!@Uq "    @   $ 㿘 `@& ?& @W㿘 > bL bL?-bL bL -bL   @@-   ,  * >"#P㿘>(` `> D @"(>/b >`L`#`L "`(L `@ `  *  *`   *   ` `#`L "`(L `@ `  *  *`   *   ` `#`L "`(L `@ `  *  *`   *   ` (`#`L "`(L `@ `,   *  +*`   *    㿐> , 1>" @ @" >/"  @>`  @"!>#@# >""#  > $  > cK*`?@Ԑ! > "`,    㿐>/ (`@"(  @% "" &  4 : >/: >/" `<  8&`4 ;"`4&& Ho o>b2"H 0 >/b `0 ""`0" "b*>`0"""`0H 0 >/  < " `"<> 7t` @  㾘->+>`@>/"  ,`% ,Ho o02 H 0 0> %0 ""H 0   >#P $ @#@ؒ m!  ,@"@4@ `@ ?  %`@   , c `*`@; * `    `*`@ * `    * *   *2 "  , " 4`@ ``%`@   , c `*`@; * `    `*`@ * `    * *   *2 "  >/ @$ " @8$  < ?`P% < 8 L?% 8@T 80G㿘> ,  >/"  `" >#TÒ㿘> ,  >/"  `" >#x!㿘> , 6 6 6 >/b ` "`> #lb㿘> ,  >/"  `" >##@>#`> @ 8"2` .`"@""t)>'>@! > L@)    > @ ` ? *  " 2@ ?  $@   +`  ?c `*`@ ; * `     `*`@  * `     *  *    *2 "  L@   ?  * * ? @ $>#`@o X>/"  .`@ " rndrd8'L  $ `.'3>`@>/" ;>  b8" Ho o>#0DL,   L #8! >8$ %8%$@R  2 @8   % >#`  8%  2` ,"@o% m% @B > L@J     = *  " 2`@ ?  &`@   -   ?c `*`@; * `    `*`@ * `    * *   *2@" `L@   ? @* * ? @0$@>#`$@ XH,:`??@, ??$@ 06>(` `  @&"(%>bL! % bL`#!+bL    +   *   *  `@ `@ `, *H 0 @K  " `` 0>D@  㼘` 2`{  v '>@``bb8" *`2`@J T     * 2 `*> ,`2 @B +`  *  " 2@ ?  $@   ,`@c `*`@; * `    `*`@ * `    * *   *2 " "` `   @ D!㾐"@"= "@, J"@ "@  ?> Db 8 @@ 1 O > @   " " @@  >" D @?  > D ?  #@Y ! 㾘@K !   |  \ ("  X8 @ "8 "" p   ' ''#@ ?| @ @ܐ`' @  < ?  @ݔ Z ۰ @@ፐ. @ @ @, !܀` @ @Ҕ @܀`   @  @| @ @ᆐ܀`  @ @g @ Ԧ|#@!P'؀ M =`?'؀` 'Ѐ`   (`"$ , X@$ , '袊@  $ , :`   @ W>8`` ' "` X' ,䀢 `  "@S  , :`@ 2 H   , * p t` @ o` 7!h`!P <  2` ``?@R`M .@򀢠6` L! @kL! h`9 ,@! `  @ T* $ ,2/ ,! ,  @T* $ 0 0@62  @ S  ,@$ , ,䀢 &m`"# , A$ 0 :@>@ @̵>   @  H $$ ,` ' (9$ , "@̖@Ԑ@@4Ѐ``r p?@$ 0耣` >8`` "` @Ѐ` ,$ (@"( @i @& 0 @ @ @ `@X0?܀`/ @, @M '@0/ 0  @?@#@@@ @ o@1 ܀` @ @#@@Ԑ@@Ͽ 㿐  |  @\`  ?`@ @ "  ` H @  " "@㿘>!t> 9@Ha>7"ch> " ܁ 㿘>#p6` >b >7ch* @ " @ @2 2  `@ 6` 0 2  㿘  >b>7h2 @ * >cp   2   @2  2  2# && " 4 @,Ŕ    2   "" cd9660_inactive: pushing active㿘  >#   |T  >"p@‒&  @! x  @4 cd9660_reclaim: pushing active㿘 >#   |V  >#@[@Y " |@n$  |@6^ :& | 㿐'    6`x 6``    `.  :`  @E 􀦠< H 26  @`x!6`x @2 `x @6`x  2 `x 6`x  2 `x 6`x  2 `x 6`x  @2 `x 6`x  * @&`|  * @&` &`|`x&`!m6`x @㿐 '`@  ``+  :`  @ߘ􀦠& H 2   =``@  @ @`p  ```d&`p&`t @`h  `p`t&`h&`l  @`p`p`t&``&`d &`h&`l @m㿘     l' &@&`C `  ĕ* *" *@" *` , d:@ڰ&  * @, ,`* * " < @ˠ&?, * * "@*`@*`" * 0 d ,:`*`" *  * "&@&`   * ( ?А㿐 ?/  /  /  / ޒ / ڒ / /    (*  (` (   @(2x   (*  @("|    (*  @("  (@2 ` "`RRIP without PX field? 㿘>@aŐ!@o ..RRIP with incorrect flags?㿘`$`0  `( h>"`  `,@>` /, >! @* |(08Dh  $ `$   @>% >  !ت   >@aW"`, `,@@|   `(&`$2&`0   0 &`0`(&``$ " `(&`$2@`  ?&`RRIP with incorrect NM flags? 㿘>!N ` 7 > *` HD X(XXXXXXXXXXXXXXXXXXXXXXXXXXX0  >% >  !ؤ   ?>@` H`, `(@2*``,2`@ ``( ?&`@`$""@`(&`$2`$|(`$&`$ `  ?&`㿘`$> !*! * *N !    !  `$ `(@ `0`( `( 2@    (*  `(` ( `"`JC  `( x0"`㿘  *  2 " @@ ޒ`h  @4 h  @ ђ`` @ h l" `" d  /@Ò`p0` 2  " @@ `h  @  h  @  `` @ h l" `" d  @`p`@ h l" p" t` ?&` 㿘@4     (*`  ( ` `(( `(2 ( * `  "㿘 `? @`@&`!_    (*  ("` ` `* +  ` *  ::`   (  * ("`$IEEE_1282IEEE_P1282RRIP_1991A㿘  2,    2&     >b0@ 2   2` >b@@  >bP@  `" =&`㿐' `!` L! 2`   *` *  `*`H "X`!T  ?# ,&`  "`LJ2L J@ ` " € (` @: ` +`( ``  :`8 B  ?+ @ő  H``  @  2 €  2 `''ܐ 'Đ>\8`'' 7''ܐ x'6> !`  IJ` ?'Đ@`''6$7 ''ܐ 'Đ>.( SP`&aX ">b@    &aX 1@  2?'ܐ"'Đ> x"?  F,T J ;( J ;F ?  Є 5+  (В   ( ()# `  @   $ .;   ? ;?   @* =* %@   (8@Z *  (8. ; 2*(8;*`@ & 2cd9660_mountroot: can't setup bdevvp'scd9660root_device >>">-p@dch  >>!#>2@\`8 >@]ǐ!H03>!p>ax@֯ +'`8@   @֓"@0 0>2X"@"`X 2"X">2"a\ D@3@y   w. p~<`@x @  D @?l&$ @&(&&@ҽ&, `@ "D@uW  >"Ԁ@& @kM   `@* !@ @07 @ڔ<@@2  @/  @>  Yvy Z`@$  Yvn`@$  D@ @CD001㿐 D `<' `  @ @ۆ >2 8   @' ݀  ?@X Ӭ(   @?@e >` H @Ȑ  2   @@Ėc 2  * @~?"@@2 !\ 9@. @m!\$  P$ P "+  +` +  w$  *` *  *` $H  *` *  *` $L$ $   $* & 0`" 0@=&aD` &`d &`h`<&`@ &`<$$$  D" l #'  `?H@@ٓ+@ % H $Tl l ?&l 0`" 0@ 'l ``$` $P $P   " @    ?@@/ 9&aD㿘 @($ D  ,`$ T($ < T$ 0@p8$ @@@; K>` H @  D ? ``c$,` 7  * @?"@,2* (@(  8@$  " " `` & .&. 6&@& !W&&<  &@QO&6 0@ " 0@x 㿘 6`@S   aD  D?"  @@ח @. 9$aD`<*@$`<㿘!D!$h!P @`? -㿘!D6@ &`&` &` &`&`&` D@ &` `Lv Z `v Z&`4  㿐!D@(` 2  ` &`| x  &0'4'@@֐ & F㿘 @2 isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] 㿈!D &  >'@Ŗ  & :@,@ @ `4 > @#a "`|$`$`$`  @ "!D02D'6@ &@]>  @! $  @Q> Ȓ@Z F0Ԓ/ ?@,  @A@k> @Z0 H  @1 ">@W>! @Zv  F$` @$` 6@`$`\@A    @r @ 0 H    *` *  *` $`T  *` *  *` $`X `T $`\"`@P ' "'   *  :`@7'̒6쀢 " @8 >@>8`x< 2 +"`@>!* ͠͠͠LL͠͠8͠>8`," >Ba" `@ԡ   |& |>)c" |@" @י'$``TH@@ "@ & | 2@"`\ "` `@3 `24 ` 20 `$2, `,2( `?2" `2 @`"  @>(      㿘    |x|@z /`   |`$ `$ `x /4 `4 `|$ `$ ``$ $`d$ (`h$ ,`l$ 0`p$ 4`t$ 8`$ D`X :< `X 2.$ @ @ 2*$ @$ @* '$'' 'Ę  ?'' ''А' ' @O' Д$   < @,% $ @ $ <` $ `X :< H @$ 㿀  ` *|` 6 @ܐ 0 %`@! ``    "@   X :@b   x `<s < > > ,'(  X* ( :`#\  @?!   X*   '?#\@a#`?@2% @$8  H@<>  " X: `  ` `0 "`0@R ` 2t`You did ioctl for isofs !! 㿘>@X`#H    㿘`@* `  ? 6`#0`@* &#@#D`"`#H 4"@&#@?`#H&#D?&#H`#0@; 2>#8 㿘"" N" =`?  " !!? 2!@ ""!  # ! 2#.!   # ". "   ? 6""#(!"># "#(b:csE ..㿈' #P| ` @)B',!, ,",!, $#0 $#D ` 2 @),/`$#D$#H $#@`<#(#,   @ ʒ  `X"#(   "@p #(@   H >`  :#( Be<#( ϐ  4i  ` ," !&c  ` Y$" T* $"#( B<#(!P >" `," 1#(+!h4"!h ,"L`!  `!!P ," ,"" " `  `? ` `,"!P #(" #(=p #,k  !P  ,"Ӑ & ` @) #H'@"@" "#8@#88`#@ "@)㿐  |`!P  T  ` ? 3 + @] )`   H @ @     $ @(     @) @w 0@t   " & @ "@` "  "`@:5@) 㿘 @ @'  㿘 @ @  㿘  |  4@yd㿘   |` 4@ndcd9660_strategy: spec㿘` \@? |>@T# T P@2 T   T@ "  T$ 4 0h" 0@l?2 T H@ <$ @ T? D $ D>#* @@ @ tag VT_ISOFS, isofs vnode 㿘>@V   㿘  |@ 4`+>(ݘݬݬ<p݄ݘݘ`|P`   %   ` $  ` "  `    㿘` `, @?2@ "!"!0"! @! @ @@ @`exec: a VTEXT vnode has writecount != 0㿘`&`(`&`,` &`0``  &`4`&`D` ` `  R` " ` @ d >@T "@ "@``@*`@```* @ &`*`>"" ` $ `($ ` $ @` $  $ ``@*`@i```* @ &`*`" ` $ `0$ ` $ @в` ` $ $ ``@*`@K```*  &`*>#X"@ ` @ "``0` "`"` "`"`@Ò㿘`&`(`(&`,@#@2` *` &`0 ` `&`4 &`D@```* @ &`*`>""  $ `($ ` $ @]`  $  $ ``@*`@```* @ &`*`"  $ `0$ ` $ @?`   $ $ > ,`0@?@-@ɒ`4@ $@```@*>@Ő`>`cX*  &``*"  " " " " " @A㿘`&`(&`, &`0 ` `&`4 &`D@```* @ &`*`>""   $ `($ ` $ @`  $  $ `0>`,@?@ϒ@k`4@ $@`$``@*>@g`>`cX*  &``*"  " " " " " > ,`4@ @B, &`4@Ԓ㿘@. 2 ` $ \ @SF2  @2  2   "   ` ӄF2&  @2  > h `8   2   2    * 㿘?"`  &  @ " &   @&"@@2   '@`'@  `'@ '>-#L: "  @ C  @  @  * @ & *`>""  &`&& @&@&"@ @* @  * @ & *`>""  "&`&& @Ő@& @* @_  * @ & *`>""  &`&& @Ψ&@&>-#L@ : @ @ @  @ >@4> cX*  &  *"  $" " " " @" 'x  #\ #`  #d#h#l@o 2`   'p'Ԓ D'ؒ ''@$'ܰ @ t $`@菖 l  < f `!@` X x 4 N   w A   , @$ 2- 'l "'h8! plh  l p  " &D&pl 'p`@ؠ ` @"p@%Z p'@exec: a VTEXT vnode has writecount != 0㻀 '` / 3`.   E 2 ` R` "  @ ݰ >@P#, , @#`  Ɛ?&`,&`4/, @>  2,#`  >`@ >"x&`T?'  . , >"h`" : "`` @ `` | . ,,@:>",?'''? (* DY`` 쀢 @ &`(&`,&`0&`4,`@Π ? O>-#L`0@*@ 'O $ @"   @" lΔ$&``&`d$ *$ ,$ $$ &`X&``&`D@$a ` @"@$U @` P`d```'U  `XZ  @$; @$8 @v`0B` `@`€@`@  "`@`` 2& '' ' 'Đ ' '> ,''Ԑ ''ܐ '' ' @'''`\j@# @#    #!exec_script: copyinstr couldn't fail㿘?`H %`` !>ah@@  ܰ `  @ 8   @ J@ "*@`@ *J@ @  ° L  J@ "` "` L "&`$  J@  `J@  J@ "`$*@`J@ "` "`J@ " `$ `J@ *@`$`, `` ` ?"` "`H @!&`H  ?@!͔ $@`@`  ?@!Ô $``@$ ?@! $ @$i "$>@Nڐ!p` &` `  4@Ԑ@  2"``H  &`H @㛖@#+ `H&`L`$ &`H`(2``$" $- `$*" " 4`H   &`H ?&`H`P@  ` @s` 4@# @  @" ?  @" ?@1`vmcmdset_extend: not necessary㿘   >@Np!X " , & ? * @!8*   ,  k!* @"Œ ?& 㿘   :&  " @˼   `&&  @" ?㿐 `` ` #\` #`@0`㿀 ``@  `` ` `#\#` #d#h@#l >- `cL` `8  @N 㿘 ``@Ӻ >- `cL``8   @7 㿘<&`8>&`< ` 4`>-#L @*@ &`@a```*  &`*>#X"@ `<`@@ `8" " "``8"`"` "`"```@*`D```*  &`*"@ `@@ "``<`@" "`"` "` "` swappercannot mount rootcannot find root vnodefork initpagedaemonfork pagerupdatefork update㿈@t>7!>@@#"#p@Ȗ>@Nݐ">@Nڐ @@"@E@@@$>K`$"` "$ >BaH$>W! "aH" !"">B"!P$<"!P$@>/!"  "!"`"$( ,- ,>#x$> Вi >K#" @( $ ?> "@>H"X@2` $>cv2 2  " p"  " $::  >HbX  @>!x? @:` @$ ? @& @:  $:`!>H"X  P< p>[!>2 , + ; < X< h@ : < ` $ #>-c$ $ Ġ @ >- #L>:` @  @ $c>`Đ  $P$ @$*$$@:M@@ܩ@@@Z@x@n@iv1>!` !@   2H /*'@D@H 0@7 @7 @3 >2>@L X< "<X #>  €`$ !> >@Lv `$#@W$  `$@p@Τ$ >L >@"aP  aP"`>7""""`">@""`"" " "$@,$  @6耢 >@LH!@$!>@$ `@-̒>"  >@I ">>@L0!("  >@=8 >@L$!@@@롐@=@>  @}"`/sbin/init.bak/sbin/oinit/sbin/init/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d P'Ԑ @'ؐ '>#8''@ž  `>>@ME#H0@MB#p0@Rinit: couldn't allocate argument spaceexec %s: error %d init: not found no initp >/"#8Ȑ>[ h> " '@n" >@K >ԨccG"  -/ؖԤ h>H"   s/ٖڤ  *"$@ f@{ $@ f ?gĒ ?g?g'''@ q " > (@LȒ 2 ->@L @>@KW X㿘@㿘>@ѭ#pP @& D@ ''' @ '@8'ܰ 4 @/`@     @% #> a` >>)#p >"@l a`  >)#p @>)"#p$a`@  > @"a`@> !`  g Ȕ@(? @7@7  'H /* * >L  ؖ"@'  ܒ"@`''А"@@'H 0 @]7 ̒@'А"?'`'?/!'>@#aX>a\@q " 7``` @h 7`,`0 @07  '  ' (  ?   "? l' /  @* #\ #`  Ж (#d#h  @O#l㿘 . @:a #  6 `   #(.` 6 `.` @.`6 Accounting resumed Accounting suspended 㾘#>)cp`#!> `@ 2 `  ?@ I$cp  >#@@ d @/ >bhcp> "`&$cp!``/`@ 2 `  ?@ז $$!`  >#@q@Ò d @ > !`>b$cp$!`@J >>#!>aX@\"@ weird hz㿘> "">@"">)#䀢`>->!XD ""D@D>0>7ఀ`">!\">!X d>M! @"  ` <>0>0>M$  >0 >0 "c0>M  "c0 "c0>M "c0@I 㿐> ! @>` ? "`  @`2` >#p`)>) @` >  >!\@;ʐ 2 @+:  >  >!\@; >)@+) >)#䀢 >B@Q>B`>!\`>L "`'>2h  `'>  "@"h>7 "А"?@?/!@" "> >  @?@ " : + @"  " #@:`+ "@"   А"?@'?/!@'>R >'@>#=">#ē*    D l |># > *"c ' %"cTa@L >?'> "cTa @= >'>  "c># 0>>"#>`>#  ># ;4@ ">>M#0 ?*@"#  ># ;4"@ ">M#0>?+"`>" >   >M>#0  " :"@  "#0> " ;@">B! >M#0>*@  >!X ` " d <>`:` : "@"@ "`6:` : "@@">L"``"`/ >OH 0!@0 >  *5 e 0eؐ 㿘Ho o> !  #>% `X  $#$`XH p@Ho o 2 H 0timeout table full㿘$ Ho o>%`X` >@Gΐ#""> !!#`X  4& 2 "  "" #"H 0H>  >%2  2 "  $   X""# X2H 㿘H/` />L`"(b``>" *!\" *" *    * " @. >!X1#@&#@̒H 0㿘 ( $ >5` & (  "` >)#䀢 H /*.>0 >"">"">-@s#DH 0㿘 ( " >5` & (? "` >)#䀢H /*.> "">""@L H 0㿘 @#>>#p (  @L[ >b? X"b L Ғ`B < >Ba0` 0"`>Ba0 +"a0b? A"b>#p >p @ >B `B < >Ba0`  "`  >B `B < >Ba0` "`a0` "`>" >"" ` \ $ `` $ \$ \ \  @4w Ѐ 1 , Ё㿘># ^>@? . > "c># >L>  2>L>L >" >L`>>#` "# `+>@+#*  >  :`" "  > @ " d>@Ð  >># *`: "  "#>*`>  ">> @4" @&"㿀>)#>!\>!`''>!X>-#D'' ' @/@  cum ticks arg func ?%9d %9d %8x %s (%x) 㿐>@GK#8Ho o> ! >Ŧ#` `4    "'> #h @G' 2 H 0fd_unused: fd_lastfile inconsistent㿐 @ @.`   @P @dup2: fdalloc㿐 @ @`,`   ` 2* ` (& >!x@ @ 2 & @@ 2@">@Ee @h@Hx @@ @,`@ "5 `` 0>Ɛ"L*` t0`p `     >!x@@͔ܰ  @   &`  @  @ ?*@   ?*`:`* : ? @&% ~  34 `  ̚@ 4   ` 'ذ Ґ b}   @`@'ذ 2'ð ~   2  0T  ( ( & `w &T  ` ("`(  "`,   "`0  @d 2   &`  `v`|T w  (`_  nW W @ B ?W "#   0[ 0X  " `(`"`(   `(`"`(  @@ޱ9T " (3 `_P  ,W    0# @ B ? W      @ށ @ `_,  *`@ * #@  (  #  4" " 㿘 .` 2 # @ @Z$,@ @&$  @>@C P  .` "$ @㿘 @ @: ̐fstat8 @`*@@`2R` - "`(  >0 >0`(@1 @_ߒ `(@\ @C P2 @a 2'`^ `fpathconf㿘 @`@*@`2R`  "`( >`   ""  @ݭ`>@C]!H㿘>!x  @  `` .  2  `4$``@$$`&9 &@`2  1 2* @8 , '@ `@*_ߔ@I$``_֔@@$` $$@@@s '$@$`>0`$` "`>x  " $"@`4 *  " ?,  2?`퐂? file㿐 q >8B>!x@>@B 8 `" 0 &@ @ 0 `" >'@ $@" "@ $ bxbx $bx" "bx$  @* "@ $  $ @` 2@&@& 㿘`"  "` "@@` & >8"@ܒ &㿘  ' @; @  @F&  & @@ 6  & p&  & & >#v& 6  0 㿘  ' @ _ @  " @  `6  & p&   `c *`@ 4`@: `c@ ,` '@ && & ^Օ,` ^є `#`" `  ""` 㿘 ?4*  #`  "$@ &  @C '@M "@G@8 'closef: count < 0㿀 `" `( " T 2 7  ?? 7 ( @ @ ? $ ' 6 >@A 8/*  @2 7  ?? 7 ( @  ``€ 㿀 @``@*@2R 7 4 -(  7?? 7    `?К( 2` 27 7 2    0    @ۖ "X 㿘 .`  . @  D  2@R " 8 #@2" 1   @*@  "  @4&& % "   @*@"  * @4&  &&  >@@ P2  . "&  㿘 ` `  "`Ӓ` $`x`(D% $% (@v  &` @    `$@ܖ 2 4 < 2 2 `$((2`$  `$` 32` @@ם 2{ 4`$  I2s  @a 2l 4`` #\ #` #d#h  @V#l J`  "@>"` &` >" `>€  2`H`H > 9"` ` >`D@8 `,@@  ` `4 `$   ΐ` @ @ 4@ 0 4@} @#execve: argp == NULLexecve: no vmcmds/dev/null > ؤ @>"` @6'l >"  "`؀@8"آ`@ 'l'p'L ?@ 'H't@!> "@'''H'''''>#x''ؐ"ؒ' >W!@ >@?#0؀   @@J,J    @@ ?`@ @ ?ؐ ?'``°  2`?%'Z    Z0  ?`` @?%'Zh   Z  ?" 0`` 4  0  " ` *  a "  ?Ѐ@'m '@} Ȁ @k @>% > 0> (@ 2@ % % Đ 2 % А 2 % %   >@? #H@@`€@@   G''ؒ>"  $ 6!=#Y  0` #"@ 0Yߔ %@ 8'[* ?# @ 4@,@($@`$(D @+r$(@  @(*@$(쀊,"b(   @$$@"@쀊($"`쀊$ "` >˪#`(>`@! $(`  ,`@ 2 ` 2`' @''''@P 2 2 "  " (@A``׀` *`" >$(@ "`@ "`(@&H /* *>#<n $|$x$$ * "`"` " " H 0>W!@6|@d  @@ ,€ W(((@ $@A ? @`G @B s؀  ?'Ð @ԯ@|@! >W!@@ ?0$ @Æ>耢 "|@ |@   @ԏ@>W!@@ ?@} @z? 㿈'`` ` X' 2X , ' *` T  @ *  @'&@Xs  @ X&쀢 8 @'? 'XY  & ? &`XN   X쀢  ?  'X6   㿘@@ *` init died (signal %d, exit %d)㿘 0 'H>ΐ"`@=>` (  H H @є &! ( w`& ( D w@)& (?& & >#<B  Ȁ @h@d Ā 2  @>  `# ` "&`` `|2``x  @6 @p` ` " &`@ԭ ` "&`@,&`&` @ ? :` & @ ` "`   ">/<< & < "` "<&  . - 4`" 8 8"`8 8 4"@ P`>/@)H#8`"!#>/c8`H@'`((" 7&`(@I `2c8!J H Y#6 ! @` !@e`H& d (@ >/ D (@" D>/#8 D@ P 2 D@)  D@ @) D (@@" @) >"cp? " @ *@Ɛwait㿐@ 2`   &@`?" Pư   (@2 H@" L - 0 " L -   @2 HL - g 0&`    `V' 2` `"  T!V H 2 T ">@ }>#p\ \ @ 8 "\4  !@א H!@3 @c `"  "`   "@ H`" L L"`L L H"@  @? `? "` @ @ * "@@ )>`  ?E"` 2  H (@ 2 Hh@ ` " H@  0$ (&`    `*V'& 2c (2` 2&! >ϔ@& "L P$ T@ @4 @(    D  H L L L H `P" H`P H L"`P`P" L" D㿘  @㿘  @㿘 @@procppwait㿘 `  @ 2 2 >!l > ` >Ѐ >@:" #@R   : `p >$`t@A? #>$"@' !  )@  >5> 0`"0#"0!>5 0#@ >Ю@c$ 0>" $ 0>$@9 #"$>K# + >5> 00 $@"0 0 0   0 0@$ 4"$  0@$ $ 4"$  2 0 >>/#<И >`  "`  , ->5 0$ 0>K $  "` "$ $ $>N 0#\> L * @ $ 4 0 * @ 4"`8 0#\L * "@ 0 * @$ 8 T@s p Ē W $ $ ( $  (    *  (! ( @  @ $ ($  V   "` @ 2@ $ @` $ Ő$ $  ` "$ @F $ ` "`     ` ( ` ( $ (2 < ( $ ( < $ < < <"`@& < <$ @`$ D@ ( $ ( P $ H P H"`L& P P$ L$ P @"  \$  $ @ \$ \ `  &   <@̖ $ @` ``>@0%>@0" "ܔ @  " >@ "@   " "@  "H 0. >L "ؐ  "ܒ 4  @P, -H o@ `?&  ( "  03>А b@$z  (  0 &&>p 㿘Ho o>#p 耢  @$\ H 0㿘Ho o>#p " @$C H 0 %:㿘'L'P'T'X> ( L7>ҟ >7>ҟ>Ґ#㿐'T'X>7!В  tϖ @@j Ӓ (T@:u' (2& WARNING: thread `%s' (%d) exits with status %d 㿘  >>cp (0@:>#p. unable to allocate kthread_q㿘  @ t  2>@8 @}˒ $ $ $>`0`""`㿘> 0 0 $0$` @ @  0 2㿘 ,>p @ B @} ,4 @ `Ӓ `0 U($ 㿘>#p @ $ @ % $$  6@  *``@" $`($@@Ғ@  @  *@$㿈>#p` @ $`7''$ ( $@@  `*@$`㿘>#p` @ $`@|$$ (@@ m `*@$`㿘>#p` @ ~$`@|$$ (@~@ S `*@$`㿘>`3#p @ a$  @  '@'` `@4Rʔ $ $`( $@@H@  @  *@$㿈>#p` @ +$`.`>`''''$ ( $@%@  `*@$`㿐>#p` @  $`''$ ( $@ @ ޒ `*@$`P ` ` %  *! 'Ԑ @'' @'@T'ܰ2x  @H @    @g >K#`X `2`@  " &`&`@```2`B 2` =  !@  "5  `/`` @s@@0@`<```@ `  @W@@@`"    @˰ *@% 㿘@ 3 2`` @6@&``&`   2` &`?*  &`` &`@&`` @` `` 㿘  P`  H 2 Dktrace write failed, errno %d, tracing stopped h> D#p'ؘ  ? '''Ȑ ,''''@   '`('@'@ ,'`@̌ @ؔ  @@` >Ւax@6_>K#  2 $ $ @  2  `22 2 2`   㿘@{2 & p& 6 & & ?& P " 2 lockmgr: using decommissioned locklockmgr: non-release on draining lock: %dlockmgr: not holding exclusive locklockmgr: upgrade exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: pid %d, not %s %d unlockingexclusive lock holderlockmgr: draining against myselflockmgr: unknown locktype request %d㿘 ?0 0@   p  `>@5t#`> >@5k#耎` *@& 2`  & ``>֐"*` Z\[D[ Z^D^ * 's  '   &   *` @ ]:` ?&  2 M ' U  & 0P  &  >  >@5  *  : @& 6 0 !  ?& 02 >  >@4 @ ?&   !2     !2 !&     &   *` @:` ?&  2 M    >&  $& &   " >@4 `   @!{  @>@4   6 0ˀ  'Š    &   &   *` @:` ?&  2 M &  "& 0  &   *` @:` ?&  2  M   !  =& ~ $& &   "p >@4F `   @>֐  >@48 ?6     ;& ?& 0   ?&  M@ 0I >@4  '=   9 5 '     (&    *` @:` 2 21 M '     & &  6 0>֐!@3Ւ (" '2  2  2    w& @  lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d with %d pending㿘 > @4 p   $"   V > @4  `>@4 ȁ>  lkmopn㿘  0%$ >`8  !>؀` 8 8!h `& 8@! 2 8 `>8>`@ `"8 㿘 H @ >& `@& & $ "`@&>b`& `""`㿘`"  "`>"" "@@ >`@?"`@ 2>x ؔ MΖ &, >" $/ , @x؀   2 ,0> @@  & >"    2  &㿘> < >"Ȁ  !> ,  "  }"Ȁ >`>-#t@ "" >" <㿘1> 8  8 >"Ȁ " 8 8 ?& 8@u DDB symbols added: %ld bytes 㿐 # @' #@>[#@ X' #@X Q'0# @"'0# @ D'0 #@0 #@: >["Ѐ 7 41>&") 7>-t $"&@" 0 c"Ȁ@ ""& ` >"4t@"<""`0"`8 & >"0 #@"`4"`0"`8$ > "`<>["Ѐ  1> <?   3>b` `" (`ސ M@ 'b``    & <>" "3>`<?   " 7>`4`8" (`0 L@ ' 8 4@@   &`<>"`8"`8>["Ѐ  "Ѐ  > <    1>>"  @  "@  @vؐ 1>q 1>"  " ( 9'"0`>84  <,  ""`D>`<@2 >">"`< G">["Ѐ C 2> S1> 6&"  (  . > }"`<%"(=> "" $& , & ,&  >`,&@y# & ,& , & ,  L '㿘@㿘@A 㿘>" "  , , @v"` 2  "  2 , 㿘 `3 ,9`7 "` 0 a >ڔ">#` a`a`a.` .` >#`M `M  $` ` ` >c.`M 㿘`, ` `   @?@e㿘 `{ ,` "`   "6`  ` `>"Ԁ  > >ږ" @ >`@ `>"Ԁ@ .`f 7>"Ԁ@6` .`$, > `M. `3 `>"  >">ږ" @ >`@ `(>"@ .`5 >"@.`- , >"ؠ`L (` (L$` ` ` ` `.`"*>` L 0 .`*>bؒ Lڔ (㿘 `> ,F`D "` = `>"`  >" ` >`@ `>"`@ .`# >"`@.` >" `L `L > "" $` ` ` >b .`L > ""؁㿘,`" >ܐ *` pppppp      㿀@  H /**@ ?> > ''H 0@J  ># @@2 `a  b"`l> >#&P@J^ D }  `@ ` sH /* *  >"  >"  >"   >#Ĕ "? @ " >"# >># 6: : '> '> !>> '#'>#''>7 > ''БH 0@J D # @@2 `a  b"`l> >#&㿀H /**@L?> > ''H 0 @ temppoolUVM aobjUVM amapRaidFrame dataIPv6 if infoSec AssocIPv6 fragqIPv6 discqVM swapVM page bucketdirremmkdirdiraddfreefilefreeblksfreefragallocindirindirdepallocdirectbmsafemapnewblkinodedeppagedepvfsxform_datatdbpfilEXT2FS nodeadosfs bitmapafsIP queue entadosfs anodeadosfs nodeadosfs mountmiscfs nodemiscfs mountexecttysMSDOSFS nodeMSDOSFS fatMSDOSFS mountISOFS nodeISOFS mountmrtether_multiin_multiip_moptionsNFS daemonNFS uidNFS srvsockExport HostNQNFS HostNQNFS LeaseMFS nodeFFS nodeLFS nodeLFS segmentsubprocproclockffile descfileVM pgdataVM pagerVM pvmapVM pmapVM objhashVM objectVM mapentVM mapshmUFS mountUFS quotanamecachevnodesNFS nodeNFS mountNFS reqfhandlemountiovsessionpgrpcredmapmemioctlopsgprofnameisonamesooptsifaddrzombiefragtblhosttblroutetblpcbsocketdevbufmbuffreemalloc - bogus typemalloc: out of space in kmem_mapmalloc: allocation too large???%s %d of object %p size %ld %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %d of object %p size %ld %s %s (0x%x != 0x%x) malloc: wrong bucketmalloc: lost data㿈`.`>O `@>@-#!p(   5 3  @0 . "!) ' $$ "      @     ,>K `@H /* '@ ?#> H  4  .@ @ @ @ *   $  2o> ,.` $ ?@t@u&  >-#t>`0+>`(@ : @ܓ.@ 2 >@,!H 0Ӱ  >H $ >7#d`(&: * >`,2*`@ ?#@$2>@,n!$ 2   @t$ "7o"$ @@   * @6`"@&`&`  "$  $ * 2` > H:` >ސ"@>ޒb :>b0#`@-#d8&@>ޢ!  @ ?#\>ސ!>ޒb >b0@-w#`$?"` `  6`7o"  *   7o"2#\ *&@>H>7#d>`(&: * R@@>@+"x  ?>@+ܐ"H 0 2 ?$  *@$  $  $`$$H 0free: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated freefree: multiple frees㿘>7#d>H>&  (.`:@*` R  * >O `+`>K `@H /* '> , B >"H @3 1 / - ( $& $ ," ( 4 4 0 < 84@ D @ L H>"H+`  >> >H.` @+"  ,* (!> (>-#t@*  (* "$44  6@ѐ?$` ?$` H 00]7o"@@`>!> 2` @,L@* ؀`    7o""@`@ *"@5  4* `2  &`$`>@*Ð `@$`` $`` $`"@ $@ 6@z?$@ 2`$@" % $`H 0minbucket too small/struct freelist too big㿘 #>`, @mY@s@mU%>$@- >H"c!>%`, D#>7@rcd @j>-"ct>K `> ,-@@$ @m2$  *` $   #>>O ``,@rͦ* @*` @m $  physbuftodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy broken㿘 `>#p ` ` @,`@ @ `@ǔ  ΢``@&@`?@H /* %`0  # !> "X`0 &`0@`0 `0 &`0H 0&`D&`4&`,` @)>@,`v  &`0`*2 @ : &`T &`<&`H`<6@>@)"`$>@)" $`H@~@ @H /* %`0"   "@ `0"`0 &`0H 0@ `H@eฐ?$`0("`<`4 " `<`@@>@)i"$ >@)d"Ȗ "@ $  $`; @ B ?`` " '`   ``@&@H /* % `0?# @&`0@E0 `0 @ 0 * " 0@H 0getphys㿘H /* %>.!$   # !>" 0 @& 0@)  $ >.! $ $" $H 0㿘>.! $& $$ $ \ @ 0 @ 0 * " 0@ <@4" <㿘>K"#>/"#!l & :  )>N@\!l> "`L: )>8@v(!l>W"aȔ: )>5@k$>/"bchgproccnt: procs < 0chgproccnt: lost user㿘>5 $>/b @* @ @2   +" 6>@(z `""`"@ ܒ )  > @(e В )6  "" $""" >p"   02 D 2 0 >N\> L @( "   0  4 2 0 >8(>WȄ @( "     2  enterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession and p != curproc㿘 " >@'# `  `>@'ِ#(O@  0>@'ѐ#X  e      $  $$ $     Dx  ( ?& (>#p $` >@'#  $` @ "@$`$`>8 (>WȐ@*  $@ "  (Ȑ@* "@@$`$`"% @W  @S  <` @"`@ @ <" ` 2& @# & ` & <` <"`@$``& @ 㿘 <` @"`@ @ <" ` 2& @ &  㿘  `"`x""`x`"  "` "@ @? "@   㿘 D 䀢@` ` 2 P` &`? &`@$ P  䀢@" H` 2 HN - " H` "`? "`@  H 2 㿘  L - 2 <  @ǒ @Ē  < 0 2L - 0" D0 " D0 "  "㿘@`  2     &㿘@ "  p"     0 & "  "  " ( ""   "  "  "㿘@  R  &R    `Ax,  & 㿘  0  " .   0f  0 &㿘` 6@A ` 0@"  "5  2 .   ` 2(  (@" !    " `` 0&`@ "   `  @ ` 㿘 @ @ @ `@  @Ò "`@ @   @"& C?@ & & @&"  ( !$ (㿘 @ @ @ @  @&"  ( !$ (㿘`@ @ @ `@ @p` `@ @f` $ $ @$" `( !$`(㿘 @ @ @ @H  @s&"  ( !$ (㿘`@3` @` @Z&  @[.` 2 2 `( !$`(R` `(@ :    *   ` @2@㿘 P  @jP P 6㿘H /* '?6*   t H 0㿘  A Pڐ 6㿘ǠA P 6㿘`  &`  ? 㿘       @?` ?" 㿘@  )  "`M "'`I   h 2:N 9 )`  q . )  * )N Ҁ& < 2N  ) >K  "`>K#  )`  2 N Ҁ&  2  ) )?&  㿘 @  "`R "-`N   A`@C`;`   1`  -``@-` < "` >K  &`>K# `  `@2  `@`  2 `` 㿘    `  4 &?N`Ҵ6 .`  .`@Đ 㿈`>ݔ  @@㿘`(  &  .` @  4 2 @8  4  2  @(  r "߰@4 2   @( > ```  `"`@ & .` `.>` >``j>" 4> > >̐ >>" 4>2 > " 4> > >А >>" 4>2  >А >  @e 4 2   @(    "@>" >-#L:` @ @  @  @V H!x:  > !x >!x :>>!x:  >2- (>#!x>!l:  > !l >!l :>>!l:  >2  >!l :>< < 㿘@ 4   * @`= 㿐H /* .   H 0 D@B2  '`'@&` &@' '>#p @>@""Ȕ"   "@@ < 0(@(@c3`+  +`@ b 2`* @ *`B2*@*<`@ C@c@c  Ж@@c&@ Ж@@c&`@c@c  Ж@@c~'@ Ж@@cl '`@c@ci  Ж@@cb' Ж@@cP' 㿘@ `   R   H`= H@"`Ж?  ""?/"` "`   " "?/" `&"  `@"` 㿘  * >u $  $ 㿘 ? &  *@a2 ( [ (<T>D*xxxxxxxxxxxxxxxxxxxxx`* @"%  0` "  " @  "     㿈@   $` ` `2`Z ` G,` ' $ $ + 2$  2  $  "   $  `  @$ 2  ( " (  $  (@"   $   2   $  *@ $ `; 2`  ; "@  (`$H*`"` "?" `(#`( " `(`0`(`((#`( ( "@  ( "  ( " ( "`>H2,, ( ",  >*` 2`Ȁ``; #``Ȅ #`` `Ȇ; #`` #`̇H > *`" ``"` ȅ*" Ȓ``*`㿘 ̀ ! $>" >z * :` & ̑*  "  Ȑ &  & *$@ ̀ 2 ̐ $a $a$a$aĘ "H@"`? "` `Đ  "Ą("?"ćH  " pause㿘 $ #>!$! $!?@" @& Đ!(`8@ ږ  㿈 $! 2`!  $! ``!: (@ " :   !  ! ?$!#@  ! $!$!$! $! 㿘`` 0 @ ?( % `Ô 2` ` @5   @     ` @㿘 & >K#J 0 $("2" " ` @20+ "   2 $   0 $<("2<] " <` @В<20   㿘 I)  B  >   "  "   2 <@ < 倦0w    "  "   @{㿘  i @ 㿘    ( " <@[ < 㿐 ( $( @*  ̀"=$!( Ā29$!( `< "`<  @` 2 ' .`  殒'.` `  ğ Ē` & !` ̐* & >" .` Ȑ& ȑ.`$$!(@ psignal signal number㿘( >@" (.`(>" *   Ȁ  Ā   ̀   N Ҁ  . Ҁ    ~   *@&  *@&    & `jN - fHo oN -  %>E#p ( N(J`"0+ >2=  ( ? 6  D* & `(   @ڐ00 (h-` $`+ & "  h  . -+ &  h `@ 20 >7  "cX Ѐ 2 2. @ H 0Process (pid %d) got signal %d issignal 㿘>"   ( ,@  * ; ? * ,@  Ȁ $  (("  ( ((21 $4  (@@"  D , -@ @ ^ ( @b@ V@8p  ((("  " İ?  ė*@ 2  * $  $. @``. 7  0`>!@n  ((2    2 D2  D4 `(  ϒ @@  2   2  ((2{ >@C!v Đ $ 㿘 . - (*  D@ & (postsigpostsig action㿐>#p  $>@ 0? *@  .  *$  @` @ a  a Đ  @j0F> Ā@ 8H/` /a  ?a$a.  Ē@ ` $ a  ̐* $ >" .  Ȑ$ ȑ. $@H o@ `< "`<a$ a($a(' `  pid %d was killed: %s sorry, pid %d was killed: %s 㿘 >b 0@f>"( 0@, 㿘 .` 6 >"  $@ "a$ "`%s.core㾈(!   (!># ݰ   >`( *  : `@ ̰ `D 8>$`b Ӕ@s$`''ؐ '''ܐ@b@ڔ! P0@ @  T?@*@@Ր  ?h@h @!48kd0@e8'  @`b'$!$/>(' $+>-a('$'( Ԓ*', ؔ+'0 ܖcL+@@ +@ @6'4 F +(  '( (  0 #\;`#h@Q#l 2-(0  ܒcL  4 (#\;`#h#l( >"*@ 2    #\#`#d#h#l@% @7 @  "㿘  N㿘@`P && #& `>#$*` |ÄÄÄ|Ä||ÄÄÄÄÄÄÄÄÄÄÄÄÄÄ& & uiomove: modeuiomove proc㿘  >@# Q`>cp K`>@֐# G` `&?9&8     2@@5Ŕ50 2@@7h @`@$@"$`&@#&@ B >`4ureadc: zero residureadc: non-positive iovcnt㿘` 2`>@v!0``4@>@o!H  2`&` &@     6ɒ 6 *  $$ ` `&``B >`㿘 @ hashinit: bad cnt㿘 >@0"h 4< , $, < ,  @*``@&?&㿘    2&   & >Kbb &b" "b& shutdownhook_disestablish: hook not established㿘>K"     2>@#``"  "` "@㿘> #H  >K"   @  2 X  ` '```  @4* Ȓ?` -> *`  4L@|(d|pX>Ѐ` " >#>z!>R#P>  > "(> |>d"U -` 4y  L` "$`@w) >@ bЀ bФ  $ @  А `$ >  "b`@w#````#\@``  @w>"`"""@  ` `43 㿐` \  ?! ?`#>#8*` (Lh̴̠̄8͸4Hψ\thhxΈΜΰψ@hhhh  >H  >P  ܖ  >X  >p@Ұ  >!t  >!l  >!x    !>["И@'  "Ѐ`?6    0   >[""А  > !@,!  >%"   >.!@! | y>Ww"!  !>H"@'j$" 7 e  >@PG   @VX @˒S @ N  Ca  >   9   4  U 4  >  X  > \  > 8  >/  @@>  >#@`    @} -㿘`"K ?`F>#Г*` (<TxШ>А>@," > `>(+ >["> `> (" * >[@, -㿘 @@     `&@2  2 㿘 @'P@     `&@P2t 㿐#\@㿐 #\@㿘 \@\:@  @ ,  `% ` "&@@@  @ *@21@@*&@2(  2/㿘 @[ @     &@2㿘 @@ ` `&@1 1ٔ㿘 @@   ` &@1ǐ㿘@  >8  ` *` *  (&@`!>'"&@"x1  &&@ "x  `/1 0   0&&@  ` `2i  >Kc >K# `K >"PN`- "@`? %* @ ր,\h`0` `( ")``  "#` l``  @2`(b@*1<! !16! "Pb``2N`- >/#<  $@& mp& 㿘&@  &` @&``&` `&`` &``&``&`  P@2` N -  2 &a<&aD&aH&aL @ꍐ&a< Ԑ`&aD ؒ&aH ܔ @2&aL D "&a\ 0&a\  &a`  6ad ( ?` `?`l&ah`x " #&al`|&ap&ah` @ &a   2 l`&a l`at@Zj 6a&a|6a6aa` @Za`.aa @Z\ .a  P>a㿘>B "!d>7"#X>!X !>@XV! ͡ 㿘>K#>%  e*  p -`? $ p t $ t d>@]c2  t M$ dH /* .>!X d   ` `* *  @],* @$ d$ ` \@]Đ@]$L Ҕ  8$ \@! Ѐ`1>#p" L - 2  ( 2` ё2 @" @' ѐ@, 0 , БH 0  2 p@/>K@ڐ#>>aX!h) 㿘>%  t* *  \& \`& t( t?  & t@]l@\̒ 2 t 8 & \@Ȑtsleep㿘>#p  @ @`@a  J Ho o> >>G#䀢 > XH 0 H 0  >L - >  >@#$ h$ l$ t, Б>  #>4 @ @ "@ ""$>#T̬`"  (  ` $ (( Ā@``  h  @ , -      , -`@ @"`@ >2*"H 0 ( d$ ( {`$ (  @ @`@E #  ܾ ? #>#T̓`*`2  `"   (( Ā@ `  @ @`@  ܕ  $ a* @ ?  @ @`@   ܀  㿘H/` / h N - @ (@ ($& (H 0sleep called with priority %d > PZERO, wchan: %p old sleepsleep㿘>` #p>#@)>@ Ho o> >>G#䀢 > XH 0 H 00D >L - >  >@ $ h$ l$ t, Б: #>4 @ @ "@ ""$  , -`@ "`@ `@  @   @  @2    >2*"H 0H h8>4 2 `""`" hH wakeup㿘Ho o>  c>4 @@ =   > -? >@" h2($ h"@`"$`L - 2@ t ($ t$ t  (`, -@ ( >B>7!˒"!d>7"#X@ 2 H 0㿐>#p@]>@"`"Ȓ"@   `" А"@@ "?@?/!@$`$``< (2   #X     X  @4  X  @X`B <X>[`   aL`Ҁ 2  ,`@j>[a-"a>@@"ȁ >2  setrunnable㿘Ho oN -` *`>!  T L >@Q! ((  ?  *@ &   (`. -@!H 0 t ( (, ( & t>7!0  >2 b >B "!d>7"#X \ J ҇0(2@8 * >2>B  d>7 Xmawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAPPID %10s %10s %10s S %7s %16s %7s PPIDPGRPUIDFLAGSWAITPID %16s %8s %18s %s EMULWAIT-CHANNELWAIT-MSG%-10d %10.10s %18p %18p %18p %10d %10d %10d %d %#7x %16s %7.7s %16s %8s %18p %s 㿐N > n.>J#P` #PNL@"L@`L@ L@``m>K>@#X>@#>@#>@#0`n#`w`a0. 0+> >` >(>8> @> #\> P>`>>> >@` > >` >>> @{V>!'>8>!@N- @D>0@k L@ n"  w a>2"#h.  %? 0N-( `#\h "#`l "#`#`@?Ӏl 8@12N- >/#<2N-㿐H /* * >L"@'  "@`''А"@@'" # H 0!>@PP "P@ І"?@# "P?/!@# >@ȘȔ "Ȓ @# "?/!@# @BrH 0@㿈@  @'*"@ *`@ *`'`+o 㿈 ) @ " % +U  #@S'>["Ѐ '>L``   0` f 㿐@ "`   >!X'@R"'`+$ nanosleepx@+  |#@R''@I q H /* * #>L``@'А"?'`'?/!'e " H 0>"! >?"  #" ` 9H /* *` ''ܑH 0" 'ؒ" `'ܐ'А"@@'؀ ''ؐ'*"@ *`@ *`'*  㿐@  @@*   ``>!d* 㿈 < 27@ *k  2.` *b  %@ >["Ѐ >L`` @ 0` v` >"adad"` 㿐  O@*.  H*"@ *`" *  * >c  >!`*` * !`@R @Qؒ@W & H /* *>2> h" "hH 0 ` !@Q"@'@R_"@'`)  㿈@R H /* *2  x' |' ' `' 0>L@  >L@''>L   " '"''А"@  *@`'`'`'`'H 0 `) 㿈@ 4t ` )~  2j`  &`  ] Y@耢 2T @ M H /* *@ 0 >#<Ɲ>L >L    'А"?'`'?/!'ƲG& x& |&  &  * @"`"`"`"`H 0 㿘  x   | & C& "??/!>LH /* *   x @  |&  &    & @ &  @ @0@T >c<H 00H 00Ł}x@8  Є?`  2  " >\&"   6  "@@ " "  "   2  "  " " "  `" Є@@" "  㿘 3 @@>O  >$  >G"#І# >(  "#Є >>> probing for %s* %d mapply: no match function for '%s' device>>> %s probe returned %d 㿘   @>#4 "` >@}"@V` 2V`>@v"X>@q"`2  @ 2 ` >@ "h >#4 >`"`@U   " &   "& O & &  G >>> %s probe won >>> no winning probe 㿀?' @'`   @ '>G#Ѐ`1'@  ")` V * 2  ($V*`: * @@*``  2 p V $ ݠ $``2@>#4 耢 " >  >@  @ ސ 㿘 @>G`   @ >G#Ѐ8` "0`T %* 2  ( $T*`: * @*``  2   @> T $ ֢`$2㿀''''''>R!`!> V* @*`@  @Q" 2V 6*  unsupported not configured 㿘0 @M   !>ƀ#8* @ M root device %s not configured 㿘   >#@ 5 @$㿘?` .?@O;  0.@N ` 4??`0.%s (root)%s at %s㿘  `    `  @ `* "@V   V `  6 6 &`>O``&``"``"`> @ ܒ` >G> `@ Ք` >G#Ѐ%   " 2 $V `@2 $V  "6 V  2 $  6  $ 뀢2config_make_softcconfig_make_softc: allocation for device softc failedconfig_make_softc: device name too longconfig_make_softc: %sing dev arrayexpandcreatconfig_make_softc: duplicate %s㿈@ '`>@ "p Δ  2>@ "@P%&& V` 2V`V` & V`@  *  & V`@&0& @O $@  >@ "'` ' & $@/` ,` 4$, $, $,  w   ,``>">#>#@  @$@Oē*``'Q $ * @ ># @ } evcnt_attach㿘@Oi (&>@ n!p@Oh&>$" & "@" >O"  $2 2$ bad unit in detach_devices㿘>O  ]   "S   ؐ 2K   `"E @ 2@ ƀ `@>@*` >@ " "  `  @*` 2 `@ *`2 @m $` ` $`$  " R` "2` Z   `? ` R`  R` 㿘 $  㿘>#Вu㿘> $l㿘 &>Gc`&`""`>O @) `   @N 2``@2`Ho o`  €H 0``2` `""`>G"#"@@`"   `$ `  㿘>!   2  `"  "`>G"#  "@  $2`@"`$B" $@7$"9"`$$@ @:`@$ @*,$2`T T&%$$2$"`$$2$"`$@ @*$`@*$2`T T&$$2$$"`$"$ (   @*`2 %s%d%c: %s %sing fsbn readwrit%d%d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)㿘 G` `: ,`"@ a>@ߒc> !>   0@>#ؑ, : >#>#  <" T> ` > > <  T: @ `( , <`(@!,@!>  `8@PT`8@O!>`, 0@PE@O><  >7 t㿘 >7 t >< "   @MO  2  disk_attach: can't allocate storage for disklabel㿘!  & `"   ``& d 2 >@"x@MI! d@MF"H /* *>7"& @" & DH 0 &><``& `""`>7`t "`tdisk_detach: disk_count < 0㿘 `S  dP `"  "`><"  "@>7`t? "`t>@ΐ#`$"`$H(>7"`H"`LHdisk_unbusy: %s: dk_busy < 0 㿈 $??& $> @  H /* *>7"" ?H 0  H"' L"''А"@' P T@& PА"? & T  & P?/ !@& T& H` & L 8>` B (> 8`B > ( 0`B > 0e@H(   : (: 8: 0H( >7" @" DH " T" PH rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs +>a   a@" a4` .  `>"  @B )>>ؕ. #p* >"a@Ȕe`e` #p@  >#a@#p  , 2 >@#8 >, 2,>O " ! ?>@#X> >b쀠b> "bb"   b " 㿘>" "  @Kx   2 㿘>" @  extent_create: name == NULLextent_create: extent `%s', start 0x%lx, end 0x%lx extent_create: end < startextent_create: fixed extent, bad storagesize 0x%xextent_create: storage provided for non-fixed㿘@ \>@" >"0@l>@"h +>"@ `> @"@K 0?& $& ( &  `? "@ " " "` &   آ  2&  & && & & &  &    & ,extent_destroy: NULL extent㿘 2 >@ " `"`"@@    㿘   2 '`  @ 2'`8"'`'`   '@ " &  9'` 2+'` `2@'  @ "" ' `""`"@@ "'`@0 '`  '@" ''`extent_alloc_region: NULL extentextent_alloc_region: extent `%s', size 0x%lx extent_alloc_region: bad sizeextent_alloc_region: extent `%s', start 0x%lx, size 0x%lx extent_alloc_region: overflowextent_alloc_region: extent `%s' (0x%lx - 0x%lx) extent_alloc_region: start 0x%lx, end 0x%lx extent_alloc_region: region lies outside extentextent_alloc_region: can't allocate region descriptor extnt㿘 >@" @>"@ >@":  >#@>@#P@ * @(> @#p>#@>@#@ 2 >@ 1  @ '`#`      & !>@ " @ɒ # `2`Қ extent_alloc_subregion: NULL extentextent_alloc_subregion: NULL result pointerextent_alloc_subregion: extent `%s', ex_start 0x%lx, ex_end 0x%lx extent_alloc_subregion: substart 0x%lx, subend 0x%lx extent_alloc_subregion: bad subregionextent_alloc_subregion: extent `%s', size 0x%lx extent_alloc_subregion: bad sizeextent_alloc_subregion: bad alignmentextent_alloc_subregion: extent `%s', size 0x%lx, boundary 0x%lx extent_alloc_subregion: bad boundaryextent_alloc_subregion: can't allocate region descriptor extent_alloc_subregion: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx extent_alloc_subregion: overflow after alignment㿘\ `>@"2 >@"(@ *  @  > @"X>"@>@">&  >#@ޔ>@u#8 `>@o#` @: >#@˖>@b#А@  >@# @   `@ *     > 8 @>@9  ` `` `2`` `    `<? `@ L@J@*(` `@#`?    9 7( :@``"M" J:`  `  @  @`˒? ` " ," )` `` ` `   & !>@ c @  #"$ extent_free: NULL extentextent_free: extent `%s', start 0x%lx, size 0x%lx extent_free: extent `%s', region not within extentextent_free: overflowextent_free: start 0x%lx, end 0x%lx extent_free: region not found㿘 > @b  @  @@>  @> @N!:  @>  @> @A!PJ *CB@2  2 `""`"@@A  2)@   3@ @  (@ ( :@2   "` "` &  "@" &"`2 @> !h@U> @!&    &  " ?&  㿘  ,   `#``   & !>@ 2  쀎` `"  "`  "@    `{   & 㿘 `"- ` `  &` &@ " &  &`   &` &@ " &  &`     ?& 0ܐextent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx 㿘 2> @M!  >  @!   !>   @! 2 >8a>耠L  "aa"  "" "  (  >8 >  klog㿘 > LHo o  @#%>  H 0A #!> $ "  H 00. @‎H 0> b ?"b  <`/" `8 `    /$ $ ` 2 㿘Ho o`> L  @ > H 0  @7bH 0 㿘>8! > "@=? ?` ``្ ? >K L? ?$? }@"- @w@:?0< ~@7 v@$?02H>L H&">   >      > " kernel %sassertion "%s" failed: file "%s", line %d㿘> "@%s: table is full 㿘>  c@0panic: 㿘'H'L'P'T'X3>Gc! H!!>"@&c> @Q#H@gH> @K#P>#L @'@㿘'L'P'T'XH` @   L@H 0>8!    @%d㿀 < @B > `@8O   > L@4  L   > @+ 㿘'H'L'P'T'XHo o   H@QH 0>8!    @Aٰ 㿘>G#䀢 >"#`  `># ```@:  ```>c""c`   `> P `> L a@@Da&*`  /&&``>#  ` `>#T@`Q㿘'H'L'P>#p'T`(  'X`     @˘H ("   "   㿘  ? &G 㿘'L'P'T'X  !    @6   @L%㿘'L'P'T'X  @~L㿘'H'L'P'T'X   @pH㿘'H'L'P'T'X3>   cHH@_&cH>Gc䀢`&cH㿘!>   #H@K$#H>G#䀢 2$#H$#H㿘'L'P'T'X  @6L.㿘!>  #H@)$#H>Gc䀢`$#H. %qo%qd%qx0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad baseH'L ''?N*`:  ` .LN`' %N U  ''?N `Z> #d*` B$B$B$B$B$?B$B$@,B$B$B$B$B$B$B$B$B$9 ==B$B$B$=d=B$B$=lB$>,>?0=;?`B$?B$B$@8B$;`"N   L hN  : L  > b0  > b88> b@ O `2L .LL` '"JNL 7 *  :  @ %`  < ,*@ < ,L֒ `.L˒L` ' L 4Lͦ " N` > >.L`'`>" %`  `'  '   `@  * :  :  >` -" B@ `> "H'`   x'  ' `  `@  * :  : ` 2@ ` -" N`  `' '` +N*    ? * ?ФN Ѐ (,&?` ,* ?ФNЀ  y'u`@N l2q` n`      '/``  `'`  'd`   `@  * :  :   ` -` >"  > x< u: o`   :`:`2  `@  2  "``  `'   '$   `@    d    > "H'@  xX   > "`  @A "@ @@ݐ``  `'  '  `@    % > "h> "H`  ''  ' ` `@    ` 2@  ' `O'`"- `3> 0? ` 0, 4` 4  -`6 04 01-  @<`0-  @< ` `0-, 4` 4  ` @ -'"@@H '?/   & ` 2 ` #@`  .LÒ `L.`` 0 0.L`.L `  #@` 0 0.L #@` 0 0.L2M .Lq`` #@`  .L^ & @'㿘` @@`"  `H /*.`"` " @"``X"H 0 w 㿘,  `@ &&@  `  @;* 2`@ 2 `   @? $`$`>7 "cX (  & (㿐 ( ,* ` @ $&@    @;Ɣ* 2`@ 2   `  E   B7 rminit %s㿘 `6& >"/ &&  @& "``@*"`rmalloc %s㿘` >#0 @  `  @`$ ` "  $` `@ *` 2     " "?# "#rmfree %srmfree: map '%s' loses space (%ld) 㿘`4 >  $  " $ h$f$ @ <   @$Q MJ$ >   $ "9"? À ` `" @ $   Ŗ " ?? "?2$ @ >  (`|""? ( ?sshowquitLlinesllisthhelpffindqexiteenableddisablecchangebbaseaadd > >>T>#c\>(S ` Rd4"d R2R$`>*` (2 >>"`$`>` `--- more --- 㿘!>#h >#l@2,`>+#@wk$#h>$ #h,`:  q`$#h Q %d0%o0x%x㿘` > >#X " >4 > 2>>   %s*FOUND***UNKNOWN*㿘. > . @*`> @  >ސ! V `>!*` MMMMMV >̐ 0 >!(>!0>!8Unknown devno (max is %d) %3d at root%c disable ??? %s 㿘. >#\>  >>!0P". *> >" `V? >"(V?"T` %>0|V V? |T`   4>>"8>"Hf>`#T*`R ?` %>>#0@ V* @UPC V? >K"X㿘  N -  N 02' N x  X2   А     ɠ  @@3  ` •`  ? &@     `( K*  ?Є 8K (8( (* :   Є ?K K "  "  " K?"@22 㿘? N  `J@   2J@,`>cd:  4,>#0*: ,`: @<, `@; "`* >cd:  ,`,: ? &@?%s [] ? Unknown argument 㿐 %>@ >"n]@>i#@4, (L J@ "` "` "`J@    > &@J#   >change (y/n) ? changed 㿘>#\  . : '>%>,`:  N",`(@uh"X, <  y Y n,`,`:  y Yg. * >`   ` @"`$` " `$` ``>#T,R@?  `* R@?2`,` R  >>#T,R ?>#0@ T* [ T?`  @;ƕ,` % Œ >". < ̐>  0>!Error unknown state already disabled 㿘>#\ / >`. *  R` "  "  >4 > 2` 2` >{"H>"w. :  >o"`>l"p0>h! enabled 㿘>#\ / >`. *  R` "  "  > " >2` 2` ?"H>";. N:  >3"`>0#`0>,!command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] %sshow attributes (or devices with an attribute) don't know㿘 > P>#p@Jz)> @@:@    *  ?* : `'T*`>#0 [\d\d\d\d\d\d\d\d\d\d\d\d\d\d\d\d\d\d\d\d[[[\\ \\d\$\d\d\d\0\d\d\d\d\<\d\H>& ># >  >!>!8>!`>!>!>!> ">" >&b8>>"h >"X`@J 㿘 >>`@"#h   ,` $^:  `>?"ch%s 㿘 >>d"ch'>>#0   , cd >?"chUnknown routine /%c/ 㿘 >>c\@ O"#h>#T. : .> `* U ?:` ,`>@V, `2@z@! r e  s d >! >!9  < >   V?Τ >#\`@`$>?"chUnknown attribute 㿐? L@"L@`L@  @  `L@L@ "` "` "`,>cd:  4-`>#0*: ,: @8 @8= "* >cd:  ,-`: ?2L@>#   ؒ >G s0#㿘 / :`c>"#h>  Y.:    @8 2K$`@7 2C$V  26$V.: @20$V  2*$ )`d`e`c >! `f>!$^$ $, : $? $  ,:  c>?"chValue missing for attribute 㿐N"N N    `NN "  "  " N 2>"h/  >.`: .:0#i%s ? Not same device type 㿐 ?'%>@> >#XT @0 (L L "  "  " L 8 2 L>#\ *>2!*` *  `@7) >##`` ' ? q   f ` Q> #` `>No more space for new devices. Device not complete number or * is missing/nNo device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')h@7 $>#\ >#`@>Ð 0.:  >>!0 `   @7? 2 $`@6 " $  >>!80Ր!X a6̀?">`* + @ 'И  ' ' ' >' !'  i' ' '77̀>#\@ 4#> > * *   $#@  "`"` "` "`"`"` "` ?"` >̒`Б+` * "@Ԑ " " " " "  " >c"   " >#R  >!  >̘>!R  >?>\ `  "\ @6 2$`@5 2 $V  2$V4$ 2> @  @6n 2$`@5ؔ 2 $V  2$6$ 2"W΁Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected Unknown command 㿐 NN "  " N> N`   `>#p, J ?@ @62  @5k " J NN "  "  " >M <>8!cp* @ ?* : `'+> *` lpppppppppppppppppppplmHmn@nopp0pppp<ppppp`pphN 2>"Ē >>"#l#N 2>"   >WWܰ א#N 2>А"0 >   >>"#X"0#N 2>"H~    >WW c #N 2>"`  d R    >WWu dr m#N 2>f"` ؔ e^ & U e  >WWI eF A#N 2>:"H  * : 1 A  >WW% f" # 0N > 0#?N ' 0  >" UKC> User Kernel Config Continuing... 㿐>  / / / / /}/> >-#@, ( P > Ё    N - h`@` *@@J  2`D 6`? '`''ؐ '`''''`  @`2'' @`ذ  耢 ?  #2` `$  @`2 & 2 & `@; &8`@`  @*@v  2`p   * $f  ɔ  '`''''`  M '`  ` '= ` `  @`2   ؒ @ذ  耢 ?  # 耤$   `@  &  h`@` *@@O  2`I 6`D '` '?`''''`  @`2'' ``ذ 耢 ?  #  + `$  @`2 & 2 & `@[ &8`@`  @*@}  2`w   * $m    '`'ܐ '''`  S '`  ` 'C ` `  @`2   ؒ `ذ 耢 ?  #  ϣ 耤$   `@ؚ   &   @ *@ ڰ   2`԰ " ", @  ?*@  @   *@ >`,2      Jx `r `0@2   `$@ "|";@"{Zn  "} "~d@ 't    ?4   b~tc@ 't  @  ?4   b}tOT  't ("`(  "`,   @"`0 Ð 2 6  't  `vt*T  ( ( !$@ `w@ $@   ``۔`3 select㾰@` 4&@@! 2 ,`,`-    @1ؒ'(','0',`'8@1ǒ '(X',x'0''' ` ( 2(` , 2(` 0z 2(` 6p  2(ޮ  H /* * >L    'А"?''?/!'ʐ " H 0( (>2  @%((@@| 2I( 2E(H/` /` >L`  `` 2(@& (H 0%((`@>2  H 0(%(> #L!>PH 0 "((? ?%(  #" (``" `ݔ 2``Ԕ 2` ` ˔ 2(8@  㿘  `2 *   ># @6,4`* @  ?@-@, @ ,   ` ,  4  *  -@  &` @ڑ4`в@'  㿘 0@ "&@ " &@ h> #L@2&@` 6`㿘 4   >2> #L "  6  "&Ho oh> #L@2 (J-  0ː 0 @ ?"(H 0㿘 5 >#@* @  ` "%``  6`>#T`@,   "  ` ` @4` `@Ѳ`'poll㿐 ` `* @Ԕ `  2`` `?B@-#'* "@*`@*`$ *`" *  * ' } H /* * >L    'А"?''?/!' " H 0 (>2@$(`X 2F(Ho o >L`  ` @(` & (H 0%((`@>2  H 0Đ$(> #L!> WH 0 (? ?$(  #" @* 2 㿈 H  @n H `@ $`@@e @,$ @ " &>3 3 # # (   2 2 " " (&$`< $ <Y* "@@k@ipipeinit: cannot allocate pipe -- out of kvm -- code = %d㿘 >-#L>[a@1*@\!& >$"  ,  & @M ">>"餐   @ " 㿘& & && & & @& <& DHo o>L``& 0& 4`& & $`& (& ,H 0  @. #& 8pipelkpiperd㿘`( D  $ D`)>""F @  "@@ 8 `@8 @! "$ @ !!j 2  @!" @ !$ @   I @ ~b$ @ |$ @ a    $ $ "P$ Q  ?$ @ݐI ` 2D # @! "$ @` !!  2  @!" @ !$ @ 2> D 2 @$ $  @ ~b$ @ |$ @ի @  ?$ @դ!>" @  $ @ 2 D` 2i 2 DHo o>L $   $ $H 0  D? $ D @ 8 ?!T@5`- @ *! #>""$ @ !aӵ 2  @!" @ !$ @ 2 @$  @$  ~b$ @ |$ @D @  ?$ @= " !  @ @ ?$ @ pipbwwpipewr㿘( < "=  @`"`7  %#>6c 4" d2  @ 8     >$">   " @G# $ $ $@$ c$  $c  2+ D @! #>""$ @ !a: 2  @!" @ !$ @ G @ ~b$ @ |$ @ɐ D $ D` " D+># ?$ @Ի!a 2  @$  `" "$ Y#@8U @  "@@ 4 `@8 @! %>""$ @ !ݖ   @!" @ !$ @ 2T D @d b ~$ @ |$ @l @  ̮ @ ~b$ @ |$ @Z 24 D   $ $ $$ @  ?$ @E  # @ @ ?$ @ !># @  ҉$ @ 2  D @ 2 ` 2v @ D? $ D @  ?   @  ?$ @  `  " 2Ho o>L $ (  $ ,H 0    @ @ ?$ @ʐ  }@ ( @ @ 0 ~@ @ 0@ @    88 "㿘 (`  <``") @9  05 @d22  2. `2+ # &  @ "$ " !T  @ @$ @ 2  "  @  B  @ @& @ 㿘@+Ӓ `6` &`@`@ >`0@ B B?@(>`8 &` $*`" *  * &` (&`  ,*`" *  * &`$ 0&`( 4*`" *  * &`, 㿘@ (& ( pipecl㿘 E @ @ ?& @  D !>%'  @!& @w  D  < "  @ @ ?$ @  @` $ @$ <   @>$>6c?"c>$"  >` " @E#` ptrace: impossiblep@  ` 2@K @`#+>%#D*` ddddddddddd 00@  (   @2"  0  0 2&>["Ѐ?$&  (h  D L - @2&0&@`# >& Г*` `44444444444444444444444PL ( D($ (`0 $ T `2` 'О 'Ԑ'؆ '܀ `ؚ8?''@ '@'`     $  ( 2`@C``" @ , ?$ @ 2L - D T 0@" $ T >/#8$ T (*@$ (L - 2` `Һ2 [ `X T ?Q$  &`  ( D( $ (0@$ T &`  @  `ؚ P  ?И'ؘ '?''@ '@'# @Ӑ   `ؚ!  ?И'ؘ '?''@ '@{'>%ǐ"؁ 㿘 (   @8S 㿘 (   @6 㿘# N ( ";#H2L  "~" "}2?  #%28  ! >3 G     X"3 ` |3 X   X =3   |3 X ?3 |1  8# ( # ,  $# 0 (  "  2  " i r   @ޱ     @   @9㿘 (H /* !`  ``"I 40[" `0X 8 H@   V   $ CH 0G  h d \"" 4  l         $  H 0# { t | 6 |   @ H 0 f P X 6 XH 0 㿘@( `06`    @ 㿘 ( "$ (@3$ (㿘.   `@ 0`2`` @e  `@`@e    2@ 2` 2` 2` 2` 2`  "` "@ "` "` "`  2` 2` "`msginfo.msgssz %d not a small power of 2msginfo.msgseg %d > 32767msgmaps is NULLmsghdrs is NULLmsqids is NULL㿘 >!  * " >(/!#@$>O>('"  >( "0 >2?>!Ē 422@ `>22">7>!>M#T "p>("@  >M "`""@ ` >M#T>2> !">("P>!`    "`(2` `\msghdr->msg_spot out of rangemsghdr->msg_spot != -1㿘  (>!>2>7V >)`>)ⵐ >O * p2   p 6 `0`"6 6   2V V ?>2>)═ (b&"b㿘 &` &` &` $&` (&`  ,&`$ 0&`( 4&`, 8&`0 <&`4 @&`8 D L&`< H`D&`@7 msg_cbytes is screwed upmsg_qnum is screwed up@@``? # @>!Ȁ6 > * * " a* @`( " V@` @2{ "4 0q[ 0n h` "`  ` " $` `$$`$V 2 ` "`$>)! "$`(>) !֐D a @ T :`(@>  >0 !̀@8' #?$`b`$`  !4`$`(>L $`D1! @ٔ T  "&8@``? # @>!Ȁ6 > * * " a* @ ( "} V@  @2w "4 0m[ 0j d `" ` " $  $$ $@`2` " $>)u! "$ (>)o!:@  <k \ 6 (@>` >, !̀@8' ?$ b $  !4 $ (>L $ D!  A \  "&㿘@`  *>!Ƞ6>> !`( " ` >  `\>!Ȁ & N Z @0FB >!Ƞ 6>> !`( 2 `">  `\>!`2&`$  &@ &` &`  &` 6`&`&`&` `&`$ 6``&`(&`,&`0&`4&`<>L &`D` ?# *`@&msgwaitmsg_perm.mode & MSG_LOCKEDsegs_needed > nfree_msgmapsmsgsz + msg_cbytes > msg_qbytesno more msghdrsmsqid_ds is already lockednot enough msgmapsnil free_msgmapsnext too low #1next out of range #1next too low #2next out of range #2didn't use all the msg segments㿘@``` ?# @>!  > * * " a* @`( V@` @     @(??!`( 8 `` " @  8 >7 p4 >2" " `Ā "4` !>+0 `` 4` а `( 2`(ʰ `>7>+  p$` >+ `( >2>+ ⠀`2>+ߐ!4` ?4 4 +"⠄ >2>!p`Sb>+ː!0b>+Ő!H>+!`&>+߹!p p?>O *  3b2 4   V  `ې ?a =2 ( >!->J   + : 4 >+߆!@>+߁!@'  &>O @.`@+ : ?"?>+h!`! @`(  4`)( ` 2`$`  # ?a 2 0"$``"`  `$$` `$`$0$`,>L " 4& msg_first/last screwed up #1msg_first/last screwed up #2msg_first/last screwed up #3next too low #3next out of range #3㿘@``?` #` z>!ȀȰ > * * " a* @`( V@` @ E! /` ` > " `"'$` /$`>,̐"` (`   @4  "` "$`>,ޮ" $`2 $`>,ާ"ؔ 2  /!>+ɽ ` `(  ?V@#` @ S  ` " `$$` $`$0$`0>L $`< 8    09 #703 * >!/>J`  *: 4`>,U"@>,O#@&̐ W ٬`>O .` @v& sema is NULLsemu is NULL㿘>K#䀢2>L>-$" 0 2>>-"!`  >  "`2` `@>!`   >7 >L 0"` `d>7""㿘>`<    < <#  < semconfig: unknown flag parameter value (%d) - ignored 㿘ݐ@  >- #> " <>" <ʒ <&@& &semu_alloc - second attempt failed㿘 >!>L>7  @>!0  2 6 "& &%#"`@ d>. "耦 "V  2&  "@@ 2V  | h$  㿘@2R>7"耢 "&@22R H  2&@A R +  `2`R@2` 222R ' ?2* : *  #`  #` `Rۖ  R  *  `22"2 >7耢/R &   2"S  2(8 *( " ?" 2Rޘ 2R㿘 &` 6` &` $&` ( 0&`  ,`(&`$ PX@`` ` @?# i>!6j >K#- @`""b V@` @2\  T >/ ؓ.  T4 h B>`8$@" `>O 0"8"@ *` *  *  *  :  $`  , *  `* @*` " ` "` " >!` 64` >K#"" `(  `*` * ""  @4` A  ; 8 ?$`ƒb`$` Ȕ !4`>L $`(y! ː  Ő2 8c!  & `6 , `* @`O!  & `6 , `* @`;!  & `6 , `* ~@(! zΔ  t`m  `, Œ c `` ] ! X &V `6R , `* @H`  D B `>  7*`` *$3 ֔ (|  "`  , ` m@  `` ?G$   "&P@`` ` M@?# e>!6f >K#- @`""^ V@` @2X  P >0"ȓ.  DdŴƈHt >>`8$@" `>O 0"8"@ *` *  *  *  : @ $`  .`*  `@* @*` " ``"`@ " >!` @64` >K#"" `(  `*` * "" `@@4` Ŕ   @ ?$`Ēb`$` Ȕ !4`>L $`(! ǐ   @!  & `6 , `* @`ה!  & `6 , `* @`Ô!  & `6 , `* ~@! zV  t`m  `.`M c``@ ] ! X &V `6R , `* @H` z D B `>  7*`` *$3 ^ (  "`  .`` @ ``@ ?Ƭ   "&㿘@` `@ 4>! @6>>K#`""``>`@ `@>!@ #>Kc.` @  oc h  &Y>Kb "^  >!$T >`8" 4N  @6>>K#`">`@ `@>!@>K7 #.` "`> 8" . `@"`*`"@# 8 "`>L" 2?2" *2>O+` 0*  " @x"(>K#.`   *`?#@@&semwaitsemop - can't undo undosp @`' @*?# >! >K#.@ "V@  @e ` `ؒ-`*  0  5 7  @*`  T* `  $ 2 *  2 2 2 @ ` 2   2 2 ``@&Ϧ @A 6   * @*`  " 2 (2 #T 2  4  4!>2ö ' " ?V@#  @ "To  2 ?4 ?4J @Yؤ @"=`T  8Ԕ "1` , * `@"?V`  @ה "?>2E"? ,   * @*`  " 2 0`@  @آ`@ *` *  0$"'@'@ semexit: undo vector disappearedsemexit - semid not allocatedsemexit - semnum out of range㿘>7"耤  " > 2 > <`#@! b`  <  <  <>7"耤  "   2  2 T >3# <>T  $5 61`>K#T`*` `"T` >3ש#@`>3ע#` * `*  @*3  `* @2[ T բ`$ $>`<`<L"`<> 6?>B"    8?? >@ >B*` ᐅ( 2   :  㿘>K" 4 >,? @@] & 4"6 > > 0>5> ( 84"@"8?"㿘?`c >B, "@*`  >`, @@\ ? &`>L  $& ,?6 $*  4   $" >O" X 㿘  Ȁ>! 6>?"@@> >!  㿈    >!`  * `  @6  ?" `@ " I@ 2`` @!! U>!   ?>`@  >!@C  ``> ,@?: @  `` ` @ '@ &  '>-#L @`@*@ '  @ #\#`@G] $@$ 0$`>L  `$$`( 4`$&㿘 "` "` "` $2` ("`  ,"`$ 0"`( 4"`,h @@ 2`Y `8V >5"*` Lּּq! Dɒ` 0 9 7] 0` 0 )?$ Βb $ Д !4 >L $ 0?  $ T $$` 4 >O@?# @"X ` @f@ 2`U `8R >6 t*` @؈HH! 2@` 8 9 7 20` 8 2)?& ̒b & Д !6 >L & 0 2 & V $$` 6 3>O@?# @"X shmget㿘>B.a" * @ d@6 !$>6{ "  # "``"` @$`  && ? # *`@' shmseg free count inconsistent㿐 >``@ሀ>5  ` >  , > 0> > ( 8:@ ` >O `X  > >B!`"> `8>! >6"?"`X  >B,"*ᐔ,@4 @  $  ?+ 4 ?#  *#\>K#` "@EØ  "4 >O" X" 3 $ 4>`($ %@> 0> 8: @"8$ $    (4 `>5$  " 0>L$ 4 $$ $ , $ ( @ $ 0?Đ*@4 O& 㿘@ ` !@   #`" 8㿘  Ȁ  ` *" >!  ,     ` "   ?#>B!`?  * "@*` `$ 2`$ `㿘  Ȁ`>!`  6  `?"   `  y  " ȁ㿐>`,!>!@$!!>$@w@3 >K"b >O">B!2`2` `8>O" X>5" > "#8@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@㿘H /* &&`l`p    &`p`@ &`t`p =&`pH 0 㿘>c""c@ߒ & x& | & p 6 ށ 㿘`l* k`(`@a@a >% (`D`" ( &`D>5 (`$`" (&`$>  P``" P?6`.@@ 2\ @  `x! @@@2/`p" !`@’ ! "!@!  ( 퀌@`@"`p@`p @h 2?h2``p@*@!&`pd=` 2  ``  ^@ @`p@ ]`p &`p ` ! @`*@&`@+ @ D``( "`@ `&``6 2  ` 2 `@ @   `x 2   `@ @ `x  `p' 2 " `p!2 !&`p> nؓ*@ *`@ `€  i 0| 2n`  2]`p2  `2`@2 `(2`a@@'*?`p( ( 7&`p ) ! '" `  ^" ~  | { } \2?(#&`p? ( 2  " ` "`p@`@  `p2/  +`V``@` `"`p@`@ ` `p@ g` @ b``"6`@A`6``p>*@&`p 2G  CdA b@`  ?@ X0Ɛ@ S`@?  >8@Q`p   `@@ ;@`?    @ @@2``p 2  d" @ Đ`p 2` d` `xݔ @2w`p@ s`p``( # V``H 6e`p @{``p@ \`p@` Ua @ @ ǒM`p"6`   2`րd " `6`֐`@U`(@ ܐ `p`֐ 6`֑* :  2`p`6``p@*@&`p /@8V`@  2`p `"`pV`Ԑ" 8  $ `p @ ?  `p! 2` @  ` * `p&` >&`p@ 㿘` 2 >-H`d "H`&`d` @2?@o`H ? 6  3 `/ `   "@ H /*&>:#@`H>-H& `d@"H&`dH 0`Ԓ?6`Ԓ   2?  ` >-H`d "H`&`d` @26`Ԑ @`H " 6` ` 2 ` ? 8`Q?` M@`@I?`0>;"@*`   ' ! ^ ( ) \? "` \>-#H`H`d##H@&`d C` @ >-V`Ԁ "8?>-H`d "H`&`d` @>8@`H &>8  ?`V`>;#ؓ*`  0(04 6`` " 6`  ?6`԰?/dev/console0  @)  }@H ] r@W# ^@"R g {@c3 z  @D#    @(  e  u@4#  @ F  @*  @> h  g@# 5  @1  @ .# &  ߔ >Kc!>h@ Ƙ   | @ (` h x `  Ȁ Ā" h@" ? n@@ @.  @ @ݒ ^@ a@Ғ @"w h  o@["@k s@ w@А  @" "}@:   @ ] r@ "~@  @U  v@_   b@Q  e@l  g@i z  @v  @ s0̑H /* &   p  p ?$ pH 0c @^&H /* & p $$ pH 0L ` ` @C  3>#  " ' p ( (2'2 'Ԑ @'ؐ '>< @''@E" $`@d !@em @h[@K > "#>c""c @c " 0  , 6 6 6 6   |@2  ( 2  x    x "} {#H /* &   $ H 0ư H /* & p ;$ pH 0 R HH /* &#@  @   H 00 @2@D  :  Ȁ€ "  pH 00| p2    2 $ ߐ"$ p@k$ $$ ($ (   |   { @q  @"C  ! @;`$ @C4 @ ( ' ' ' ' ' ' ' ( ,$  0$  4$  8$  <$  @$ $ $ ($ ,$ 0$ 4$ 8$ < $ @*@$  $ h$  ( 7&      $ H 0 >!`  l  h  H /* & >`*@`€.@ €  h*`@ €H 00, hH 0 H /* & p!   @   *@  p" ~@" pH 0         >   |@  ( > h`* €w H /* & p! !$ p> nؓ*@ *`@ `€ H 0W   `Q `  | " 䀢 G   $ | $ x  "  ( :' (R `  |  ( `- 2` )  & #$ x@  @Ȕ   4 4 4   x4   @  㿘>ؕ2  *@ *`@ `@H /* &` `"V 0@'   @ p   H  H 0   H 0 㿘 @" @ !  (    " 㿘 H /* & H 2 2   @/ Ā`+@ H 2 p p ! p2   @ Ā & p> H!x@   H  p ΀ H 0㿘 @ 㿘H /* &`  (`" @  ( `"6 @  6 6 ؐ p>* @& p@-`> p n ~& p*@ *`@ `€ H`@ ̐ H' H H 0㿘> @  㿘  ($   p ?& p!$  ( p @2 ( !"  ( % $"  "  @ В H 2  p`@@2& p @@ ̀ €   p @& pttrstrt㿘 >@#@H /*& p @ " pH 0㿘 Ā`@ 㿘`J 0< 㿘 p ` @` & pސ3 20 & p> nؓ*@ *`@ `€ !  p ` & p  @2  | "   "}    `@P" p 㿘`" p p & p ` & p  @2  | "   "V    x *@&  p   & p' ' ' ' ' ' '& & & @ ؀ & p0 *@& p㿐>#p H /* & H 0`| @(`($x `Ȁ $ `Ā     ~ >Kc!>h@e "0 H /* &S    &Op0+  *  *  *  *  >  >L    t >L>L     ''>L"*"@ *`" *  * "@  #`U>!X@)Вb? @ wb@( E(p   @  p  H 0  H 0 #> p> `!@ԘH 0   # m # #""0gH 0 @  I 2  $2 x  `8>Kc!>h@ . 2 #         H /* &  @ H 0㿘 p @%  $" ` "  @  H 2  p & p @@ ̀ €  p ?& pttckoutq㿘V ڑH /* &` >#p   HȀ@)@' H`>#p  >H 0 >aX" >C p8& p  HH 0 0 V ڢ`H /* & p*   @%  H 0  H 0 # !>`@ H 0׀H 0>#p | @2`( "` x} @y 2x` 2s`Ā 2o`  o   >Kc!>h@u `  @2&` H_` d` 8  逤`>+ )>- >8@  ?@6  69 H 5 H1`06 ֐@  H$ Ԣ$@#H  d@6 Ԕ%#H& d  H`4 ͐` 2 `4 `>&` H?H /* & H  H 00H 0` &` # H!>x p `@& pH 02`0 ttyrub: would panic c = %d, val = %d 㿐` h  *@`{&`V`ր +>  >8  ?g>D"L* h|||||@t n`` @"j`֐@k e`V``@@t0^H /* &``p V`Ԕ &`p`  `&`@ 6` @`@  ` *@&``p*@&`pH 0V``Ԡ$  6`Ԡ ?,"`֐ ? `>D!F`ր`  `p 2  &`p \`@X`֐?6`ց㿘     㿐 " @: ؒH /* & (@ {  @( (@ B  @ l @ @ 3  p*@& pH 0 6 6 ց㿘`p@2`` *@&`` (  ( @      ^   ^}  @ ?u㿘  p   x  @2``@2@?㿘 @ 2: !!  6 ܒ@ h `g h (  3@  4* @*`@*`6 ځload: %d.%02d not a controlling terminal no foreground process group empty foreground process group cmd: %s %d [%s] iowaitrunning%ld.%02ldu %ld.%02lds %d%% %ldk 㿈 >% d!>E #@* *  * $2 @@ ; d | 2 x>EcP6 ր`2`>Ecp6 ր  >Ecy6 ֐@x 2 < L-0 >E#l >E#>E#͐Ж cФ"? '?/!'`') #!>E@9#ؖƬ '?/!'`'#!>E@"#ƕd d* * " *  * $2 >E@L-` `   @ڐ >@ `,2  r6 ց "Z  -(  `-((  "G "B  J -2 J -`\ \)87 0`0@?J`-`?") "$ `t"`0`t t8  (`( "`0 (2`0  04  㿘H /* &`p ( (  H 0? 2 ؒՒH 0 㿘 ޒ  T ޑ.`: @ ?>8  >2 ">8"  >2 tty_detach: tty_count < 0㿘>2c? "c>Gd!`"  "`>8"! "@㿘  >% @   $@  ($@  H$@ 㿘@Ґ @А (@ΐ H >?㿘>!h @[ *`" * >0! 2 $ p p  $"    0="$ p #"$  $ %$ #$  !$ $ ͐ Ā  p $ p p >#>"`$ p !``E  p "> h`*@ €@ 㿘 . "*>0!> h*   €A@֒ 㿘 . "*>0a >#p   "d ` | @24 (`(`"0 (% x"+ (`Ȁ2a `Ā2]  ` U   >Kc!>hܘ G` | @2 (`(`2 x (  6 # (!>p "0* " (@ (֒ &  ( 4` ( 2 (@ ( ( 0  > h* @R 㿘 . "@*`>0!@`Ā   > h`*   㿘 p o!*"@ *`>0! @`  ?"` *`@! 㿘 o`* "@*`>0!@   ?"`*  `*`@ 㿘 o`* "@*`>0!@ׄ  P`}  㿘>!h . ) "* >0!  b$2 Ġ Ā  >H# $ > h*`@ `€   7$ $`,`,`㿘 . "@*`>0!@> h*`@ `€ $  p ?$ p 0 . "@*`>0!@@ `p 3     "  e  @  ,`@8`q, W "`H  " `HҒ K, H `p!"  = ; #`P!>pZ "`p00  `` 2T`ܴ`H d 8 @  .`` " dT``H  `p  ?$`pѐ`Hֲ`0 . "@*`>0!@@ `p | ` ";``( 2s`p` * `(%  d`@8 #" 8 p`p U @`(` 2`( `(@frX U > - d`@8  D`p ) 0`( # ``!Z``p `h? *€ 4`` ΀   `!>x "v`p`&`` #&` 㿘 . "@*`>0!@p$@` ``$ 0T7 0QH /* & H   H 0 : H 0 p  ``  ( `  !     "(  ( #Ҁ`!  Ջ  *  (>0㿘  `@ * "@*`>0!@@#` "`    @, `((" `    @, ` 7$` >ؓ6  `*` * >I 8@  i@"Z w@"/  _@_z  @S  f@7o  @   @D  p@`  @Y  @ V4`H>#H@`x 2 ɰ   &      ?     ?$    ?$   `H@`H  `  `x   `@R > `h +`@ `@ O 6`  !@  `G,   Z  `("1`  ,  @   @  @   }  u@  @`  @   @* `  @, `"  2  "   @ `     ,       ߖ, @$ 㿘 >m $ '?@Œ `:   >Y $   >$ ?@$ $ $ $ $ $  $ 㿘  " Ӓ >  "& ͒ >& & ?H($    ` `8 ("@82  "  " "" " H  㿘H /* &$  "  @ "  " 4 Δ&@ "&@ @&  & 4 & & H 0$@ H(@ C @ 2 `` `  :`7 `a  0 , 8`( "8` ` `  `   H H(@!"$       4 "@ "  "  "  " `4" " H putc: required clalloc 㿘H /* &@` 2` ` 2&` >M!$  " `H 08?&` &`` *` `` "@!  :*"   * @ +  :*"   * *+ @`  &@``@&` `&` H 0 ` `8("@@**.(@` `8@ + "@:  +` "  (@ ( ((@    * @ * (@ @ (@ (@  &(@ b_to_q: required clalloc 㿘`S H /* &@ ;` 2& >N x$  /& (&@'  " " 4@  }" &@ &@@& & `4H 0 >> >    " "" 8("8a">   "@ "    8 ("8!"@ ?H(&  2  "   "  ` `8 ("@82" " H  xH /* &  H 0 0H@ 7 `@2' ' ' ' ' ' '@&`& `& ` & `& `& `& &@&`&`&` &`&`&`H 0 0H 0 "?$0PTCLPTRTCN46㿘`h ' >2" 4: >2 >2 4 *>2" & & &  @o &`а `t &`t 㿐 0'> bp@J 㿘 p Ѐ >!p `*`@  V +  ` , .㿘`>!p `*`R@!@    2"" * "`"S@    @(82(8??2 @("`J@("`J@"` @("`J@("`J@"` @ (82 `(822 @@`?22(8 2 :  (2J@("`J@"`?(2J@("J` "2 @?*@(82`J@"`J@("`J@"J`( "2  @` ("J@("`J@"`J@("`J@*("J`:"?2  2 2 ` ` `(8 (8* 2 ` ` `(8 (8* 2 ` ` `(8 0(8* 2 ` ` ` (8 (8* 2 ` ` ` (8 (8* 2 ` ` `(8 0(8* 2 ` @(8(82 J`  `*㿘 @ "@""@ 0  "@",?  "@   @v 0w?# @q&>!p `*`R @   2c  $ @$?  $?# @ $ *>!p "@ "骒`@  " 雒`@  "  @ 鈒`@ 0  @{`@ _ &? 㿘(     `@Po?@Q  @T$0 㿘``(  `   `@PQ@Qx? @T0 㿘``(  `   `@P3@Q? @S0 㿘`( `     a@  q@  `    `( ?#`(@Q?㿘 (      @Q? 㿘>,>c`"`!>$>""" "$"$"@CB$""`>G` "```:` "`` 4* ``2`>G >S ">S!4  >W\>/ #c(>5 d" q#`>S  qz >$" "2 : R" 4  4*R  ->$"* "2  : R  R 2  4R2  42 4" 4 *R  㿘`-  ' >$""" *" 2 *@: *0P؀4`  4 *㿘>$"```:` "` ` 4* ``2`㿘>$"`>``:` ( "`` 4* (``2`>!X>S2   p:㿘>$"`>``:` $ "`` 4* $``2`>!X !>S@=!4p mbinit㿘H /* '>`,@'  @* @   >SH 00A!Ёmb_map full 㿈> (`?> !\@u, 6>H /* *>L   ''H 0 >#@'#`''А"@@'耢 ;"  >S)b`@>-#P @  ,@v &':  @6>H>->H 8`P@&"P ( " >H`8` "`㿘 >) "#>O>  *`4 խ , Յ ( @f>cP.`@   6 H /* '>H 8.`@` 2`H 0 &&  & 6 㿘 >) "#>O>  *`4 p - H ) @)>cP.`@  S 6 H /* '>H 8.`@` 2`H 0 &&  &  6 㿘H /* '>$" >)`"#``:` , "`` 4* ,``2`H 0>H`8` "`㿘>cP.`@   6 H /* '>H 8.`@` 2`H 0 &&  & 6 .㿘>cP.`@  Δ 6 H /* '>H 8.`@` 2`H 0 &&  &  6 >㿘>cP.`@   6 H /* '>H 8.`@` 2`H 0 &&  & 6 Ւ "  @ڒ l㿘H /* '>HS  8*`@ `?2`H 0   &>H /* ' >O @"@> !2` ?* *   >- P"@ ` "P #` H 0 >S #P*` ̐ 㿘 I>H 8%>->#PH /* 'V *`@`?2`H 0   "&V H /* ' >O @"@> !2` ?* *    P"@ ` $P $` H 0 V *  㿘>V P*`  ۔ "V  2H /* '>HV  8*`@` 2`H 0 """2  2  "" " " # @2"  ?6 "`c  d"  ?@& & m_copym㿐 @`>V ``  2 `>V 2  `@ $@ `􀦠y'沨">#P>H 8 2V m>V ` *` Y "V  4 H /* 'V *`@` 2`H 0 $$  $ 4  I$ $  $  # @4  $  "$ $   "8$    $  >O @"@> !2`  *  $  $  $ $ $ 4    &  >2a>2a  "am_copym2 (null mbuf)m_copym2 (len != M_COPYALL)㿐 @`>V ``  2 `>V 2 #@ $@ `􀦠'沬">#P>H 8)>- 2V >VА#0 *`  "V  4 H /* 'V *`@` 2`H 0 $$  $ 4 Ӑ m$ $  $  # @4  $  "$ $   "@8$   :`d(9 H /* '#P   @#P$ >O @" > !2`  * ` ?%`  %#PH 0  "  $ ($ $ $  4        &m  >2a>2a  "am_copydata㿘``>W'">W 2 "@ &@ `#>W 2 b" ̐& 㿘 2`  2&  ` @  @*` &Щ  ` @ :& 2  P `&`$ 8 " "@" " `5"  1"    "    "  , 2 " : " "2 2" 㿘` `d``  `d@` `d` &@C v>T`P*`  9  "T``6 H /* '>HT` 8*`@` 2`H 0 &&  & 6 k  J& ` " `& `& `# @6  & ` ?4`   ?&>W!\*` 8   `ے  $& ` &@" $` `$`b``>W` &U>%`T  "`T㿘`de` h`(@h@` h`   {&@>T`P*`    "T``6 H /* '>HT` 8*`@` 2`H 0 &&  & 6 ͐  sH /* '!>-#P   Z#P& >O @" > !2`  * >H`8` ?"`  $#PH 0  "  & (& $ &  6   :& ` "` `& `& `c  6 ` ?4`` 8  `  & ` &@" $` `$```2` ` &Ԑ>%`T  "`T㿘  @  $@   M"@>TP*`  ߔ " T6 H /* '>HT 8*`@` 2`H 0 &&  &  6 M "z & "& $  Md d&  d&*$_ 3 d>WT P*`   "T  6 H /* '>HT  8*`@` 2`H 0 &&  & 6  ͐ l"  ?@&   "   6  &  &  $& $ >O @"@> !2`  *  $ $&  8& $ &$㿐' >cT0   6H /* '>H`8` 2`H 0 &&& 6  2&  & d`& >H 8+>- ' >cT   6H /* ' 4H 0 &&&6 . ΐ l& $8 (@ H /* 'cP   cP&>O @" > !2`  *  ?$ %cPH 0 " &(&$&  6 (8&   2 & >G# 8&  & f%&@`n㿘     d  l@  " @ $ 2 unix㿘>#p9 "A +  2V; + 6 ) ) @ 4`  2` 4 ` $ `@   $ $  @  `@d2 0`>#H@2 &@2&@  4 &@ 㿘H o*@a    @ H p@㿘H /* !      @ "  H 00 `  4 > X@>> X> \@&4 H 0 㿘      @ j  @ & \@ɐ% soclose: NOFDREF㿘H /* !    " @ D @\  2 @ : @R    9  ' 2 @ 2!   "   !!"   " !>V >@aX "! p 2   2V         @ `"  " >\K 6 yH 0㿘     @ soaccept: !NOFDREF㿘H /* !   >\" ?( 6     @ H 0 㿘  ( -H /* !     2 8@0   8    @ H 0㿘H o*@a    @ H p@㿘H /* !    9   %     @ H 0㿐'H'L'P`   >`#pL L P :  U@ ``` '` 2`  '`4  "`4 `| *`+>H@U`\'>H H 0`|H 0`|H 0`|H 0`| 5`|>H 8H /* !`Ѡ `$ ր2```  2`` 9`2`` 9H 0`|Hð '```h`d`\" " 4 `$    2``  (``@  (H 0b`|<`=  D +@ )L%2 ``l`! #`| ? 5`| ?5`|`|@`\H 0 ;PQ`|H 0P%L 5>-  `P`P * >Pq  6H /* '` 6`H 0 &&& 6   d&&&>PI  6H /* '` 6`H 0 &&&6   l4'VS'QH /* 'P    P&>O @" > !2`  * ` ?&` &PH 0 " &(&$&  6 (P >/#($@ @8  &h8( %8 %P  L6  d" ?@&LL& %P ` K"``` ` 2` P􀠠` 5`H /* ! ``   P H@H 0􀠠 ` ?5`'P PLS`| ? 5`| ?5`|P`|P  " receive 1receive 1areceive 3㿐'H'`'X 'H 2'X ?* $   `@   @   U` 2 !Ґ2& $"  X    `@  X   @ 8  6 X H /* ! L 2l`  8@ :g`  H@ @"a`  <8]`   Y` W  2  $ 8 " $>_ߐ!  2G` 6 $   2<`  X "6 L  "0 L 2T   2   " 9 " X ! # X ? 6 X ?6 Xq X@ 8H 0" X` t T  >_!'H  Ɩ H _ 8 "  @& 8& @  H $"@& @H & LG$H /* '>HT  8*`@ `?2`H 0   "&H /* ' >O @"@> !2` ?* *   >- P"@  "P # H 0 >& LT cP* @ L T    >H 8>#P   N 'f 8 "@ @& 8?& @    $"@& @` `" '   2'@'& LC$H /* 'T *`@`?2`H 0   "&H /* ' >O @"@> !2` ?* *   >- P"@ ` "P $` H 0 & LT *  L  ' T   "$ T ' !2"2  >H 8T   􀠠  􀠠* 2  ( >_b! 4 ?6 `"@@8 "@82H 0 \H /* !  "& "@@j  2" 8t  "  @& 8& @   $"@& @&& LF&H /* 'T *`@`?2`H 0   "&H /* ' >O @"@> !2` ?* *   >- P"@ ` "P '` H 0 >& LT cP* @~< L 2$  4  &  $ "@$  8"& 8 4 2 @"  & 4  @B6 @@ <@0" 0   , @z 8 " L X ? 6 X ?6 XX XH 0u 2 @     " $   "T   `  2@ 82 "& L` "     `@ 2XX   X ? 6 X ?6 X XH 0 XX" X  X ? 6 X ?6 X XH 0㿘`  ``@`      @ p 8   @ 4 @ܐ0 4 H /* '@  ? 4 ?4  ' ' ' ' ' ' ' ' '@ $H 0`  ` `@@Ё㿘'P?#@  "¢ * @  @P *"3"8 21 *"-@( *$ *    *v * 4r *J"  2{  6 "u  (q   X6 *U6 "d  (` `$  " ` `0@ &>` 8 \@t 6`D 7@8.& l <@8(& H"7  81 >aX@ >a\@א # !  `06 ~6 Z`   ` @P 7㿘?#  " * ` @  J&` 4 "FV @"AV "!X@!`"@@ƒ>@a\`"` *& 㿘 ( , 0P  P 2 㿘   ;  6 @ɒ @ @) 8   ܐ "0ِ "@ 8   @ \㿘  " `86 @ \@ 8   㿘  " h06 @ \@ 8   㿘T T @ T @* @J   y  0@ 6  ?6  6   6  &  "6 " (& ( &  &  ` <@ː@'     @  @:z  `@ 8   L " 6 "` 2 "`  0 2 "`  "  `" ``2 "2  "2    㿘 `2 @B \㿘  8 @96    㿘 !  @6  >R "7`㿘   4 @! >`$ "       4 㿘`` ? 6` ?6`  " ( , 0 㿘 \@# " 7 8@  H 2 l & H l 2 l(& l l ` 8& l @  7㿘` > x(@퍑, @(&  .`@8   & &  㿘@ΐ& & 㿘`  2 "@ 0 @A㿘`, "  2   &`&  $@& "& " "  ?2 2@ 㿘`0  `"R`  @2     &`&  "$@& ""` "  ?2` 2`@ݐsbappendaddr㿘 @ >f#  "   `    "" 4 4Y @ l( >cpw   4`H /* '>H`8`, 2`,H 0 $@$``$`4`   2@- `$` @{ "$$@` @ & &   " $@&  2  " &    2 $  sbappendcontrol㿘2>g!(   `@ `"  @   "" 4 @ $##  @ & &  "$@& 2  " &    2 #  semi-panic: sbcompress 㿘 @X `` ` 1@ 2R  R V`@#$   ` @ @VV`@`ɒ  `  & ` @ &U"& &` @ & & ` `$@&  ?6&`2`  >g68"hsbflushsbflush 2㿘 " >h @  2 >h  >h (sbdrop㿘  2 `e >H 8>#P2  `>h S`" " &&   &@  $"@& H /* 'S *`@`?2`H 0   "&S H /* ' >O @"@> !2` ?* *   >- P"@  "P $ H 0 S * w ` _  `[ >H 8>#P"  &&    $"@& H /* 'S *`@`?2`H 0   "&S H /* ' >O @"@> !2` ?* *   >- P"@ ` "P &` H 0 S * wW "&  `" " & &  #  # # "&㿘  X>H 8 >#P&  "@ &?&    $"@& H /* 'S *`@`?2`H 0   "&S H /* ' >O @"@> !2` ?* *   >- P"@ ` "P $` H 0 S * v 2㿈 _  2` 2` > "`@``찒 *`_" 0" (&㿐 @@ ``@Ö   (㿐 @@ؔ `& (accept㿈`  `)  @@ H /* ! (    H 0  !T  2' $H 0t # 54 $  $ %>   "!h .T   $ "  $  4 $H 00K^찒  H 00=&  _   >i"H 00+  2  2> "r"(m`  8'` ` +H 0㿐 @@ R (  !!2`J %`@  C\ 27   !!5 $H /* !    $  3> "!`hi      $  "  $4 $H 0  4 ?" x@```찒 O@``谒 E^@ <ܔ  '3 3 > # ^.# ( $22 ""(' `   찒   ^Y* "@^S* "@ p`'`'ܐ' '''`'`'@` @58`  (#$ (`*` st 䀢*  ''@`@ t h @԰Ɩ '   '' ''?' ` '   ` @ϖ  "0' "O'  @ @   @2;` 2̀  `?"   ?"    "  "   '̀` ` ` "`̀ 2 K 7 "@?#"` "`  @`В ܔ , rԔ  (A 耢 ?  #    `$'   gޚ t& Ѐ Xp`   "`0'`'ؐ' '`'`''` '@`@@8`  3#/ (`*` rQ ` * ''x* @ؔ @  '`l sÒ h''̢ @԰ؖ '   ''''?' ` '     @`  ܔ , qݔ 'Ԁ@  (И̖   Ȁ@ ?  #` `   Ț g#sW  mȒ"@' "0 'Ѐ2 'Ȁ 8' @" `2@  HȀ&Ȓɔ   @9а  3̀ @?#@2&& "  &?" ` " '̀`2` 'Ȁ *'Ȑ & &Ѐ "̀ 㿐 @@  `W (㿐  @@"` l `    2`  7 N` "`睐0 $ `` (㿈 '@@Ҕ 7`  `.  "`0+'`` (E찒 `   8' `  `  쀢 T㿐 @@ .`  &`(     7    @ ` 8'`` `Ӕ f㿐 @@] 3 ( $2`+ 9  $ Ғ   7    @ ` 8'`  +㿘l 2 p l  H 2$  7 u Đ0$@ *  @*`2P   &" uipc 1uipc 2uipc 3uipc 4piusrreq㿘  >` #pb -`     L - ``2F `@.`>n" ,HXppX|̀ ' 8@5#@l @    @ @7 "   2  & >`  @s V  2>n>nʐ"( 倧   @`h"@  &`h @ $  8``" @ " ` 8 \$ π "0 @ ŀ V < t>n  8@   2  9 ``> `8v `    7 @ې   "   >n\"8 `8ϔ 2  `8 `@  h"@ " & h `@"`  `8  `"@ " & ` `8`8H"`  L ,"@@ْ 5F  `&@V  ? "?`8@&@?&  2 $>'`$  "` $&( ((&,& &$&&  *&  "&  &   "&   "&  &     >n"H 儐unp_attach㿐 ` "V <  ,V "> "> >p >  >   " , n  " 7@ܒ ,$& @;&$ $ *`" *  * $ (㿘  " " D@  &  "  @ @6 6  2 " ! >0  oߒ @oے  ` H't'x'T`'P'|  2M ` `l`J k C * @P 2=` d@4td@0@T@* 0@S ' :` ad7 @2`td@1 2 ` $ D^& &  @5 P` D''ؐ '`''``  `J?  (0>* @ 9 @ 3 & @1 * D`"& =T@V@@! )`  `  2` =   沔  &`@ @Ӑunp_connect2㿘V@V@  )`" V  >q"x"  " sq  punp_disconnect㿘 (& R``  2 $ >q 2 w!@"  $ & ` ?2`$ 㿘R    '㿘4 $   $ w n unp_externalize㿐 >#p` @2`W6  65 ( @|'$ + ('+>0 V ">q"`Ԕ      *` `?%`#` 㿐   `?#@2W  @ P 2 @  #@' `* @`2` ; "8 ` `2 @&@  @'>0| `  * `p'@  $`"  "` ,’ %` 嘒 㿘> a  "a>'"x>  "" ?#  4  2 ?##> %>'"x 3> , "+ @b @4 ? $b @2 "@4 T 2 (" `2 ` "L>s@W`t 2 b 2>' &>8  l * >'bx ` @2    2  $@`  $  2 @R` 2 ?`( "??` @W@ ?`mi &> "!㿘 >s@`㿐 2?# *R 2# (`2` 2@ ?2 `  `@  2R    >    2 㿘 >0" "Vߒ bremfree: lost tail㿘  2 >)#    >) *>)#2 >s} ` "`"  "@㿘>)#   ""*"  !>>7 D~>2>`H"` D@)@ϒH1>!P#!#>2a" |@w?$ D$ h$ l$ >B , $ H$ x> , > ,@$ 8 8$ 0`>)#>)# $  "` ""$ a $a" $a$ > D¦|㿘 @  0"2' 0 & 0  h? 6& h@3>#p `, "`,'@㿘 \@Θ `0"`?`0 &`0 `h? 4&`h@3j>#p `, "`,` 1"@ '. @ 0"?0  "0 h? 4"h@3< >#p `, "`,@ː Ӷ@5㿐'P'T\PT #\#`㿘 0 ? \ "?  " ? < @?@:6  0! 0 @$ 0H /* %  \@t  \>#p `0 "`0 \`4 "`4H 0 0@@ $ 0@2` @ݐ@j㿘 0 2 F 0 & 0H /*% \@?H 0>#p `0 "`0 F>"Ԁ> *"@ *`@` @0  0 ?& 0 0b" 0@/㿘 0`" 0@2㿘 0>`#p 0 & 0H /*% \@H 0```0 "`0㿘H /* % 0   0 7& 0 0"@ 0 & 0 0@" 8 0*@& 0 0 @N? 8 $ x 0@, x >W!p`@ 0 \ ?& 0`" 8@@r 8 >)>)#ؔ# &  "` ""&  0@>) # 0 ">)>)#Д#& & " "? 0# @& 0H 0>c c "c 0 @ 0 * " 02>7 >2`( "  P 2  \ 2 0 2 P getblk㿘>24>7b `* @@ G P2? \2;H /* % 0   0  " 0>u(H p@ ذ 0E 0@ 0`0& 02H 0 H 0 2 P $@ܒ "@@ &@" $@& & P& TH /* % @pH 0@3㿘 @   0 & 0>2aa &a" "a& @allocbuf: buffer larger than MAXBSIZE requestedallocbuf: negative bufsize㿘> ,@,@֒@( 8>vO!"q& <:: 8'>2ᔐ @o   0 $ 0ᔀ $" $$  8 8$ @ 8  H  H"@tђ@  8& 8 8" < $ 8$ < 8 >v!X 8 ΐ  8(4& )#؀   H 0 & <a 0 $ 0H 0 H H 8@t" 8"@" 8& 8 0" <@ " 0& <getnewbuf㿘H /* %>)#     > "##>v`H 0b  0@ 0*@& 0 0 & 0H 00 0 & 0 0 " \H 0 0`" 0 @H 0 x >W!p` @ & 0?& D& P& T& X& 4& @& <& d& `& t h& poO& h l?"oH& l`"  "` "@biowait㿘H /* % 0"  1>w "c  0"H 0 0$ 0  ;$ 00  0(  4 " biodone already㿘 0">w" 0 x"& 0`>W!l`@ 0@@} 0 @  0 X " 0€4 0 20 0 * " 0>)  㿘> 2   >-cx`  "`*@&>L >Ba (* @  2  @2L 2 @ !   2  2 >-cx`  u"`@2 >-cx` E"` 2   @`<&>-cx` "` `Y  "`   "@$ >8a`$ `" J"` @>-cx`  "` cx "cx `"  "`   "@$ >8a`$ `" "` ?(&@ `"  "` >8"!  "@` "` "$ >8aؔa؀ $ aؐ "`  ">8"!ؐ!$  cache_enter: name too long㿘 $>>x" [#>2aH>at  >8 @ eؔ @4 @aH $aH!؀ F! ` "` "  "@ ` ` 2"  "@$ `$ ` $ $  $  !, *:$ >8a`$ `" "`>L >B!@ @(*`  $ " " $ 㿘>8"!ؐ!" !>L>!t>B xd$ (>-d d" >B>L((@ *>-"  2  :>-d d" >8؀`3!`"+`""`%`"```  "` ` ` !@2 `@ "`!؀"`!؄` `"#!"` 2`cluster_read: size = 0cluster_read: DONE bp㿀  >y2"@#\"`0 5 \@ @   `0>cp&`0``,  "`, 2 > " & \ ` `& \& `` :@n? 8``@`` @+ `?$ `@4  \ \ : @*& \   `*` 8 & \ & \ \ 4'T@[`` :? @&`T8f`@a`m \` @+ S`?N$ `@4  \ \ : @*& \   `*` 8 & \ & \ \ 4' #\#`@e#d G  0$ 0$ T   >#p `, "`,` `0">y5"X@,ܐ   0"  0?c $ 0c @,ǐ "  ` <@ P@& ``cluster_rbuild: size %ld != filesize %ldcluster_rbuild: too much memory㿐` \ L d>z#8<  @Y; 8@ x   0& T& 00l#\@g 0"`.  +c &&& &< @  L&;& L'@ q 0   `8`@`H@>z#h 0@ " 0  @p$&`T `0@&`0 *`"`&  2   + 0& L & 0d& X@ے㿘`  E  0"\& T\@Ò>{"& X 0& T @& 0cluster_callback: too little memory㿘 0(  4 L H& L @ H@o”$ < 8`$ 8 0$ 4($ 0 8"& 8  ??$  8"& <6 H>{"$ @ @"@$ @o& <& XdW + 0 %0 0 * " 0|㿐 P  \$`L$`P$`X$`T`X "``L 2 ` <`T T;`  "~`P` L@Ҏ@?`XI'  : <`L ; `P$ @& &@2$   @z *@*   c +  <`P@y R cޒ +>$`L <  < @; @"  T@)v  T? j$`X T$`T$`P$`L $`X $`P]$`L$`P    @5$`X $`P$`L T$`Tcluster_wbuild: size %ld != filesize %ldClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocks㿘  L >|"͒    ?` 0 ט  И 0 2<?Ԑ8@?ݐː/   +a <$8 $$ $L$$L>{"0$XH`@$0ry l`g`  `0 2 ΐU   $ 8T`T: @"?>|P"`P>|`Tݐ#>|t# `0!`x @$`0`0 $`0 >W!h`"@`H@n<8$<@$8`8"$`8H /*%`\@u`\`4 "`4H 0@-  "    +0$L $0b$XB?"+㿘 +L P "* `&  & P`,   ?`<  , "  & vop_generic_revokevop_generic_revokeall㿘  >#p>}#h (4!  "&>}x 0,!(#& D"D D ` 2D@ @@2 D "D@   2D(2 D >&@  㿘8 㿘  $b    㿘  h   X  㿘  h  W -operation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operation㿘`2'  !>6# `2* #@ҍ*`" `2> X@" >~!h>~>~D!  * $@ 2vfs_opv_init: operation vector without default routine.㿘> X*` 2>6>~"x#   @ `X* "@ `㿘>"@  >   >"@     > 2>6>H "#c  "c㿘@Ԣ >8@ߐ >b>""b@ "" @C`@ (㿘 2 W`  7`L W` G  "@B @ B&; `` 2`?? ( DB? (_X < < $ $ ` 4 $ \$ $4   0@@+@y`͒ (0`ʒ ( lf_setlock: lost lock㿐V  $   ('>0@ "n'  @` ( # $T$ $". @)  `h "%`l2!>#0>#(  @ @"` @2`h` (Ұ "`l >?*  @2 &  6 @ 6 & @>0w    $ 2 $   >ܐ!`G ( > L @+  `*`dP`z"v& V   R` @9   (`2d V R@2` (Y  @  @ " & `B :@ڒ@V   R` 2 $@ ` $$@& $`  "  '&  "@_͒ ( ' & "   B@: `"&  B: @ 㿐  2'0KG >"А @ ?@? 9* @Dh "@_ (0) @   @Ր @_ "`  "@ _l (ː B? : ' `B : 㿘@) #  6`6` >@ ?2   ?2   >` @ b `B >` @?  0&`&`6` 㿐 '  @ "  V  R` 2` lf_findoverlap: default㿘 ' `` `@; "  `@3    ? 4 @ " 42  2     4   8  & '  2  2    2   "   4"  2 "  4  2v  (r  ?2   ?2 h  4   @2 "Y  @  ? @ 4  2M   8 G  4  2  @(  4  27  @(3  ?2  ?2 )  4> 2 > @ 4    > ?>  >Ð & `  $2$" $$2$ $㿘 `@2   ` @2 ``B > '&` `@ ( `@  (` B?> &` \] J (``B < $ $` B?> $ &` & 㿘 $  & $ $" $v8" namei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsp,$ $0 ">`2$>8!Ȁ?">2! $>,"`$ [ $ $ $Ӗ  @` P   "  "]k $@"$ ? L /2? :L "@" $, $ ` $ >  $$ J /2 ` ]< 0w >@$$@$ @@`@d]# g $d "   2  @"  `$  $ [n '''А 'Ԙ  ?'''' @"а   (+\ &%@ # ?( 4\ؒ $*@@x$J /@Ր @>\ @@e$leaf should be empty㿐$`$` `   ` ``@$` *$`$@k`J /2"$` J /"`""@$$`@ ~ J 2$`  2$s $`  1$``$` J`/" ``@$`J  `"`$`W ?$" $J / J /"" "$$` `*@$`J 2`` `*@$``  $`  * $`` 2``J` .2 `J@ .2`` *@$``@"%$ >  $2$$@z` "$`!'@`@k`@Ĕ $$@ "9`   >o"(? ? < '@u`@C`@$?` ` ` <  $@&  `*@$`` ""@$` "@$$` J 2`  $`  @E 2@ ` €@[ 2m`@!$@ 2 @D "@`!ߐ@ 2@` @@  @$"$`@ V$`@ `@ ? ` @2 @$`@O$` @? `+  < &"   < "``@$@ 2`@'`   @  `   @@ @ @@$relookup: null namerelookup: lookup on dot-dotrelookup: symlink found.㿘 ``@+ &@ "J 2>f!@">_!(@ "@@ ?>R"(Q O   < J@I @(E  @ 2  @">6!H?  %   <  `"  < 0@`@`2@   @     @@ @ @z@&@㿘>N"#>"!> " X>7""ؐ"" >"##" >O" >2aX"aX@ " vfs_busy: unexpected lock failure㿘 <@@` @& <q   @ P9   >#Ё㿘   P+vfslock㿘>">` #p`@ʮ ``$```4!H Xj @ƒ!H  > O   $ $  @`$  $ <$ ` `$`4 D`> <+@  @8$ < /,   YZ &  %s_mountroot failed: %d 㿘>! "> " " !> "  $ !  $ 2  >2XX"  d 2 h 2 d 㿐 >! >"& h * & d3!!''>2!X!X@  ΐ ! '`4!& dJ  * *`8J "??: : H?" <" @" 8" 4" 0" ," (" $" D" " " " " 2 2 " Xvnodefree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O's㿘>!  #! >!t> #,>*cp#! >#`#>7"؀`"! "  Wb @ɾ > c, Q"c, 2T >s &T  "  > (@ђ>r 8` "` "  "@*@$ @ $ H@  | > P@>T `H /* % 4 >F xH 0 $$ $ \$ `$ L$ T$ P$ X$ D$ @$ x$ @ & 4 $ |   ` $" ( ( ( ( $ ` " `" $` $ ("``" (㿘@  㿘@ 㿐? &@>)D &@ $ @@  '@&@ 㿘 @>? cpa @ >` ?* >/c@  ' @ D @2 D @ @@2  DV  @D 逦 0  2 D    x   @   Vq $ D"  D" D"` D"  D " $($h@"  @ @ &  x& xO$ @vget㿘a b& >n < @"! V  2     `2   >7 ""܀`"  "` >"#  "@*@& ` 6 @@z@ " ?6 *  2@  vref used where vget required㿘V   >"Ȑ`6 Use count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cnt㿘> #p>#p ?6 * : `@ݒ 0A>V  >#@->ΐ#`">Ȑ# "  >#0@>#P `&>7"># @ 2&  &  "`  ""& & " "@Z vrele: null vpvrele: bad ref countvrele: ref cnt㿘> #p>! ?6 * : `I>V  >!@̒>m!(`">g# "  >#0@>\#P `&>7"># @ 2&  &  "`  ""& & " "@`@z @ R 2  "   >    " >7"     " holdrele: holdcnt㿘  ?>#0& @V   `"  "` >7""  "@& >c`& `" "`㿘>#p   : / $ 2)" T T  "" @ 2T   " @? @ @,>)c |"  2 `  vclean: deadlockvclean: cannot reclaimvclean: not cleanvclean: lock not drained㿘V    6 !"!>p!&@`@Z` ? @  ` ?@N@ @Q@*  >F!; ?6 *  4  $>6!0 "  >#0@>+#P `&>7"># @ 2&  &  "`  ""& & " "g h ">)  @2 h>!H@X hUf & h>)#& x&  ?# @& =&m㿘V   @ 㿘>#p@vgonemissing bdevmissing aliasvgonel: not clean㿘! "& >kܖ 07     @? P  D`"M& @@2 `"  "``" D2D2> (*  D@ ` D 2 D@ @@2D D 2D>g (2 7" 7& DTɒ & D & @@+V  '  $>>I 8cc  " "`  ">cc & c "`  ">"##& >/@: ?( D 2 D@@2D" 2D㿘(2 D"T ) @ ` D @  @ @@2  R  2DVBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: type %s, usecount %d, writecount %d, holdcount %ld,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT|VBWAIT|VALIASED flags (%s) X "`@> `@>V`cV`* @`> (/@ >@ī``@ >@Ĥ`h@ >@ĝ`p@!>@Ė`@">@ď`@$>@Ĉ`@(>@ā`O > `| >> 0 @㿐`0>"`"A\```$`2``6\@ #\`,.    `& -  >g > "`  ```$`2``     h7 ( -kinfo: vp changed 㿐 > #, ` *` * L&@$@&@H >2!X!X@ >  >J . &'` >#̀ >+#h``$ʔ  2`Ô 'Ȑ$@&@  D " " `" `D 2 `D`@ @2`D2 `D`2`D 㿘\  <"y `4 P*$`0 4`4 < "k$ <.  €@G.  1d  Q'@ÃX`\T Q `\@$d_,`d" \`A > d@$ g, . @ >$"`. @2`` 2`$``2@. @  7  @`4   P$`0 4`4 Rd 1㿘  RY 1 㿘 %> " ` (RH & `` 㿘@" < <& <! L " <!& < 㿘 2!X  ->+>p @ "a~  p >~">~"Hݦ syncing disks... %d giving up done 㿘H o@>~g">G#䀢  >7@w >7!В @ה >7!В @Д  )> > D*`" "* @  >"0  "   ">>#~2' @ݢ@ >#>#(~!㿘`  2 ->["Ѐ  >e#㿐  -\#\ِ vwakeup: neg numoutput㿘 0@*@ \& 0``4? "`4>|v!(@  "@i:`4vinvalbuf: dirty bufsvinvalbufvinvalbuf: flush failed㿘`JH /* % 4    4 h{$ 4  4 0 +H 0 @R H /* % 4   0 >|!H 0@А 0H 0H /* %   ,` ` ``P ```2`P`` 0` ` ``P ```2`P`7````P &+`0   >Ȗ 0  " 0f " ,H 00*`0"`0`0 `  0@ " 0`Ѐ` ,  0 > , >{!ؑH 0 vflushbuf: not dirtyvflushbufvflushbuf: dirty㿘H /* % 0&  0 0 >{r 0 "0H 0\`w 0 0Ք``2  4H 00  4#>  &fja 4  4H 0 0 >! 0bgetvp: not free㿘`\ >{%"&`\ @? 8? D &`D , &` ,`"` & , ,&` brelvp: NULL㿘 \2!P>{#( #!@  0`"  "`   "@& "& \0 2 & \8`"<<"`<<8"@& \ܐ reassignbuf: NULL㿘`!P>|7#0K #!@  `0`"  "`   "@&  0 2`0.`,`0 2+`8`"`<`<"`<`<`8 "@ `0`@   >#>#@q  `D  >#ԓ2  : #@ &  "` $& vfs_register called with vfc_refcount > 0 㿘  >{א!P>" " @t   $  $   >⸀4"& $"@ (`" @ 㿘>" " @P    $ $   2     $$@>"  >  4 $ 2 >"" 㿘V  ">z# "  >#0l>z #P `&>7"># @ 2&  &  "`  ""& & " "㿘!> >$!$  L >"a(!$ @ *``@ "㿘H /* %>#Ѐ@ >#>a$@>>(* @ & 8@  8"`<("  & L'>)>2`H /* %>!$$؀@>!(*@ $ؑH 0 @ 0>W`@  @@ @r@2@ 0 2  8 @ " 8>ya ` <"`< < 8">#@ ֐>W!x` @  ?% `>K# (>d` 0㿐 >)L /$  >>!2 a " @@ `#a >#Ѐ@>2 :`#!2  :   ">#Б2`@: "#!#a >.a  $ 㿘  +8`"<<"`<<8"@>#  >J    `<` ?$`<    @ " `< @$`<  㿘 R " 8`"<<"`<<8"@2̐  syncer vnode 㿘> z  h ">E>z  vfslock> 8  Scb'd D'h'D`@'@<'l V@`@4P 2J @ < `@ < @  $ < l@ S1 /  `!' &` @P`@v @ S      `! A &`  Ț @ "@-  Ζ >"` @` ``$`2``а `@ >"` `@耢 ``$```2D - !H  J @ !H  > AϘ    @` <$ $ ` 4 D`>+@  @$ <$  $ l` " < < `@$ <? <#  $ < ` ~ @ $ <`@` @ <@@"&$D  <@ $ <  <@*@$ <$ < <     D "$ $ 0Aʐ 4` $`>2X$`$ X 2`"X">2"!\@2 @T <   D   0  }"DK Cmount: lost mount㿐V  7 D ` € ">K>w"#`!> ` 2  $  2 `z$ ``2`!>  $k$ $P'Ԑ D''@''ܰ & `l@  Q "`<0`<@  ֐`@ΐ unmount: dangling vnode㿘 <@@ @@$ <bג  $ < @`>JA < @$ <  " < < 2    @   "% <      0 @`>J <@+@ @$ < <@*@c! <*@/$ < "X "` >2X@"@  " " D  "   " >v3 @`>J@ <@bJ  㿘>2!X @) >J; "`<@ 2@ ?$`< `@ @   "@`< @$`<@@@ܐ P'Ԑ @''@''܀  Y  `` ` @P'Ԑ @''@''܀ # > D   >4` P  u!''Т`!㾐 @@  " (   D`  >4` P]  K!''`!㾘@>2!X `!X` >2   >J `-&6%  D  2 >6`P  !''O! aɐ` $ &&t0& 㿐`@@  ? (`@ V @ # ` @@ `  (  `` €>  " D   @\$ P` D'''@'@3'܀ D  $ P  O 2'Ԑ D''@'@'܀  " #! $  $ 㿘R   @   ` @@  0 @Ц 410` ` ?  '\ @'`'<$* @ m'80'd4: $X 08  ;8@\ "$X1ѐ  ?X 03 t0?"g f0 0H ϒ 6`6` > @&`'&`(7  ? ? 77   0 @! @w 28V``@ T` 6``7@  ` 2`  <  `@  @    ?`@ 1  @ V``@1Y0*  "@ @ Ӕ0 &` N`m` h  't 'x'T@P'Pi'| [``( Ð` ` /* 7 ' < @ 8@   @ @ 2  '' '  d`@ 2 dt@  d@ d0`t@ *@ tdؐ`p`ϐ 't 'x'T@P'P'| 2,` d@ t`@ 0L ` K d' ` o*@ 7  @ ؒ`td@ ޖP'Ԑ @''@''ܰ 9 @    '''`''ܰ % @ @g  ` 0`@  `@  @ h԰M$ E @$ : 't 'x'T`P'Pp'| -` d@ Xt`@# `ﻐ `  :` ad7 @ I`td@ ŘF P ' ''@'1'ܰ - @@ @ x   ֞D @  Ԓ@ ۔  @ aāP 'Ԑ ''@''܀ '@ @ ޒĀ祖0B@ @Ő @ ז  @ і @ xԁ8@`@@+ @ 2T E B  (`@ = ``? " `  & 00 0-2   ` B%  ` @  `` B @ B  < `2``  `<   >P`?@2 `  $  $ 'Ԑ D''@']'ܰ 2$ ``*`` !``2`@`@F @$ $ 't D'x'T@P'P0'| `@`  L9 2'`p `'t 'x'T@P'P '| `@ڔ^`  L 2'`J `P'Ԑ D''@''ܰ `@ s:(' ''@'' " @  `'`  ''А '?'''`'`@@ а`" &'t @'x'T@P'P'| &` @`@` <  `?  '@ ֐0@@ ) ( @d`@` <  `?  뷐'@ݒ @ `?@- 't @'x'T@P'P2'| !`` @(`@` <  뀐 o7`@n0`?@+ `@@< $ (` @`@~` <  N o7`@s @ ''t @'x'T@P'P'| F` @Ő`@M < 4 `?2`??Jʒ ># ?@ ?Ð*@ ?`'`'7@'t'x'T@P'P|'| F` @r`@ < 4 `?2`??Jw ># ?@Ȗ ?Ð*@ ?꧐`'`'7@ʒ쓐0@@h I ( @"`@ < 4 `?2`??J' ># @y ?Ð*@ ?W`'`'7@z @ .B`  @'' '   D耢??'?2'd?''d @'h'D@@'@'l -P  @`@5` <  '*"@ *`@ *`''*"@ *`@ *`' @ `  @H'' 'Ɣ  B耢??'?2 ?' @@ 0 (  @W`@ߔ` <  '*"@ *`@ *`''*"@ *`@ *`' @Ȓ @|'t @'x'T@P'P$'| +` @`@`@  @   @`  g`?@V0@@+ ,` 2`(&  @`@h`@  @Ӑ 4`? @Z @㿐 @@ ` (@> `@  >W!t`@ @ ' ''@''ܠ 2`@` , '''l`h'h{'  @g64ax`|`@  `@ "`@   @`@ @ @" @"? $| @I Ā @A ` @$ @6 |x@/@`ꁐ`"|@ ِpAȒ  "A ?  't 'x'T@P'P'| /` d@ߒtdꪐ0Cꥐ B d'`` a*@ 7` @ϒ`td@ $`P 'Ԑ ''@''ܰ 1`@   " @     @  @ @@ĀM08 @@ 'y` 2`(r '@ l ` '``'Ԕ'ؔ ''''`@'ؖ   ?@'' @:  C`@ > <`ؖ???@?Ȁ  &`@  `< `C'  "(: ` ` `'"@ & "` 0't @'x'T@P'P'| #` @]  @ F  V` @(@ 鋐 @*`2P   " 8`,`d$b E $`$ $`(B@ L$`(⛐ ` 2`'7`@ ``$`@i }{)`@o`$``@9 $`ѐ $`h`f @ `?6` @] O }$`$ D$`(] U`@ bL -d` !@ @`d@ 9 @; 4 @ -d @z@) `@憐  ?@ @= `  6e㿘  < " @`>"`*`    " @̐   㿘` ?4 @蒐p`dh l`@N'ؐ '?'?\''  'ؔ@hؔ@$  "   @㿘( `@`@ >` @  `*@2  ` $   @ @< 㿘 (`@ `  2   2  2  ` " <  `@J `@Ҕ `@>`  ``&  @ B >  @x8@ "R&@&` @?`$>!*` (4@LX  ( 0& 6`6` &` &`&`>`0&`&`&` &`$&`(&`,&`@&`D԰ &`H*2 @ 2 >`88`( @?`&>#8*` TT"@@' *`$ " %&!@    T`@  a@   "J "`㿘 (V  @vn_lock㿘@ @?#! "@@  @ $ >XTʖ  @@2㿘 (V  qdefaultvop_islocked㿐>`'`' * @@vop_lookup㿈>`'''`' * @@vop_createvop_create: dvp㿀> ''@" 'ΐ 2'>iU!'> ' * @@vop_mknodvop_mknod: dvp㿀>!''@" ' 2'>i/"H'>!' * @@vop_open㿀>a4''''a4' * @@vop_close㿀>a`''''a`' * @@vop_accessvop_access: vp㿀>!''@" 'Z 2'>h#'>!' * @@vop_getattr㿀>a''''a' * @@vop_setattrvop_setattr: vp㿀>!''@" '  2'>h h'>!' * @@vop_readvop_read: vp㿀>"''@" ' 2'>h!'>"' * @@vop_writevop_write: vp㿀>"<''@" 'Ԑ 2'>h[!'>"<' * @@vop_lease㿀>bh''''bh' * @@vop_ioctlx>b''''''b' * @@؁vop_select㿀>b'''''b' * @@vop_revoke㿈>b''b' * @@vop_mmap㿀>c''''c' * @@vop_fsyncvop_fsync: vp㿀>#D''@" 'J 2'>gѐ#'>#D' * @@vop_seekx>cp''??cp' * @@؁vop_removevop_remove: dvpvop_remove: vp㿈>#''@" ' 2'>g @@ > 2>>g #' * @@vop_linkvop_link: dvp㿈>#''@" 'ؐ 2'>g_!>#' * @@vop_renamevop_rename: tdvpx> '''''@" ' 2'>g7"> ' * @@؁vop_mkdirvop_mkdir: dvp㿀> 4''@" ' 2'>g"'> 4' * @@vop_rmdirvop_rmdir: dvpvop_rmdir: vp㿈> d''@" 'b 2'>f#P@@ >U 2>>fܐ#` d' * @@vop_symlinkvop_symlink: dvp㿀> ''@" '1 2'>f ''> ' * @@vop_readdirvop_readdir: vpx> ''@" '  2'>f '''> ' * @@؁vop_readlinkvop_readlink: vp㿈> ''@" ' 2'>fh!`> ' * @@vop_abortop㿈>a''a' * @@vop_inactivevop_inactive: vp㿈>!@''@ > 2>>f0"@!@' * @@vop_reclaim㿈>al''al' * @@vop_lock㿈>a'''a' * @@vop_unlock㿈>a'''a' * @@vop_bmapvop_bmap: vp㿀>!''@" 'P 2'>eא#''>!' * @@vop_print㿐>b'b' * @@vop_pathconf㿈>bH'''bH' * @@vop_advlock㿀>bt'''''bt' * @@vop_blkatoffvop_blkatoff: vp㿀>"''@" ? 2?>ev! '>"' * @@vop_vallocvop_valloc: pvp㿀>"''@" 'ʐ 2'>eQ!'>"' * @@vop_ballocvop_balloc: vpx>"''@" ? 2?>e)"X'>"'\'' *` @؁vop_reallocblksvop_reallocblks: vp㿈>#$''@ >y 2>>e##$' * @@vop_vfreevop_vfree: pvp㿈>#P''@" 'V 2'>dݐ#>#P' * @@vop_truncatevop_truncate: vpx>#|''@" ?/ 2?>d ''>#|' * @@؁vop_updatevop_update: vp㿀>#''@" ' 2'>d '>#' * @@vop_whiteoutvop_whiteout: dvp㿈>#''@" ' 2'>dh!`>#' * @@vop_strategy㿐>'' \`* @@vop_bwrite㿐>$'' \$`* @@    dead_read: lock㿘@  " >d&"   dead_write: lock㿘@y  >d" 㿘@o   > "`* @@  㿘  \ " @V   `0("`0   㿘 @@ *@&   2 @8 >  ! * @@㿘@'  "       tag VT_NON, dead vnode 㿘>e x  dead_badop called㿘>c 㿘!   "&Oʒ !"fdesc㿐 <@@ 1 - @ 2*  6N  "@`"#&!D <@ M& <  Y~" Z@"@  @ Z>!    㿘!D6`T  ` l 2 ๐f!D7 &!D 㿘!D>#p`n&@ 㿘  @  @   *` "`@ *`  6@#@"&`&` &` &`&``&` D@&`  d`  6@ `L Z ` Z`<  @`  㿘>" 6>>">Q"p  @ "> `(>*"b >M H@>2"b 㿘>#p >M#@>2b@* @@ > 2 `2   8 2@ =& 2 >a0  a0 "a0 Nɒ @ "a0 >)ۖ >  5W "`|$ $ ?$ $ $ @ $@" $@$ >00 `"0 "0O3 fdttystdinfd/0stdoutfd/1stderrfd/2..㿐     H  L .2 |% `| "˰ `2>a@  2  \ `%e" @ 2%>a@r  2 ( "        6 `%>   0$>a@H  >! >a@<  >!  >b@1  >" >  W`|" % " @ 0N 2 >b@   2 j 9<   @*`*: @Ѐ@  А ,`L @   ,`@  ` ` |" %`%㿘 | `>"*` ``(`@|    "`X>"    fdesc attr8`@. @`2R` Z "`(  >0N>0K`(J H@ D?`# @?6`}L :"  `(z` 0 &@6`6`&`&` &`&`>`&` &`$&`(&`,&`0&`4&`8&`<&`@&`D@P >`H`ѐ"pfdesc_getattr㿘 `|  `_ > h*` ||||@ `ΐ`| $ `| ``!m4 !m4  $$ D 4 `|@  < !4 $ 4 >"  <  $ D $$ D4  "< $ $ ` d$ "$ >@!P  $ $$ ($ <$ @< H$ , ($ 4$ 0  $ 8`|   2>`c $`@fdesc setattr㿘    |  `- @?) -'  `*@@`2R`  "@  >0>`(  r  ?  -` !%d㾐  |   2  `    @3  7  |  2L ,`* >c{ > ,@6u 2`( "( `   2    : *@ " ' /  | D/ A   <`>7  0`4` '`/>"|\ @,  /,`@ "`'>ba// D  Т`<`<㿘 `@ "`| `   -`@V Dt㿘 |  ->"/ 㿘 |  ->"= 㿘  |   -   >"I 㿘 |  - >"d㿘   $ @ 㿘  |`""`"@ |3k & | `%>( `   ` "  `    `    tag VT_NON, fdesc vnode 㿘>`*   㿘 d   㿘 \   fdesc: bad op㿘>^    㿐`D 2  1j $`D    $  $  " $ 2 ~$`D$  2` 2`      $    2  $K$  "    $   2   $K   2 2+>) 6 !aIT  m 2.  #   %     +>)  !aI/  H 2     fifo_read mode㿘   D`>]# 2 5 " `!4`  Ք   d `  2 ` ?4` "` ` >4``  # ` D " fifo_write mode㿘   D` >]   `!4`      ` Ĕ ` >4`h  "~@"$      D'   xȀ "  "   D '   xȀ  h    D'  y Ȁ "  "   D '  xȀ  㿘  '     ``  㿘    `D ? $    " T` ? $ T`  IF 1]  $`Dtag VT_NON 㿘>^F#@ >^A#ȁ , fifo with %ld readers and %ld writers㿘 D> ^.#"  0  0  "      -fifo_badop called㿘>\ Ё kernfs_get_rrootdev: no raw root device 㿘> $ >?">b >'>  a,  ` @$a   &, >?"!>]Ȑ!kernfs㿐 <@@ 3 ->-Xס 2+  @/  "@`"#&!D <@ & <  Yv Z@b"@  @^ Z>!x   㿘!D6`T  ` : 2 ه4!D0v @&!D 㿘!D>#p`<&@ 㿘6`>[a`h&``h>  `&``|"&`&` &`>!t> c,&`" &` D@ d `  x6@ `Lx Z `x Z`<  @` ipsecversionusermemtimerrootdevrootdevposixphysmempagesizeosrevosreleaseostypencpumsgbufmodelmachineloadavghzdomainnamehostnamecopyrightbyteorderboottime...%ld %ld %d %d %d %d %ld %u 㿐 5` [ "#    0z! /5 0u"[>  _ Y 0m3 kZ 0h@א>\aH0T@>\ݒaX0N L&oS> Lo8p /"" 8` D&>% >  ! >W!>.!2 w *@* >%`(# `( > \a`0 `>>["ap\" 0@*ؒ @"& 㿘 / _! J? "!>.!w,>W"! J? "!> !ؒw,>%"  㿐   ``%@? o ` >M . >%ו`] !>cx  ?`2 @  x `Δ@ ; 9  G ?0  R  % 2  >-Xո   -4 `# |"  " @ %` 㿘 @ 2!m`|    ܪ 㾈  ` @gM$ $ ` d  $ < "@$ $ $  *`" *  * $ ($ <$ @$ D< H $$ 0$ ,@   $!m4 4 $  "< `| `  $`4  4 >!$@:  $ 'y! > <   @ - 㾐 `@   -`|' X! >  㾘 `@  $ -``|` @ ` 8>” "`  2  ,@㾈  @  J  8D    @  7,`>!`0>#x@* G` ?"  @쀢 " `' /  v! >l/    ֢`<`<㿘   C$ @ 㿘  | - & | `%>(  44 4  `   ` "  `    `    tag VT_KERNFS, kernfs vnode 㿘>Za#@  㿘    㿘    kernfs: bad op㿘>Xߐ#㿘 >7 >>7"` null_node_find: vget failed. 㿘>#p>7 >76` * @@` %>`2@`  2 @ >  Z@`2` null_node_alloc: no alias for device㿘 >p +a  >-<ז , 0`@$ @?    +J $ D`D` " $ |$` $` " @&,Ғ  @?   D,ʒ  $ @>)#" Y z? > D :` ?* >/c@   D D ` 2 D @ @@2 DV  ސ Ծ 2 D   D" D"` D " &>X ($hՉ">7 >76` *   $@ " " $` null_node_create: aliasnull_node_create: lower has 0 usecount.㿐  'M TV` 4 >/#p>WА# &㿈<@@b -rɔ  [ T&$&(&&l&, P(& @  ԽD  *w   $@   + 0*@ "@$``|   < "$D< $<$D] Yr1 Z`@$  Yr&`@$   㿘!D 6`T  ` z 2 ǐt!D+ &!D 㿘!D >#p#`|&@ 㿘!D  @㾘@X!!D  "(6@6`&`&`&` &` &`&` D@&` d` sǔ  `LsÔ Z `s Z`<  @`  㿘!D  - -null_bypass: %s >! >X7#1>-x  ?" $ "$@ #<@" $@$@ | "@Ӓ< ``<ݨ x *` @> @ x ,` ?% `""<!2< 2 <"   <``٠ 㿘 2    d "`㿘 `|  @?  ` <  p㿘  D  㿘  |"`""`"@ |* & |ӥ tag VT_NULLFS, vp=%p, lowervp=%p nullfs lowervp㿘  |>`"Wy | >j" 㿘  \`| $ \$ \㿘  \`| $ \$ \㿘  ` @*@&  㿘 @* "  㿘  `@     < ?  ? @   <     㿀 <@@\ -p  2V B쀢 2O (    E ,>$ޖ耢 2=  (Z   "|(T  "@|`""|"@|"`##  `"  <&!D@ H& <  Yp Z`@$   Yp`@$   㿘!D6`T  ` e 2Ҳ_!D  (& !D l !D) &!D 㿘!D>#p`^&@ 㿘6@"&`&` &` &`&` &` D@&`  d`  q6@ `LqĔ Z `q Z`<  @` portal_closefd: error = %d 㿈' >VG#㿐   '%? G    L . %ѭ : `>$ -    '# @ "`|L@ J     # 'v$ $`$@`qb> $` "% 㿘`"! =VV@@"` )  2` =    沔 &`portalconportal_open: %d extra fds  't'l   `X  | tDҖ ltbPe l t`( lH /* !t  $    >t>X "+ ?: t` `$ " H 0t$ 2ZX2~|`@2X @2| 'x  '|  ' x 7  @p 'Ȑ P'̒ ؖ   '  t''؄ '܄ '''?P.'谒 hl ''p @'ht ؖplUh Wp "l2  'p`S l  " 6l 耢 "'pl`8l`@?2 `. =` >!T 6 `@ ``,@ R`     =H 0l%`X l "tt M t㿐  ` @h$ $   d "$ < "@$ $ $  *`" *  * $ ($ <$ @$ D< H $$ 0$ ,  $!4 4  $  $!4 4  | $   2  @ -  㿘     㿘  |  " 'i $   |'d  " | `%>(  44 4  `   ` "  `    `    tag VT_PORTAL, portal vnode 㿘>T! @  㿘 [   㿘 S Ͼ  portal: bad op㿘>R waitrunstepdetachattachusr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtiotabrttrapillquitinthupprocfsxprocfsprocfs_control㿘#`0 0@2`( ( @ `(6``D(@&`(`0&`T4  N`-  `D`((0)6`>0qr4>0l`((r `D 7`T&`(`0" &`T) "&`T&`T`(* >&`(TN`-`  &``( @@ ` ??&`0D`((+ N`-  5>`D! <  N`-  `((2`D &N`- 2" `D2 `(( !>N`- ! "<Ė "N`-0 Q" N`-  ?+ 㿀 6 - '@䰒 ,> -# @ `+>#P@ N`- 2``D2 ``((`>2  `35 㾐@ 8! $ @ `  &``(  @q  @ 6B 2` 2 `N`-  @`  ?&`> (2   h>[!`/>$ `?` > >-#L`h*""@8 @    @ޖ `?  h @, e'`  #\#`#d@谒 @u  `0 @˶ " "  @   >'h@ޚ  @<h @@  ؒؔ5h@V@  h @͔@ ` 2y` 㿘  @ `  &``( @R`&` 㿘`  @2`(!" `0+  `0  >["Ѐ?  H    @'@:  -HΒ 8 P $ @ `  &``(  @E  @ 5 2` 2 `N`-  @`  ?&`> (2    %d %d %d %d %d,%d %sctty,%ssldrnoflags %ld,%ld -1,-1 %ld,%ld %ld,%ld %snochan %d,%d 㾈  -`D `0 0`   @ `0`Ӓll . @>cДQ-`(`  ` `n `o>c>c? Q> ` #>Qc>#`  2 J>Q`>#J ,>P``(  ```>P`>P` , >Pے`(`h>` @`l> HP͐!>` P@ `PÒ`PT` @ %>X P`T` @ >P`` & " @   4> 88  procfs_allocvp㿘>#p>!8> 2 2  r >&@s 2>a@  a@ "a@ ; > "a@ >   N>@  ! $ |"" ""*  -"> ȓ. $8888@H@@!m2 $ @ $!$2 $ @!m2 $ @! !$2 $ @>N}#h">!8 " "@" >@@ `"@ "@;7 㿘 |`""`>"!<"@ |"Ē & | 㿘  |    & >7!Ѐ20K  2  >["Ѐ $   2 = ?`8>"*` \$@А &   { F   -㿘  ""   (2   > .@@ΐ J? 2&?.@& 㿘 @-    procfs: invalid directory entry sizeprocfs㿐 <@@2 -@& <&!Dȅ  ZhZ Z@˒"@  @ǒ Z> jU  㿘@  >#    ˤ  㿘 z  h@6@>[! h&` h&`&` ؐ" &`&`>!l>` &`" &` D@  d` j  `Lj Z `j  Z`<  @` notepgnotestatusctlfpregsregsmemfile...㿘  |   $>7!Ѐ`2 "  2   (2     "   ($   |` >( `"`     ``  㿘  |  ">7$} !Ѐ   㿘K `%>̇(00DDD0 `   ` "  `    `    tag VT_PROCFS, type %d, pid %d, mode %x, flags %lx 㿘  |   > MҐ!P 㿘  y  㿘  q   %ldprocfs_getattr㿀  |    ">7$!Ѐ` S  @$4 $ $ @>[!  $ < @< H$ 4*`" *  * $ 8$ 0 4$ ($ ,$ $ ` ' ># *` LLLllll`(!? " @4  4 ` $ ` $  ` M*`># 8t|ܐ 4 $ $  4 $ $ >cp>0Mab: < H+<  4 ` $ ` $  "< H<  -` ؔ >( *  :  P<  !< < H>K" 8   ƒ   curproc㿘   >#p%@?   2  |M .2 |%@V   / 0@}  2>!0@  2  c @8#_ >7#!Ѐ`U M @" L ">7"!Ѐ`<> >a( 66  ?2 ?@} 2  `"@   a( 2 `9%@     㿘@ 㾐   ` |    @  7`  F 2 `">7"!Ѐ,>`  `>!({ `" @ "  ``` *  ' /  gZ @// X `  S>>K# `H  D%0  '/>"g- @,  #/ ' />!0g  /```0`*``'>`0Kؒb/ /` /T ` <= 㿈  |  2 >#p`0>Kb /4  Є  * (Ѕ*8 #2    㿐``D ` `<  @`>#ܓ*`     T    >" ` ?1>` ,>["Ѐ  >"ؓ, @*`@`$ j >["Ѐ >@V? Ɋ  R`   R@& M >"ؑ, *  $  $ 㑔```Ɣ0.>"Ԁ* >["Ѐ ` ?`  > , "@*`@`  Ȑ >, #`+  ` spec_read modespec_read procspec_read typex   >I=" 2 >#p">I1" 2 @  > % D` > `ؓ+ @ *`@ ` `S0 ( ' D>" `"*` >`*" *   `   `h @  `  ` " ``"@]' ( 2@@3= ( @ە>  &8  '?#\#`Ϛ  ?% @"@@8  H-䀦    `0H"0Đ 㿘  ~  spec_write modespec_write procspec_write type㿈     >Hb!x  2 @>#p"@>HV!  >Ð OD` > `ؓ+ @ *`@ `  `}  2  6D >bԦ( " * >`*" *   `   `h @  `  ` " ``"@ ( 2@͒ @X> < @(   $8  Ә '?И@$8`H,ݐ`쀥`2   G! spec_ioctl㿘  D`  @  ` />>" ( @ +` @`  > @ > ("@*`@` @   ( #@ +` @` @Gl 㿘 `@ 2 `D` > `ؓ*@ *`@ `  spec_fsync: not dirtyspec_fsync: dirty㿘 `@ LH /* %`0   0   0 >G-" 0 $ 0H 060ޠ` `4@ 3F$@`4 `4`0  H 0>Đ"([0H 0 㿘  x   F>W!h`">@> , "@*`@`@     "`  `2  spec_close: not special㿘` D @`- `S>Ư `    "`  " ƚ >!< ؓ4 `*` *   -`В` `  `- ` s >! 4 `*`" *   Fg 0``tag VT_NON, dev %d, %d 㿘  D > G! `%>ńL(p `   ` "  `    `    㿐      D#\  f  spec_badop called㿘>F #㿘 >2 +L>7"`|  6?(@  ( ?(  6?    ?(@㿘>#p>2!L>76` |* @@` `2@`  2 @ H 2@0`2` umap_node_alloc: no alias for device㿐 >p>$ "  `@ c# @`@`   Y "`D`D` " "|$ $  &ߒ `@?  `D֒  >)c" @" a Ć@`@? 8D`D :` ?* >/c@ @   DD ` 2 D@ @@2 DV  ې ǔ `D  `D"`D@"`D " $@>E h"h"&>2!L>7|6` *   $ " " $  㿐)  'S h &㿘+!D` ?2&`#&``ڔ?2&`?#&`` ?#`˔?"&`&``` x<@@s -_  l T&$&(&&\&, a&`@ "U  g `$$ $  _* C"_* <}ܰܒ w ڒ 0*@ "@$ `|   < "$D< $<$D< Y_ؠ Z`@$  Y_ؐ`@w$   㿘!D 6`T  ` V 2 P!D &!D 㿘!D >#p`X&@ 㿘!D  @㾘@4!!D  "(6@6`&`&`&` &` &`&` D@&` d` `  `L` Z `` Z`<  @`  㿘!D 㿘!D ` 㿘 |  ``$€umap_bypass: %s umap_bypass: user was %d, group %d umap_bypass: user now %d, group %d umap_bypass: component credit user was %d, group %d umap_bypass: component credit user now %d, group %d umap_bypass: returning-user was %d umap_bypass: returning-user now %d umap_bypass: returning-component-user was %d umap_bypass: returning-component-user now %d  > P't`>D ` ;>$x` & `$x`"  "$ cЀ@" $$ | "@< ``٨ `?"&`?!&>`P` `>DV `> P " ``"`>DF `?( ?#'t"` > P  ` `>D,! `ے> P " x`"x>D!Xx@ *` @x`` ,` ?"` `" <"<`` `"``!2` 2 `"2 `  `?"#`?> P  `>Cѐ!R&> P  " ` `>C!`?$"> P  `>C!0t>`P` "    >C"umap_getattr: mapped uid = %d, mapped gid = %d umap_getattr: original uid = %d umap_getattr: original gid = %d 㿘ː " G   d"` )> P` ` >ɐ"Ca  !D    P ` " >ɐ"CJ #"` > `P` " >ɐ"C3  ?#"`  㿘    㿘  ` @*@& n 㿘 @* b" 㿘  |"`""`"@ | & |  㿘  \`| $ \0 $ \㿘  \`| $ \6 $ \ tag VT_UMAPFS, vp=%p, lowervp=%p 㿘 `|>Bϐ!x umap_rename: rename component credit user was %d, group %d umap_rename: rename component credit user now %d, group %d 㿘 `  W>$` `P`  `> B!J> P   `> B"ސ $` 8@>/a 27  @$ @;'؀   ! ޖ'  "&(j   > @  '&@  㿘>!H  |"@>!@ >>ʐ""`< 㿘>!ȱ. @ 2  "@ "@ ,  㿘>!ȱ.  `" "-x 㿘    2  @2  @ ː Ɛ @ @2 (@ (  ?& (`"  "` "@@"   "&   " ̒ &   "& & & ??> 8  "& & ??> 0@>!H,  & " " @ &  ( & (|㿘 㿘 }㿘 @ 1?? |`0 2:`0`4 :`0  2`8?`8?`< ?:`8??@F union: unidentifiable allocationunion: . not lockedunion: allocvp not lock owner㿘 \@aD@`>?#` `" `@`@@" @ @`@ ``  `` `  R @2 >!H "`  `0 `0 "=  "9 7`"5 4`  , $  2  2 `2      ` 2      o@2 ( ( 2>>?;##p "&  @ 0@ ?$ >?+  (` `  ( +T$ (`>#p $ ( 0?$ @ @ `"  "  (  ?$ ( @˒ `  $    $  [   * $ `" V  $`  @2   2` >/ ` 8`А`d0` H  "`|@`"@`@`@"`@ |$ $ ??< 0$ < 8$ |$ ,$ $  `$ ( $ (>#p "? 0 $ @`  $   P $  [=   W* $ $ $ $ ` >!H, $ " " @ $  ( $ (`` 㿘 | (  ?$ (`"  "` "@  "  "   "   "   " |  | & | p' '  ? տ ! G ձ  :@ ǔ Ш '@''''''ؔ R '''?'$'Ԁ 'ؔ e耢`  "'ؐ0 㿐@ P`(`` $`(` Ԉ   כ Ԋ `( ׏$`( @(`Ɣ`(  $`(`$  k R`$`@$`$㿘 \ ' 5 '  Z"  *@ '' ' '   2  '  ' '  )' Ĕ 2 0 ' p#\Ø "" 9 '  |7 ִ  & ` @#\̖И `-0̀  ֋ZX  Ԏ \  wF`%:``@ a'   '`Yz 'p' 't'x'|'` ''`lp`" 9`l `:`l@0l" '4``1 ` l.Q l`  2`%yl㿘` ?6 M㿘>#p@ (  ?& (`"  "` "@ (  ?& (  ;8     \  ؀   union: dircache table too small㿘 >/a `"@" &@? &><"ؐ & |   ۔㿀'`, | ,`2 |' ǔ   '* ' |" ,"@`''@``  ' | ` @ ' `   #\#`ז  |" ,`|" , ՚㿘 ,    , & ,:::union_mount: bad um_op㿈 <@@ -Vf   <&$ P&(&&&,  &@      ``$ ``    | $  $$ $ $$ < 2   ֣ f  $ @ 2@   `: !$   "  <@   < "< $<  << @ $<$D YU Z@"@   ">  >0 >0 > !X!h>!x:ː!@W  Z"?Uw@ @$    `` 㿐!D6`@6`  /     @ $ `@ R` $`   @V`!DӒ &!D 㿐!D>cpA  2  " `Џ   "+   #\ #`n ` E   @ |`( ?"`(㾘!D@N!     2`&` &` &`&`&`   "6@I6`&`&`` @k@|&` `@e@|&``@_@|&``  `&` `@&` `&` &`` D@  &`  d`  V6@ `LV Z `V} Z`<  @~y` 㿘`  ( & (㿐@@1 " ' &@r ̔2 2"& @2!`ϵ`   `` €p  "& @ " D& union_lookup returning. (%x) not same as startdir (%x) ``   ' '!D |$ ` `''>@Q#p`( 2 t - `($`(o @` @`( $`(`C  ``"@  ?$  ? @2      ؀    =2< `$  $ `$  $  Ҷ .` @! ' '``"@  ?$  @ ` ` |   'n `ǔ`2`  ?$ ` "f % @ " `( l$`(2`΢`(   $`( EiA'  N` #\ #`t   "N $` `  @2  &   J . `@>Ґ"(8㿈  | `' ( U ( $ ( ΐ    #\#` 0 㿘  | >#p  - ( 2 "  S 㿈`` | *  (   ( $ (` ` `m 􀠠 ` `  #\#`К 0  㿘    | `(  `@ 4 ` ` $ ` $ͱ$ $K f0 ( 9㿘  |` 2& `$`?"`$& >!`* @@㿘  | `   `( 2     9'` "`c *  !D    `8   |  (  2 D   27`??  2 @      "`??    @ "  @ 2 ` 2    d "`㿘` | `  @ 2 ````  ܒ@ % !  ( 2  `` ` ``?2``? `??U`㿘  |` "```?> #p`̢  `( 2      L*  |   04@  ?? 84   <@  ??  union: missing upper layer in write㿘  | >`#p>6 " ( 2 V   ͓    0  4  ?? 㿘  | `" & >"h`* @@㿘  | `" & >"`* @@㿘  | `" & >"`* @@㿘  | `" & >#`* @@㿘  |`  "` " ``?`Д  `( 2  ג   ͞ z㿘  | `" & >#p`* @@union remove: null upper vnode㿘    |`| >5O!` `1 ( ( ( $ (S `( `( $`(E    $̓ ʐ0 2 i   ` !D!union_link called without LOCKPARENT set! 㿐     `|>6U#@E  `@? | 2:  ` ` @2   ֔ ` ` `     F  6   λ,     β0  έ ` '  "`( 0 |`( $`(  㿘```>/a`  ``| V ]`>/a 2| 2 E  `  @ "  D>/a | . 7 ( $ (b`>/a 2| # ( $ (N`` `  ؐ`0`50㿈  `| `.  ( ] (  & (   ْ " p 0    #\ #`c  0  union rmdir: null upper vnode㿘    |`| >3ɐ#` `1 (  ( $ ( `( `( $`(  q  $̣ D0 2    ` !D㿐  | `  ( ǐW ( $ (    ̟ "@v  㿘  | > #p ( 2&  & >  * @@㿘  |` "``>`? #p`r & `( 2&  y& >  * @@ 㿘  | " (`? ``A &  2&  I& >! * @@ 㿘  |K  ܒ  (     㿘  union: dangling klockunion: dangling upper lock (%lx)union: locking against myself㿘   @,@ | ` (  V    ߔ " (3 $ ( ( "  (>ِ 0>ِ H2 >#p "  @ 0@$ (>2w p ( " ( |#p "? 0$ @ (  $ (union: unlock unlocked nodeunion: unlocking other process's union node㿘  | (  >2F!>#p " ( @ 0@ ?$ (>25! ( ? $ ( .  ( `$ ( $ ($ @ 㿘  |` > #p```?`M & `( 2&  T& >! * @@  tag VT_UNION, vp=%p, uppervp=%p, lowervp=%p uppervplowervpdircache:㿘  |` >`#39 | `>(# | `>!# | ,   !>#  2  |(2  㿘  |` "``>`? #p`ڔ & `( 2&  & >"H * @@ ˁ㿘  | h  |  a` 㿘  | `" & >"t`* @@union_strategy: nil vpunion_strategy: writing to lowervp㿘  \ | " & \>1:" 0@  | >1."Ր& \㿘>!d*`" * "@>Wa` I4`"a`@x[ @x <@xU <.*@x @xM >)* 2cT@xa>2 +"'!n!m ">"(>"@ *`*>0`` ">0`*  3 ȐD* @3 Ȁ>)#6&%b  * ,  @s, .>0 6@dos2unixtime(): month value out of range (%ld) 㿘 &l& d`, g2*" * 6` *" * *@xw >H@>2 ?"2 @ `"anam`@ ` >"(>"@!2   >ې p1֒   ?@ : *``@ @ @>M.`* "@*`" * b "P>MP d>d@ + " * @w&* "*"@ *`@*`@*`&  >=>X `>X*  >X>X   @ `*  `  "*@ .*@`` >X>X   @ `*  `*@ 㿐  ` *? 6*.`  .2 . .@  .  .@.`(̰  0  " .        .`"2  < /` "@& " >"X @  @ * @ @2  ` *? &  ?? " ."! >"X   @* @2  2 *?   *  2@ _.@@  .@8 6 ?@vp  0,@w    @ "'? " @ "  ~.@   .@     @? "."((@"   (* * * * 2 ? &@(`( ? @(`( ? @(`(   ((  @* @ 2?V? ?(("@ `K@  >X * @ ` 7  3  >X  @ ` #    >X    ?@ `    ?<璂  @ ?_a@  ` ((*` ` 2??N` @?((@  + /":+? `12< `  + /"0 `8+? < `  + /" +? `  *`+??<   0( 㿘`?` "`.``?` ` @p 㿘>!t>W2  : j ;> "` 㿘>#p@6@>W! >  *` 2  @2 2 @2 (  @ ` >W0> >WḄ 2 `(  2 2  2 ("   2 @ 2" """@   2   "" denodedeget(): pcbmap returned %d 㿈>`tc #p`"`<`z 2& @> i  & = @r@  4 >ޔp  "`|$ $ $ $ 0` $ $ @j$ `7y "$ , "`0``$   $ (`t#@'`<@##@ "@ , ``t#@2$ l`<$ l`@@uA`$ p4 b, a !4 d b4 f4 jN4 h@ Q찒 j TIs  , ` , a  * @4 b  * @4 d  * @4 f  * @4 h  * @4 j  * @$ l   *` *  *` $ p ,`t#@   * @ l*` $ l `  " @ l ?c @  >`T*  $ p"x-0 "`@/ & 㿐>L   '*`" *  * ' ǖ detrunc(): can't truncate root directory, clust %ld, offset %ld 㿈` ```,  ` t#@>``-u" `@f`p@`  `  T@ 2@ @Z "  `0r`l?''$`l ` T@ @V2@  X@2  `? T \#@ D*@  @` `? T \6@ "@ (  0C@^` ` H"@@pD$`p$`p`` $$`   `H Z 􀢿 @ޘ?  T2@$`|$`쀢`  t2@ ??@deextend: file too large㿘    ,t#@" `4  ` " p. @ 8`>+\!hT@2@ ?2 @"& pP@   @    p    & p  $" 㿘 ` msdosfs_reclaim(): pushing active㿘 >#   |T  >"nɐl "& q =$ | msdosfs_inactive(): pushing active㿘 >#   `|T` >#XE T   (` <  ? , T  ϔ T  㿘 h@r l@s; 4$8@s3  @s.  8@@ &2&  h@q'㿀 '?>2`(, "`(2ll 1' ` ) Tp.@ ɰ  \ @"2@& \ <".@@&2&   Tp `.@"@@ 8 ' 2&  "' `''@&@'>-c8 "c8>G#* `" T# t2?r @r @r f쀢 " _ ?ఒ Q t H  *  @ *@ *  H  * @' t/ 2 ' t '2 ?8'  ' t2@ ??   T \?"@  D*  && $t$x0& "$$ ?$|   t`t"` 8 ` "(``  ` " " t ? :" 㿐 x "S  P # |4 *`    * @  L   4 * ?24   *4 4  * @G: ?& |$ ? xO & x!  H S*a P2 *a P*a P*a *a |2 *a |*a |*a @   @"&   6!    4 `< `HH`<E' @   &  @0ؐ㿐    P*  `$ P2*`*@#@0   @" P?$ P& fatentry(): function code doesn't specify get or set fatentry(): get function with no place to put result 㿈  >   > @*  `L`@q@p|`Ԙ`?谒  0*`t#@ H  *   *` *   H  * @`t/2 22`t 2?8& `?`t#") P#'I H  * @ / < / H*@ H 2-*  H*@ H 7 $*  H@  @ * *`  * < +@  H 2*  H 2*  H 2* ' &`d耢  9㿈`@ L?  )0?# @p`@o  ?Θ谒 耦r#` t- ]0X H ` * @<  ( H*@ H@2*`쀎``8'5` H*@ H@0*`)  H@  @ * @* @ * @< +@  H@2*` H@2*` H@2*` '@2`ؐ2v  $ d 㿘6```*@?*`L2`E  "  "  E?  *`@ 8㿘  2*`  (  "  P ?& P   2'`2'@ 㿐 @ @ r@k :`  q@oabm `9  L @n @8& 4` , @ ` * ?@:`E$, ?r;(` "  L@4` @!4` , @ ` * ?@:`D, ?L(` " `   W㿈'耦`??# L@8 @n@nE 耢`Ӕ ?J谒 "0s6`* P`  $ P  * *@"  t@")o P@ #@+H t H ` * @2  <@ H*@ H@2-*` H  * * H   *  H    *  H* *  +` H  * ( H6`@ *` t@ 6@ ?8@ `8t L耢`V 㿈'L  2  ?, "@L  2 *$PL \@n7@mh@l 쀢 2t쀢 " ?찒 "t08#@ H@  @*   *` *  H@  @* @t/@ 22`t@2L4 *P  $P  * *@" L ( extendfile(): attempt to extend root directory extendfile: pcbmap㿐l  , ` >&! >[!`|`"!`l `?c >B `  `0% 0 2' '? p&@& l    $lB א|   $| ?J$F' `  ```T`'`\ `#@ `D( ˒ !`T`\ ``"@ ,  T`T `\  P"@#;@ ?$ T T?2 H>$"  H@i <$ @& ?`'`2l `   |  ' ?'',#@ `' '̚'0   @ ( \  @ K/  _  "̀` ` ה̀`     9   C̀`   $`` Ш |#@ "J@ .2  2 J` .2  '#  "    " '  2 Ā``2' 2 'Ԥ /ܰ  U 0t?ذ Q܀C H ``? `.`  3 &    2 ` 2? @ `@h "% ?% F%$` ܀@ @ @&@* @Ā``2  "(  f % %$`($ J?@Ā`А@"    ` * @t#@   * @*`< "  "` '# Tt#@Ā "<Ā`2, '#@2   l ` Ӑа #@԰  `1#@Ā`6Ȁ`1 .#@2 } ג vl2`o ԰ g #@`($]  W $ j԰ `Ք0À`0 -`ɔ & 00l `\#@A԰ 00` Ԑ a #@@А@: 㿈` `p@ `,?"@  `` `T 2@ '  p ? 0`T`p*@ &`p` `T3@  ` `X `?谒 ` T`X H @  >В `,  , a, c, b2 ,  e, d2 ,  g, f2 ,  i, h2 ,  k, j2 ,  o, l2 ,  `  s,  ` 2 p2 ,  `  q,  `  p, , tc 2`$l,  l, `$ B `$`7&`$` `X@2!?;谒 Q`  &` `T2@ E`?谒 ;` `XH &`  ` `$? &`$ 谒 ! ` l#`t@'`<"'  #/. .. 㿈 ,    >`??6쀢 .H$ `" 2쀢`!>b@f  >b@f H  * O`K G  doscheckpath: source and target on different filesystemsdoscheckpath(): .. not a directory? 㿐''`` j ` "g `ll` _`,,@"`t> ̐#PT #@  `<L````T`\?`l# `D?*@ @  : H ` 3>b@f  2-  ` ``t* @ ` `*` * lȀ `< ' Q  ` 2`    2>!Ґ# { 㿘 `` X T \  @2 "@ * * `2  T T \6"  <*@@  \"@  D*    ?9  z& "   X H  ' 㿘 ,  ˜㿈 `( ,?&`( ? `Tv4 ;`?찒 E0/`XH @ ` "    6   ?*@`  `X ` "?r찒  ` 2  `X 2? 㿈 , ``ۖ  G E  " `: 8'  ?좒 *H   @e H  * ͤ`ɐƐ  㿈 ,  ژ 2, `?g쀢 !H@ @  @  "` `  ` @ * @ א    x:G |@<@"M&$D`  ` @  O  <@2 - ` 'x<@"x   ``L !  0 ` *@$`x 2&$`| @&(&x&&,  @ " DR  >"Ԁ@& H   "<< !!` ǖ Ȑ0i <@@2 `@fx   "D0M$` $`4`` @ $` $``"$` `t#@$`@t @0#t` | "  tv$` Yp9p Z`@c$  Yx9 p`@c~$  RRaArrAaU㿈`D  V* >2 8@M `j  ƚ   8`<   ? ,'x   `h ?Ț2`D  (  ` O "?찒 2`D 0 H`" 0 x`  ! U۰  ! 2`D! ; @b!$ ` ` @* @4  ` `* @4  `,  ` `* @4 ` `* @4 " ` ` * @$ 4 ` ` * @4 ( ` `* @4 * ` , $x 2 "  7 " O * 8 O ( ?8 O " 2  ` ` `*` * ` *` $ , ` ` `*` * ` *` * @ "$ ,$ 0 @eM? 0 @8l  24 ! 2d  ! 2`  " 2\  4 2X  * @2R #$ t $  $   *` *  *` $ 4  * @  $   $ x > t#@ (  ?2" O @@2 O 0` @_@e@ 4  0@e$ 0 ,@e~$ , @ez4  "@ev4 " 4@er$ 4@en # t@$ 8 4 " ! #* * $ *  @eX$ <@$ D & %* @$ x @eL 4@  $ < *  @d? <$ @@$ D 0 D @d" $ H  4$ L @e3 $ px " t H/  ? *?* 2  8?/$ t $   2 t L//$ t $  ?#$ t $  $  t/2@ *` $ h h@d]  $ l:Ԑ ?$ \ @d $ `? `$ X:ɐ ?$ T  `*@ h O x`:'$?S찒 2[`D>b@ H @a 2%$ xa>bH@a  2$ xa>bP@a  2$ xc@a  2 $ x a a a*` * a *` $ |g' < L  2 * $ $ $ F 2`D`<   $    $  $ d&aD` &`d &`h`D " `D쀢`" 7   ?   "R <O ;&aD 㿘 6`   aD` D" ` ` ?<`- <* ;$aD`<*@$`<㿐!D    &@㿘!D6@``&```&``H&` `P&``P&`` &` D@ &` `L8U Z `8Q Z`<  @`M` msdosfs_sync: rofs mod㿘Dd " 6>n!P 5` 2 $ @ ' |` <` 0 " `"@`   d 2 @ 2 ` <@2 `mD 2  㿐!D` 2` `ޖ 2 & &0 '4'@ | 2@"` "`msdosfs_create: no name | l    p@i $2p>ې#@`  İ 2Z   ! /'' h' '| ,' '>L ؘ   'h+`# +  + 'l <' /` p ֔ w  Ԕoѐpd ?A' 2@ d  "@ 㿘   2  @ y Β t   㿐 R` 7`|Ő 2>L   '*`" *  * '  $  &  j h  ` . ` ,    f     d b a  ?&  㿘  | `!m` ,!   { @㿐   |`,>L   '*`" *  * '` %2  $``j`hƖ `` ,```, ` `f 跖 ` `d`b诖`a` ?$``$ `` "``lT\?" D* @bB  T\?" D* @b4 <@b.`2 @$ `` !m!4`,  @4 `` @4 4`, $ `, $$D`p <`j,`hܔ `,    `fӖ$`d`b `aΖ4 $@,0$$$( $4$8$@ `` 2$<@$@$<`, `$ `,`p X *   0  p=`'J #(` 6`B =  ` ` B 2 `` ( ` p2`` ( `` G `p`>' B 2/` (,```>T @ B @ B B?@Z(  `  @ 2@D  | 'T@?2 ?'`@ZT: 4 2`@ (` T@Y\& @Z X E` D@Yܔ@Y4 @ 0p- `- '`H@\d`<TP"@TT \ "@ 쇓8 ?"`T`T?2` W "K 0J?` ` X` `"8 < ` B p ` @@I&p@ H o`  &` 2W`  ?ꠘ `& `%`@ b =` ? pꑘ `2    b    㿘  `  `?  |` J`? 㿈 ` < 2 >L `|  '*`" *  * '  $  $  j h D ` , ` ,    f  5    d b- a  ?$   x ? ``t$  ( p耢 2o T3  `*`  *`  a*`  c*` b2 *` e*` d2 *` g*` f2 *` i*` h2 *` k*` j2 *` o*` l2 *` `  s* `  p2  *` `耊  q*` `耊  p*` , tc 2   l*` l*`  ~ ~b㿘   | @ `| 6 0  㿘 Z   -msdosfs_rename: no namemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirrename: lost dir entrymsdosfs_rename: updating .. in root directory?X       >#p''Ѐ$aD$2>g `@  @ԐԀ@̐dԀ "^dЀ   `} ސ | `` "| J .   ` @  @В  $`Ԩ `| |  ' ' /ð |`| l`l2 m$`"  Ԑ 2`@2>ې \ 2`Ԩ `| | "`| ` x ְ B԰ ΰ  ɀ `|'ڔ O ? %> 耦` Ѐ 2|>! `   | 'Ȁ>t!  p` jN ݨ `Tؒ1$ 1  Ė$ $$1 @`(Ȕ$`( " ` `T`Ę 阓0  `? -;` `X$`` (`'`l`2`>!(?`T`\``#@`D*@ {@ }?̒  H o` *`l2 *`|̰В  ` $`YWЁmsdosfs_mkdir: no name   |l , p@   ?dǚ 2p@X ' ' <'h>L ؘ   'h+`# +  + }'l /`  ֔ n  Ԕfd ?'` `T `\``#@`D*@ }t@ H@X``>! H0: @ Hg*d2 **ԑ2 **ґ2 ** *֑2 **ڑ2 **ؑ2 *`t#@l`<" *:2*;*0ԑ2 *1*.ґ2 */*-*2֑2 *3*8ڑ2 *9*6ؑ2 *7`t#@ d*d*l*4 l*5{ 1$2>#=p # /'d'``'` '| @_  `    "@d Q  㿘  | | O%   B` @   Ր   晔  ƐĐ㿘 Q   -...p'ܴ '  | ,' `?   @W!    ` "& w ܖ" ` 'ؑ2 . J `"@`"``l 2 `t#@2- `<2)  @'Ԑ  2! @ 5` {ܭ5`4 # `t2 '`<`T`\?" `D* @Z ' /  > / 7 /> А 7/  ? 7 @  - ܪ` E "%ծ$`t :`@ e@T`T `XԄ ``%@ @ " 8 `p"  8ВG䴒 `?y՘ഒ @"@@8H  t "?  ` xkq m?*  c`t* @ *` *  2 `Tc `<`T`\?`\?" `D* @Z  ' `T`\?" `D* @Y `<@Y H$: ' /㐐 @`* /*>  ? 7 @ ? h  ` %  H` E  u z{  5``"> @""@>  Ԙ& `p  @ e @ b 2``8 `` "@zS`" 㿘  |  4zd㿘   |` 4od㿘  | 4㿘   |`, "@  2  2&T\  "@ :   5  msdosfs_strategy: spec㿘 \`@ ? `|> 0 T P2 T`, T \"@ :  T  ?$ T T? H@U <$ @ T?` `D $ D>#`* @@ |otag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %d, %d, %s (LOCKED)㿘  | l > ǐ!@  > Τa ">>!!ܰ 4 㿐     | p  #\ 0``|',>(     `  "  ` $  `   `    㿘` %>#X.` 塚  ..  . . .    >cTⲔ  6`H /* '>H`8` 2`H 0 &@&``&` 6` X#  2&`] 7$d=&`H /* '#>-cP   Wm cP&`>O @" > !2`  * >H`8` ?"` `$cPH 0` " `&`(&`$`&`  6`` 2&`  7&` &` `#&` &`  `$|  Y" `"`"` bpf: ifpromisc failedbpf_detachd: descriptor not in list㿘 4  . 4 @  " >5"   >`@)" 2"  2&   "& >5h 6 㿘 .  * "* >5`    @T+ X $ <># $ 㿘 . * "* >5` H /* '   H 0@ bpf㿘 . * "* >5`   2`{  @w H /* ' ?  $ 2G$ $>B!`C$ $H 0\ 9$ $ "   2*    $>Ba`? !>  # ? #H 004      $ $  $ $ $   " 6H 0  oH /* '  $ $ $ H 0㿀 . * "* >5`  `2`-  `( `  `<@H /*!  | H 00W  ( "" " " " " " ," 0㿘 "o@  . * "* >5` 7"q@ "i@" "h@ "f@o"j@"  "@N"s@" <  w@"n@>  "~@" "p@""k@" ٢  "r@ "}@"΢  "m@"   v@ "g@6 0 "l@n0"f@"  H /* '    @H 0&  2    8&  && @H /* ' AH 00t"r H /* ' 4   @   . 4H 00X "V S "Q  @0L@H>@UaX>a\@Oې  ;&  7 5& aX @Tے& @T9>@Ura\(& ,& 0#&!. 666 ?& & & 8& @  & D   & H @ (& < &㿘`  (@ 2E H /* ' & (H 0)@-, y `' @h "H /* ' & (H 0    㿘 .`N@  ` А ( `>7 0` @  8*@`@ $ @>7 Ā`"= ` "5@ @QV 2/@ 4 2 - 2  @G #H /* ' @  ˒H 0 `2` 㿘 (֔ 㿘`2:  *` * " * >5` H /* '   6 "  "  H 0 ? $ >B!`"$ qPH 0 㿘  !>( , ( @& , "@F"l bpf_mcopy㿘#> 2  `@ (f㿘`  ` @`  #> ,  ( @u& , "@` 㿘    @ 4    ? $$ 6 2  0 d& 0 & &  & &  &  8   <` @ Db H P& P "   8   <` @ DL Hߐ P& P @$ 4 $@$  $&&  >Ba`  & $  & &  & & &  8   <` @ D H P& P㿘  ǔ &    & & &   O  7㿘  " (E   " ?  " (9  ( "&3 &bpfattach㿘  ݏ  2">  P"">7`" ""`" ?""x`" $ 4 2 $ 2  & $ 4! 6 4? & $ 4 > 6 4   47  a D"@ @6   @ " @  * ((,  ,   % "  " @  @ * ((   * ((   * ((  "  "@ @6   "   2" "   * H  ְ?? `>#\*`  |      $l|||| |||||||   ,|||||  l|| 4||| || t|||  D|| ||| ||||||  X|| |||@ ,|| l|||  || |||4||||||| |||  ||L||||||| |||||||X||||||| |||  ||d||t|||||||||||||||||||||||||||||||||||||||||    `?2 Ŕ`4  `H2 & @ Y2 ` @   "@  @ 6    ` 2ذ @ @ *  **`    ` 2 @ @ `* @ @ 2 ` @   "@  @ 6 J @  @ 2 ` @   "@  @ 6  @ *    * @ * @ * "@ * "@-  () '  *# !  2   "  (  *    2  "  * hfd"  0 Z XV*T2 Q N"  @PѰ I  @P- C ?  < 9* 624 2 0  4*`2  6*  6% 928 4   Ҕ*``?㿘>M#H` >#` ""```2`@  㿘>#%>@`"#X 6 0># @  >#  + "# + ڠX`  $4 X. $X @L 9@(   , ( ځ @Lݒ`(,`( , `0$h,  04  8, >#>@aX*  "?$` >"$` $` `"``& &  $`$@$`,?* 㿘># 2& >M"#H#H" &  & >McHcH & cH "` ">M"#H#H& v㿘># 2& >M"#H#H" &  & & >McH`& `" "`\㿘>M#H - "&  ` @2   "  @@L  4 "    "   @L}    2  2  㿘>M#H " 4 "  "   `@2   `"   @@LT    2  2 4 㿘     ># >M>@!X.  :?>M#H`5` "-` `2$  "   ` @  `* "  @Si "   2``2` >MH "     22  㿘 `; ` "8 `2/  ` @@KȐ "( `"   @@K 2  ` @  @ `*   2㿘 ,`D ( `$`   `D` ?@Z &`D"` &`D    $ >"㿘 4 ?  6 4M1   2@ @as㿘 4`@ak2 4㿘O  && & 㿘H /* '>M#H  T 2  24 2*  2   `" @  2T 2H 0>>aX#Ғ 㿘>M#H "   @J     㿘0!@0!$@@ݐ   !2@ !1@y !@% !@"h 0!@"`@0!@" `4r 0!@"`8k 4$ f DȰ " `4  H /*':H 0 "`4`4 2`4H /*'7H 0`4?"R` ! @ 4`4 ܒ {w$`@Ғ q` h c - !",  !"&  !  !- 0!00!   0!0!    ,0 !!!"0!#0!%   @0!" 00! " 0 !0! 4 x@ 2!`>M#H0! `  @ ` ``   2 &@` >MY#H0! S !   `G@I ^ 2C@< :@!   I7# `   ؒ<  " ؒ1  2  *   `Ȁ` @"&@ %s: can't handle af%d 㿈  4 A AQ 2>L & t   8& x 4  @X   8?4 8 4 " 4 x "  0 4  @Xl 0@W $ x 2 4" A " \`>L : A @ "  w>}#H>y#H@e 2` ! ( 4( 沔M֖ (e7 0怦`  …`  ݒ    B 4(? < 沔M  "5`` 2  `?"   ?"  `` ?$``$`  MB `` `` $` `  ऒ  `7  7  /``@.` 2  `?"   ?"  `` ?&``&`  L ` ` `` &`S 7`   ऒ  ,  @I CH /* '  @    & H 0& 7 `` & `&` 2" &  &  & `"" 4 h & h 4$ @H 0`LF㿘 4 >L & t   \& x  & \@  >#(@G  !"6#" , d & d , @IE #2 `  4! @Gɔ  `  h"$ 4 h`0> 5@4`09>HT `J"T>O >  *4  ! >  > ! } >HT@ 0"T>O >  *4   >ߐ >i# 4 b@fŐ0]*2 Y @ T  ` P*@"@K@ N'"   && ?`&` ?"   ?"   ?&`&  Kɔ    &7@2@`2``2``2``2`` 2` ` ]2` K]0#H /* ' @ `KK"0 & 2" "" "H 0>H >0 : `0 `(   (((>"H㿘 . 8. 9 . :%& < >#``& | @"`  2 `* 9 *`  9 & `2@& 㿈H /* '     0)      >#H >#P // ^/  `/ /  / H 0^ / 耊 2 `H 0P  @Fd  2   @F]          $ H 0.  7Ӳ   H 0  7   $  $ ` $ ` "`&``$ ` &`H 0 4㿈H /* '     0) d     >#HY >#PT `// ^/  `/ /  C/ `H 0C / @EԔ  2   @E͔      2  H 0$ ?  $ H 0  `"  "`  "@ԩ 7`?&`H 0 4lo%d㿘 !>S? > !Ԡ!  > b$ $ <4 4$ > #$ | , 8 , :, 9 ( N ?\looutput: no header mbuf%s: can't handle af%d ` 2>L> #H & t (  `& x 4  x 'x't' (A't&`4 @" PIt4b _ 3] A P ` & P`@& ` > #h IZK /> ! H /* ' @ `ID"H 0/ 7&` 2" #!"  `">HT,@ "T>O>  *`4 ^ H6  H \ & H`@& \H 0 ` "`T  @ 404> "  2@ 1@ "  /  / " " " "" " ifmedia_add: can't malloc entry㿘    2"`> ""` "` "@ " &  "`㿘  ``  `ߐ`ifmedia_set: no match for 0x%x/0x%x ifmedia_set㿘@ 2 & > #XL:> #㿘 @w@us0!50 !6& j `@s `` " @2@2T &@& K&H&@ `&`&`&`&`€`   *  h ` .$2 02   ` `$* "` Ւ &`  ifmedia_match: multiple match for 0x%x/0x%x 㿘  >@%>   2  В 2 sl%d㿘 >[#? > >#po$1 `> bh$@!($040 ,0$0$0 2$1 $1ǐ X /osl%d: can't allocate buffer 㿘 Ā 28 đH /* '1>-#P   E #P>O @" > !2`  * >H`8` ?"` &#PH 0 >  8#  4 ? 4 4$  Đ x$ @[$  㿘>#p`؍` [`h >[U # `H ?Ԁ 2I/ "H 7&`$?`$?\H /* &`p $ &`pH 01 H /* &`L"Q $`` @ >$ #x=۔  H 00$ $H 0 / 㿘1H /* ' . h`1 I$`& БH /* '>O @`Đ("@> !2` ?* *   `>-P"x>H`Ē`8` "P "` H 0 $`$`$``耢   H=``=xH 0X@ ?ऐ "%s: af%d not supported 㿐 >#XXFp / &p`2`pF| 2  ` @24F~p A4@ ` 2 Fqc 4  2H /* '"  H 2 >L t "  'x"@`''А"@@' $ `@6&  @ `F7& H 0T 7  &T&`  2" & &  & >L &t  &x`H &@  H 0 ` Ь  H>H 8 H   ğ@ H 4  L H" "QH /* '਀ "  $$% ఐ?$ఀ "h $h    $$% ?$H 0   " Ь ` `ؔ@`  24@  @Y   @*   /  >L`$t``$x H   ` H=$`}  4  ` `?*  $> H `$` =e    ݐ =Z "`>0 $`H /* 'U *`@`?2`H 0   &H /* ' >O @"@> !2` ?* *   >- P"@  "P % H 0 >R cP*@ Ψ 2  = " `>P =X $XP $``$P㿘 >cT   6 H /* '>H`8` 2`H 0 &&  &  6  C `cO (GȑH /* '!>-#P   Bђ#P& >O @" > !2`  * >H`8` ?"`  $#PH 0  "  & (& $ &  6   2 D; Ȑ($& Ȑ 8&  & & & 㿈> `P`А ` "`P?2 ``p 2 `\` @2`\`̐ $`̔ `4 `'$`\2!$``؀ >L`` @6$``>L @>L`ؐ  $`$``؀ >L/0>L $`Ԁ ܀"`` 2``Ѐ 2 ``Ѐ 2 `$`Ѐ  ?$```Ȱ" $`o   ` @ @*p 2`4 O*@`4!@ `Ȓ@Y=` $`Lo@{p2z`L 'v`Ȓ p@Y+` $p`L`44`4o  `Ȕ ,???oO Ւ "Y`L`H $`H>L $`t  $`xH /* '> a @  "`L `l$`L`C$`l0 #  2" #a> " >H"T"`#"T>O >  *4  0 H 0```Ā@`*@$` $``̐ $``L $`L`$`А8$`$`H( @   @"   2@ 1@ 0 2 /424"  /  / Hppp%d㿘 >."? > >#a$$?`>ap$@%$?4? ,? ,?$?`$?X 2$?x$?$?$?  !a㿘 >." ``! >." ```!`$& $ "& %6 & ! @>Z .   &!T@Vi&!0&!8 "!(? 6"!(&!!&!>L &!@&!<㿘&  4& ?6 4 Ā"  & & " ̐?& ̀" B  Ā"  & & " ?& " B  ؀"! & & " ?& 􀢠" !Bp   Bk&!!2! Ba&!@*&!0!H &!8 &!H&!D!P "!T &!P&!L!T  &!T%s: comp_alloc failed %s: decomp_alloc failed %s: no compressor for [%x %x %x], %x x  Q@# S@"`  N@"@6?0 Z@"6` V@-?0 J@_?0  G@  F@m  R@L  Y@?0  M@"{   K0 L@?0`&`&&   H /* !` @ @@H 0'`<?# @@$`H 0a  Ԓ Z> $@(S4`R O& Ò IaT "E H /* ! @UEH 02  ҥ + 0'$`Ҝ "  Ȕ ـ >#X`w#X@ 2m`  5H /* !a0 a, @ @$a,@`؟€  $a0`@@> ` 7H 0'`*@$`H 00БH /* !a8 a4 @ @$a4@`؟€  $a8`@@> ` 7H 0'`*@$`H 00@ `@@r>ؐ!ْ`  ! 0 L@2 a(& za(u H /* !$a(  @ `@H 0\ H /* !>L a<"@&a@ "@&H 0D "*   ɴ  B 0-   8 #    G@aLaD H /* ' && H 0    㿘>#pH /* '  !2@  !1@A !@"/ ! @"'}  !@"4v 0!~@"' < !@ 0i0!z@Q0!{@"_  @\ ?Z24  ) OL$ <J&"G / CA /@;w 8! &!&`!&`!&` !&`! &`!T . &`!T &`!T &` !T &`$!T &`(!T &`,!T &`0!T $&`4@;K 8!0 "!8!,`€!8 !4`4€,H 0%s: af%d not supported %s output: 㿘 " 2 4 @. 2` 2 2`?Ȓ*@6`> `   ! !(@6` *  #`+  / 2" ` 2  `?"  `?" 4 ` ?  2&`  7?&` `<* * ** ` @ &`  @ @>#x @0 2!!$` *@!H  b 2!Pg !P V "`>L $!<`*!$ 鿒H /* ! !"&``.$!`@   @&&` "&` "H 0 T 7! `$ T "$!  2" "" " @>L & t   P& x` `& P& `H 0 >㿘!?!  *`@`! !("-,#$"@   @& " " T!  & T`&!  2" "" "$>m 2&!㿘H /* '  >H* & T @ "T>O >  *4  0\ H 0㿐`쀦    $`$`& `?$`  `    $`$`& `?$` 2a  $a    *  !   -01 !`,0aT(    0  ` 0 2@Qۖ  p " ,  / -,, , , @̔ 0 !4  "1`a0 ,`@( '   `a, a0`<   `@`` =  = ` 2` 2` 0 !" `   & & `  2  , ,    & & 㿘>."H /* !  '`?܀?Ā  H /* '$?ܑH 0 ?@H /* '?  $?$?"?$H 0 @j 0!aH 0if_ppp/ccp: not enough data in mbuf (%p+%x > %p+%x) 㿐` 8`@`` `` `  ` `*  @  @ @>! 0 @?`>"l*` bceebbeeeeeeeedX H /* ' ?# & H 0 0 @~ ` y2$!8!0 s` !,@  hH /* '   & H 0 0T R`!4 @ #\$ EH /* '  @0*@& H 0 0/ `,2!8!0&@#!, @ 0@!4 (@ H /* '  *@& H 0 㿘!0"!8!, @ &!0!8!4 @ &!8㿘H /* ' ` 6`&` Ȁ 2" & & Ȑ  >H`& T@ ]"T>O >  *4 4 0  H 0%s: got %d bytes %s: decompress failed %d %s: VJ uncompress failed on type comp %s: VJ uncompress failed on type uncomp %s: input queue full 㿀'!  &!@ @  >"@ k@`` @ `% ` `*  ?А*6`H /* '  (& H 0 B!8@8  : !4, 2 ;r v` ` `* 8 @@>"X !H /* '  (& @ @& H 0    @ !4`0€   &  @   (-!T @PsH /* '  7& H 0 -/ !T ` ` #\@Py    @@>"x>cT   4 H /* '>H`8` 2`H 0 $$  $  4  9 $   dS$H /* '#>-cP   8֒cP$ >O @" > !2`  * >H`8` ?"`  $cPH 0  "  $ ($ $ $  4  쀊 `  $  @  "@@     ?$ : :s0q  !,@,`,`,` ` $ ``@` &`?"&`    !  $  @  "@ ( `[$   ?$8S$`  `  `  `  $ H /* '>HV` 8*`@ `?2`H 0 ` "&@H /* '`>O @"@> !2` ?* *   >-`P"@` "P # H 0 @>$V`cP* @ľ"! d !T ` p` #\@O\ 6  ! @@>" 0,`d86&`` 1 >cT   4 H /* '>H`8` 2`H 0 $$  $  4  8e    ;˔9&` &` &`` *!H ֖ "!P ̖ "`>L &!@`*!$ !5!,  4 !("`9f0l` ` &`&`>HT&` `"T>O >  *4   >  b > ! ؠ H /* ' @&&` "H 0  @@>"  l #% l 2" "" "H 0  H \ % H@% \>L % t   % x @0 9 L! & L`&!%s  *p>#x  @  2  @*@ `  @*@` @  |*@ *@ ޒ`  >*@`*@>"p㿘>#p  VH /* &`h  `Ѐ   H 0;  0 2  H 0. `"6!@6!&!!X@4 ?&!X&!d&!x& > & > "\& > & &!|@ې 4`@6 4  & D#3" БH 0 㿘H /* & #  Ѐ  . h&  @ H 0 㿘H /* &!|  81&!|! " 8*&! $> #4Ւ ;& H 0㿘 Р @ zH 0r H /* & ` h " `ؑH 0Z - p2  p  @2 p  p  H 0= # !>p) "`H 0,. (`؀    $`$`& `?$`H 0 `    2`7㿀 p     @2 h  h  " ଀ <` @` ` (7q 77m0>H 8)>- >cT  4 H /* ' 4H 0 $$  $ 4  5Ȓ  $@$ `#(5 H /* '#P   5Q#P$ >O @" > !2`  *  ?$  %#PH 0  "  $ ($ $ $  4       $ @  "@  ?$`@8 f $ ` /   ``  "`"`  | 㿘 Ѐ``q? P@]   U@2 X@!V  W@"   T@I  O@Bϒ GD$aXaXA& ’ :7$axax4& ǵ -H /*&aX  $a\a`*@$a`ad $adH 00aX  0 :   R@@Đ>(0 @0(`(2 㿐 `H!9  `H>H 8!|`2!`  2`H* !%` 2 ` ~!`H.+&!`?` ǐ#6!>L`& t``& x` `F 2 *` aX.@*  .`H$%!@'&!"H /* &  }- : - *H 0! &!`?"%`@ l!: :*` aX.@ }/ //H 0߀H 0׀/!: :  :*` aX.@ },@` ,@,@` ~,@`H /* &  -`H "    .Ɛ`H?0* H 0!$@&!"-%`H /* 'U`*`@`?2`H 0 ` &H /* '`>O @"@> !2` ?* *   >-`P"@` "P ' H 0 >R cP*@ ު ` !`` 6!`&!|`H!$!|H /* & @. `  $ > #4m  $& H 0㿘H /*&  ,`($H 0㿘 Ā` П@ H c` p    @  O 㿘 H o*@f {& Ԓ H 0㿘H /* &   `o!>H 8'>- 2\  >cT   4 H /* ' 4H 0 $$  $  4  3! B&H /* 'P   2qP$ >O @" > !2`  *  ?$  $PH 0  "  $ ($ $ $  4     $$@"`H 0%s: bad char %x %s: bad fcs %x %s: too short (%d) %s: no input mbufs! %s: garbage received: 0x%x (need 0xFF) %s: missing UI (0x3), got 0x%x %s: bad protocol %x %s: packet too big %s: too few input mbufs! 㿘`Ф @:`@6> @Pa `"P  $a `@@>!q!`"( `2` "``p!!&`p> nؓ*@ *`@ `€ 0   `p`Đ >`&`p@0H /* &  ``@ $`>> *`   * @`` $`H 0`@@Ӓ ~2`aa 4a@Ȓ?`0  -<a @) H /* & @ $`@@>!!a``La $`L`$a0*@$`H 00 4&a @`@>!!`ޔH /* &`L a`$`L $a` $`H 00h` ?  "` aa 2$aa` ?"` aa@a$a"`!ɔ `H /* & *$`H 0:04@@.@20*  ax*@#H /* & ` @2 *@ } @$`H 00 $` H 0a @ a 2aa 2 a`@@>!!$ a `` "  $ $a  $a?4a``@@>!!a?* $a * a$a`4a  $ a 2a  @`@>!"``a 2a "aa* a$aa`4a  " a 2a 2a`@@l>!aJ"8`*d`` 4a* 2 ` @`@V>!)"Pa      $ @  "@`$ +   ?$ 4$  2c 2 `@@.>!"h鯒`*`$a  $     $ $a > $ ac* a$a*2 * @2 4aH 00)` H /* &`L a` $`L`$a $`H 0@H 0 %s input: 㿘`!*a &!! `  >##D !@!&!%s p >>! @ **@`2  *@`   *@`*@`*@>$ p!"  * " (" $" " 4 0 " ," 0㿘  ,@ +#@ 2` $ 2`"@ $& 2`"@& $  # @  & ,  $`* @/]  ( 8& (Ɛ  㿘 @&@ <&` H&` D&`  8&` 4&` #&` $*&`2``@/2`&`㿘6 & 0㿘`$T  2P   2L  6  2G  `)>$"*` 4#  #)  "] " Ϡ .` P   *  @,8 P ,` Ӕ  & Lf  & L&& . & . 㿘 L "U R 㿘 㿘 㿘`@ 29 ` 25 `6` 20  ` 2+ "! L "  !  L*2@  #*?2 T2 V. & \ &  . K 㿐#\#` 㿐\#\ #`㿀'H 'T' ' '  *    '&@nT4'T >cT.   4`H /* '>H`8` 2`H 0 $@$``$`4` .cH`R#$`  T l(8`H /* '!>-#P   -#P$`>O @" > !2`  * >H`8` ?"` `$#PH 0` " `$`($`$`$`  4``  $`````$`   " ` ?$@   ,  , ,  ,  2 ,  ,    6   '??' '' / * @,`P * ` '  Ȭ   :$ , P`@   `;>-% ->H 8 }`5,  w `$ $` >cTC  $@ 2`H /* ' 5H 0 @"@" @ " @2  -u$@@`HT# l4$` H /* 'cP   ,cP$`>O @" > !2`  *  ?% `'cPH 0` " `$`($`$`$`  4`` ```$`   " ` ?$@   - # * ?  '. +  X* `T #2`T25`%@ '& 뀦 2+>-% ->H 8 }`5,  w `$ $` >cT  $@ 2`H /* ' 4H 0 @"@" @`"`@2  ,$@@`HT# l4$` H /* 'cP   ,FcP$`>O @" > !2`  *  ?$ `%cPH 0` " `$`($`$`$`  4`` ```$`   " ` ?$@   - $ @& $ &   & $ % !*>H 8+>- }`5,  w `$ $` >cT  $@ 2`H /* ' 4H 0 @"@" @`"`@2  ,$$@@`HT# l4$` H /* 'cP   +cP$`>O @" > !2`  *  ?$ `%cPH 0` " `$`($`$`$`  4`` ```$`   " ` ?$@   - z x`? * 2 ,  n `$ $` >cTj   $@ 2`H /* '>H`8` 2`H 0 @"@" @`"`@2  +$@@`=T# l7$` H /* '!>-#P   +!#P$`>O @" > !2`  * >H`8` ?"` `$#PH 0` " `$`($`$`$`  4`` ``$@$$`  * ?* T T  . T` @  <@ & @ & <H " 4,H# 4 8 & 4@  & 8 D H`& D & H`㿘 `  ``*  ߀   4  & 4@6 ` `S?Q` #,  X@ *@*`P `*   7    :" * P @:   "`  *? `. * `T"2`T23 #  &  L+,  2 2@4@`2` $4  & $@&  *? 4 8`& 4 <& 8 @`& < & @   . bsd_decomp%d: bad sequence # %d, expected %d bsd_decomp%d: bad CLEAR bsd_decomp%d: bad code 0x%x oldcode=0x%x max_ent=0x%x explen=%d seqno=%d bsd_decomp%d: ran out of mru bsd_decomp%d: peer should have cleared dictionary 㿀'L'   ''&`  ` '?`% ` `$@*      1>)! V  4  >cT   4H /* '>H`8` 2`H 0 $$$ 4 *- ް % %H /* '#>-cP   )ycP%>O @" > !2`  * >H`8` ?"` $cPH 0 " %(%$%  5  %`$   "  ?+  % }.. .  '!W'`R''*@ F'0@(@'a@#'4@@ @`` @` * E>) @"'#' @  @@@*Ȑ +>)"( ‖>) "Xz- @   L,` @   '* >) "\ @ <| & $ >cT   6 H /* '>H`8` 2`H 0 &&  & 6  ( M& &$H /* ''>-P   (|P& >O @" > !2`  * >H`8` ?"`  $PH 0  "  & (& $ &  6    @  $  @  "@"@    ?&" ``,` V*  P *@`,` *. "J :F ,@*` P,``   @ @ :"@ *` P*@ -  X * T23 #2T3 2" $   L*?.-   2  `' ", '@`2` &$  $ $ $@e$ "  D >) _" D H`$ D  <$ H @ L`$ <$ @ @㿘@(`  㿘E 㿐`29   23   2/   ` 2*   & 2` "  d   >+& #& 8>+#& <#\ ?   @| &  H@$Ғ 0   㿘@   㿘$# @  2 ` 2 ` ` 2 2`   2 ` "& & & & @ɐ  㿘&@ z_compress: deflate returned %d (%s) 㿘  *  #@``&@4 >cT   4 H /* '>H`8` 2`H 0 $$  $ 4  'G i&@$ `  l(8 H /* '%>-P   &ΒP$ >O @" > !2`  * >H`8` ?"`  $PH 0  "  $ ($ $ $  4       $ @  "@  ?$` `6   $ ` $  , ,, ,@: , `,$`$$`($`$А"@$`( @` $@  $`  "$` "  >,!>H 8->-`@L  `0>,! "``(  ` 2`(" `($` $`" `( ې` w $ >cT9  $ 2`H /* '` 5`H 0 "" `"`2  &k$ J' l4$ H /* 'P   %P$ >O @" > !2`  * ` ?%`  %PH 0  "  $ ($ $ $  4  $`$      $ @  "@  ?$$`( a`$`$А"@[$`( `($$ 6@ 2`P " @`P`T$`P`$`T@ "`X'v&@`X`\@$`X $`\`H`L@$`H $`L㿘 H&@ L&` P&` T@&`  X`&`# \`&` ` &`&`+ &`2``@%`&`㿘`24   2.   2*   ` 2%   ! 2`   d R  >+& $#& 8>+#& < @M  &  H@" 0Ւ  㿘@! ̒ 㿘$% @  2 ` 2 ` ` 2 2`   2 ` "&  & & \& & @ܐ  㿘&@Ր z_decompress%d: bad seq # %d, expected %d z_decompress%d: inflate returned %d (%s) 㿐'@ `` ` ` ` $@?* `` *    g >.T"a $ >cT   4 H /* '>H`8` 2`H 0 $$  $  4  %+ "8 $ $H /* '#>-cP   $xcP$>O @" > !2`  * >H`8` ?"` $cPH 0 " $($$$  4  $ @  "@  ?$ `6   $  $@ ---$$@ @"  $$ $( >.">H 87>-@    0>,!ݭ% "(  2(`" (`$` $` @` ( Ґ$(  ɴ -$($$ $($ @ >cT  $ 2`H /* ' 5H 0 "" `"`2  $$ [H /* 'P   #P$ >O @" > !2`  *  ?%  &PH 0  "  $ ($ $ $  4  $$      $ @  "@  ?$M$( ($@$ H@L@$H P$LT@$P $T'@%3 z_incomp%d: inflateIncomp returned %d (%s) 㿘`  *  #@>`<`:` &` & ?&   ?& `& >0!0@  "@    0 >,!ܵ0`"  X`& ` & `  \ H& X`& \ L& H & L㿐#\   @ 㿘 &  ?   2t? 4o?``  h? (  2& ^?$@$`$`( ,$`$?$`, $`H,$`D?$`L`H @"Ӑ $`P (`$  $`0 (`$  $`8 (`D  $`<" ,$@ (  `0  $``8  >`< 2 $`|>"@7" ?$`,`\$` "$@@ $@ @`+ @  @$@ 㿘 ")?  "%? "!? $ 2& ?& &   . , $   $ $    * q$  $ @@M   2`* " (" 㿘  `8  `` $ & ` $`   & "@& `" $``$` 㿘 ` 2@? 2 `` >"ܰ?$`` 8>  *& ( |?* (:` 8 *   @!`  q& $   "  ` "   |2   q`& `2v  " ` >"?k$``  ` l `` "`2 |"&  | @Ғ @ 2L ` "H `.`- "(`` @ q0@ C0 @  `  D <*  2? D <@*`A` ` |&  `2   2  $? c '? &  `?㿘   2 0/?`" 8 ( $ $* 8`" < ( $ $* <`"  ( D $*  b  (  $* ( $&  㿘   2  "$ ` `@B$` @$$ 㿘 $ D* & 4 <*`@2 D <@V*`> |p*    |& x*  |& *    |& *   & t& d& T& l & X& `& @㿘 t 0 d $> p   0 p  8 , d@ 1 @]@ X@ @S@  M@   6'@ /'@ ('@ !'@ '@ '@  '@ *ɴ'@!  ~' h  @ (@ ?2@㿘 $ 4 l d"  `72 $3?> d@ - 0'@ h D d"& h"@ T& d <"& T*@@ "2@2@ 8*@@ "2@2@2@ %  0 d l@ ے@  l@`& l 0 d 0 P @ d& @@ `*  L & @ l!  2 4㿘  & p l!  l!`"  " T l   @ d 0 P *@  L d@ @  ,& @ <*`  8*2  @ < f* 2 " X d $"@>@8 X ̒& X X l 8& X XH d h@ "  l X x " (& l%& X d @ 0 P & d  L*@  ,@ @  d& @ <*`  8* 2@ @ < f* 2 X? & X d d X 0 P@& d & X @ & @ `*  L & @ 0 d @  l d& l & d "h l T`&  0  d T @#  d& T  2S l `&  0  d T@͔#  d& T `?㿘   l!  l!`"  " ` l ( X @ d 0 P *@  L d@ @  ,& @ <*`  8*2  @ < f* 2 X  h& p& \+& X x@:( p d $"@>@8! p & X X l 8& X X`8 p  `2  p d h"  ( p& X p(S ` X N \ d l`"  @ l p`"@& l?& p d & d @ 0 P *@  L@ @  ,& @ <*`  8* 2@ @ < f* 2 p? & p& `& X d  d& d T`&  0  d T @#  d'& T& ` ( d 0@ @̒ " d T`&  0  d T @#  d& T d l & d& l  2+ l)   d& `@ l& d?& l   d 0@ @ & ` T`&  0  d T@ǔ#  d& T `?x  >"X>" >!X*  +@6 >"  * +  *>!X*   >">#4 >#X*  +@6 >#4  * +  *#:>">#4 >#X**  ?+@6>#4 ? *@+  *ؒ  2 ?  >"`2`` 耤  7耤 ! >"`, @2`` ꀤ  7ꀤ!! >"`, @2`` 怤! 7怤!> "`, @2`` 耤! 7>"`!@Hؠ  >"4`@ 4@  `㿘>"• 2="& &+> &+)&+> &+$*t&+(> 4&+0"6"&" &"&@$t060 t060 H0t60t 2$""""㿘..H<TP+/  (`/ TT.@/`@*  / / / T@ .@ .  @ . T.. T㿐@`` '    '2k4@ 62k4`L * +T* 2   <: "",kT,``*   @ @ 2` .` k4@ 2k4$@* @@"@ & @@@&<Ѫ` E-.`k4 2.`k4 .` k4?2k4`*` k4? 2k44 ?24$".`+4`,T *   "  @֐&@@&4 `2?x  ش** 3   " *  4 * 2 @H 6 㿘? @` H@`  L& "=&  P@ " 2`  & * "+T* `  H 4*&`   P""  & * "kT"kTkT,`4 * `?& @   " &  値&` H2  :   ?  H L P +X+  T?&+X|&?&* +X"+T?&* "+T, *,`@4   @ ` **2 , 2 &+XR  Ȣ`L & *+X "T&+4㿘?     * ? @;0`@"/`@.t0t .t0t* 6*` 4**6*6*        `@ʴ㿘?       c  *  "R. * v"@$tt.@6( &0( &"@>@6(6& x** v"@$tt.@6( &0( &"@>@6(6&"@$.@6( &0( &"@>@6(6& .@6.`( &0( &6`"@>@6(6 4N"@$.@6( &0( &"@>@6(6& .@6.`( &0( &6`"@>@6T(6L"@$.@6( &0( &"@>@6(6& .@6.`( &0( &6`"@>@6 (6&           㿘+: + 6){+( ># @* *v ? 4 @  * `@$ 㿘"` ~"*  *  6   2*@   & 2 *@ &  " : 6  ?~ * @6  &"` "*  *  6   2*@   & 2 *@ &  " : 6  ? * @6  &"` "*  *  6   2*@   & 2 *@ &  " : 6  ? * @6   6&" ">#  @ * *v*  6  *@  & 2 *@ &  @:6 ?* *v* @6 &՚` )㿘"  .   6   *@   & 2 *@ & .2`  " :@ 6  ? . @ 6  & "* ` @ &@㿘"     `*   & 2`* &  6 ?&  "`& @b   ?& 㿘"`   +   6   *@   & 2 *@  & " ;6  ?  * @6  &>"`"d #@ d +  6   *@   & 2 *@ & #;6  ?d * @6 & ` @& "b " 4a`   +   6   *@   & 2 *@  & " ;6  ?  * @6  &>"`"d #@ d +  6   *@   & 2 *@ & #;6  ?d * @6 & ` @& " &㿘"  & `? 2@lO+L+Đb  b 2` 2`@      &&  `0x@ 8"` ` +   6   *@   & 2 *@  & " ;6  ?` * @6  &>b`>@Ӕ <""` ` +   6   *@   & 2 *@  & " ;6  ?` * @6  &++ `Z @) "`@& y` @b  & "6 㿘 "*`2  "`* `& . ` .2`b  & >!X !*  ``2 >#X >#X>`a * `>#X >#X>`a * ) 2 | )"/%*  > d#4 T"@.`@ `@``"b 2 @4 4  "  `?㿘  >X **/ "@@$.6 .@ &0( &"@>6(6&>X*  "@@$.6 .@ &0( &"@>6(6&>* +>X'"@@/6 .@ &0( &/ 0"@86 &/6&3  * @"@@$@@.6 .@ &0( &"@>6(6&>4* +>#"@@+6 .@ &0( &+0"@86 &+6& $ "3$b.6( &0( &">6 1$"(6&$& `` (`` 2(``2 `?*  0`* 2  b * "0*"2 " b (  " 02 " "*@" 0 *"2"㿘ڐ" &  * `& 6 `* &  >* `& 2  `* &    @*` & 㿐 "?  2& ?&  & ` ` "@  @Β 㿐 "? `"? $ 2`? @  (  $ &  㿘 2 (1?    )& "  `"   "`  ( ʐ?"    >J#d @*  "` ?㿘ǒ unknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data check㿘 "? ?   `>@ *`  <  t   d   `ђ &   &  @ "` & ">?# 2   >?"#ؐ "  ? & `&     & ">?#   * @ >@$  $  @Y`      @~ ` " " { @̔ `   "@ "@ `_ &  &    * "`&  "@ `L &   &   *` " &" `8 &   &   *` "&  "@ `# &   &  ` "` &@  ">@  & $"` " ? ?`2   " ?" 㿘` ?@㿘 B?`2@0<  "@" `21?    0 2  #  $"@$$ " )$$  "@?㿘 8 " <&? 8 `(  `$* 2 & @  @ @&&  (& $ 8& 4& 0 & <㿘 (   @   (   & (& ,& 8& <0 ( $ @ invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeatp@` $ 4 0 "? ,"  ` >A#*`    @  < H ( | ? *``  & 4  "  ) ",44 `4$@ &@Ζ@T  & & $& &`@?& & 4&4 &&>A"&`& $& &`@i?8? *`` <2 ?# @ >A&"&`& $& &`@K?&   ` z&  `& $& &`@82=  , ` 0 ( @ "?"`2+ & 4@ 4 0 "@? ," , ` 0 ( @ "?"`2  & $& &`@ 8% %@" &   2 &? *``  ?, `& 4   !&>A"&`& $& &`@?@ ( `(`    & & $& &`@?& 4&  &  2  @>  z? *`` 4  *``* " 2  @ &   > *  * "@&  &    @'  ?"&& $& &`@\&  &   4  `a x> H @,  0? *`@ ,   * @`  `4 $@ * "  K&   ?    @  ? *`@ 4$@*$@   4 @ 4  ! @    &>A#&`& $& &`@?2  * ?* " &    4  `a *  @& ''  #\#` !4  `@`  ?"&& $& &`@@z 2`(@e@b& $& &`@?  `$*& && & & $& &`@`$  &`&@@n& 4  @U @3 @0@` $ 4 0 "? ,"  `&  && 4@9 0 4@  4& $& &`@K && $& &`@A & $& &`@9?& $& &`@1& $& &`@)& $& &`@!& $& &`@& $& &`@& $& &`@ & $& &`@?`$  "`"@" 4@㿘`( ( ,`$" `(`$ @ 㿘04@7? 3?@`,$  8<$<㺔`$@&`,$0($0"`〤@$$$ &`@ `$  &`&@$42?" 8'H'P'T''''''''''''''''\`*`   " H2 "  , @   , @* ,`@ ,`@ 8 "   *, @   .,`@ ?"@  ' "@ `   ,  *`#`" H`@* '? 'p  p- "P-#@%/"- @ @*"  `/ '(? '  p@}?" "%@"//'$* @4@ , "  "4`%/H)    /   `/' "T*   P/P"*  '%4@ /,   "@"`* @/@@4 @@/? @ "  $+? @  P- `2?oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths tree㿐#\#`    ??>F!@ & @>F!h&?oversubscribed literal/length treeincomplete literal/length tree㿐!>>\!T`#\i#` ??>F"-$ +@@?>F"($$ #\#`,` >>"HK ??>F "2 @@?>F"($ @@0 >>#D ȅ(>   " "`">"Ā [>>F#\'h>F#'l'px  "<" ? x *```"a ax *``a"a >x *``a"> "#Ԑ##\H#`x! !>>!T>ؚcܔ   t"?> "#ؐ##\H#`x  >>"H>c> "b>>cԐ?"&>#&@>#&>#& 㿘  `@`$`(*  㿘 (    "* * " " invalid literal/length codeinvalid distance code㿘@` $  4 0@ " ? ," > H` >G"*`    x ! "$ #x $ $ $!*` ) & $& @&``%  &`&@& 4    @@` $ 4 0@  "@ ? ," 8 $  $ $ $  @ *`a *`@  *  *   4 $@ $  $  @ $ $  $U   $$>G!&`& $& &`@Y? @ *`, *`@  *$@  4  $  $ $  $ @ *` *`@  *  *   4  $@ $ $  B$ @2 $ ;$ $>G"&`& $& &`@? @ *` *`@  *$@  4  $  $ ( #@ " ,"@#@   "$ 26  ,@   0 ( @ " ?" 2$ & 4@ה 4 0@ "@ ? ,"  ,@   0 ( @ " ?" "& $ ?+@ ,` ( ? $ $ 2=  ,@   0 ( @ " ?" 2+ & 4@ 4 0@ "@ ? ,"  ,@   0 ( @ " ?" 2  & $& &`@[ ?+@`}$& 4@a 0 4@  4& $& &`@B $& $& &`@8 & $& &`@0?& $& &`@(& $& &`@ & $& &`@& $& &`@& &`@ & $& &`@?`%  "`"@@ " 4㿘`$`( 㿘 0 4@`  ,"`8 " ``"&`@&` 8 <& < ,@@ 2)&`  4  (& 4 4`" 8 " ``"&`@&` 8 <& <Ȕ@&` & 0㿘`$`4`0` 0`@'`"`$"` # `, >H>G. .`( ``(( `  ? 6 @. `6j @` @.``  6(``  (  `6: @`@: @(`@   @.`" `(& 6&?. . &`, !. `(?. :!`@2 #.` (0`@'`"`$"` #2?`@` .` (` ? 6 @.S>G#0`@'`"`$"` #?!` ^`0`@'`"`$"` # '##"`40.95Pbuffer errorinsufficient memorydata errorstream errorfile errorstream end㿘?#6 `g "c. !#?`E& @``@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`` @`@ےc@גc񀦠. tun%d㿘 >L!8>'   4@ >Ka($+$ <$ >L!$ | 4 4 5, 8$ X$ L$ T$ H$ P`>c$  , : (  ڠ ā㿘%   .  * * >' @   2@  㿘 . d @*`@*`>'@ @ ?# 2@ H /* '     $ $ &  ?$ H 0    4 ".$$2*$H /* '  4 @   2   2@   2H 0$ԃ  4A24?2 `:??@2/`" 4"424" `" 4"4 24" `" `"` 2``2@ 㿘 H /* ' !@   !  !@2 H 0㿘 >L  @ $ t  $ x` 2  `?"   ?"  `` ?&``&`   , `" `` "`` &``"@ ( H /* '  @  `$ H 0 X 7 2$ X&` 2" $  $  $ H 0 P ` $ P``@$ ``@?# @6      Ӌ   *  ((>' H( }@Aw@"g@B0a\@"@0[ v@"L ~@"0O [@K"@ *<28J"H" <282HB""  ;2 ? "  02 ?+2 H(""H0" "  " "H  H tunread㿘  հ . * * >' @ @  ư @H 0H 0 #H 0?# 2@ H /* '  )>M!"X$      $$& ?$  ! @4!"X  "H 0`]`\ >H 8>#P @ 8 `Q  ҔH /* 'V *`@`?2`H 0   "&V H /* ' >O @"@> !2` ?* *   >- P"@  "P $ H 0 V *`  ```" ``L $L㿐   `>'`. * *   ( >cT   6 H /* '>H`8` 2`H 0 &&  &  6    d 7A 7'>>#P>H 8``5@8&  &$@` & `ٔ   6 H /* '  5 H 0 &&  & 6   Ġ l"`  "LL i$L"`"`( 3 "" ?" > a N /a H /* '  @   # H 0X `C$X0 7"  2" #a>H  # `# T,@ T"T>O>  *`4 bH: H\ $H @$\H 0㿘 . 7 * * >'` H /* '` `0  >H 0 #pؒ0 H 0  H 0 bridge%d㿘 > "( >Och d$  $ $@>O b$%$ <$ >Q#$ |>R"$  5, 8`>c$  , : x >#pH /* '0!C@զ 0!A@"`  !@10!@@  070!E@0!F@"!`- 0 !B@ 0 !<@0 !=@v 00 !D@"0 !H@ 00 !G@˰ 0 y  "  ,    8   4 +ؐ@R /%  44 47  ܐג  א@< / 4 4 47  0    2  2&`  0` &@`" $``&`$ , ``#` @  2@`" ,` @``"``@"@@` ```|z @v 4 @<@nܒ g 4 @c 2@_Β YL "T  , L "!@  "D 0B < 4 @6 2@"20& )@" 0$ >V!s$` `rԒ0& 4 @O 4 @H 0p "` `` 2 *`, &`, $,Т` $ @B /ߐ  @<`/ '` $|@ `$`?܀ &`,* &` 㿘 4 @6H/` / 2 4    & H 00  *"@ 4 @4 4H 0  >aX!>V@!rE㿘 4 @9>V!rp "/ 4Ho o ,`@"` $ " i ?$`c$\ $H 0 4 ?6 4㿘` X  ` ,H /* '@ " X `K`4 @"C@@6  T 沔  2  T 0& T 2 P `  "$@  \@  P ` & P`@& `$ `` 2" "``" `` "``4$2@@ @`2`H 00=0  4 @2   H 00- @  T`& TH 00 P ` & P`@& `&` 2" $  $  4 d$  @H 0 㿘 5'L, 1 .H /* ' 4 @  H 00Q>L`$ t`` H$ x \$ H   @f$ \ 2 `H 06L ``?#@  ` `   @ @Lc@ Lu H 0  L "<  4  H 00" 4 2 4 2  4 ^2  4H 00@    ^ H 0L@L 2LL  # H 00H 0 2 H 0 `d @"`d'LH p@``4 @2 ` H 0| `@  T`$ TH 0l L ?"  L ?"  LL  " "   'LL` L` ` "`L2 T  :$ T@2@`2``2``2``2`` 2` ` 2`  P ` $ P@$ `"` 2" $`L`$```4$$``@H 0  @ 'LH p@㿘  2   ?"   ?"    ?& `&          & 2 Y 2@2`2`2`2` 2`  2` ` E `00@";4 @"7@6 `T 沔  2`P`T $$`T`` $`P @$`` 2"`h &`h" ` 2" "` "  ` "` 4$2@  2 b 㿘H/` /  H 0հ @ ,@ 2a   @  H 0  ݔ   H 0   $  , , ,  , $  "  "   $   & H 0H 0 H 0} H 0u H 0m  @  " ' /  "/ H 0S (   @  j  Ð V $ , , ,  $ $ "'   & H 0+2  @  B   . $ , , ,  $" '$   & H 0㿘H/` / H 0- H 0% H 0 @ * @  @   H 0 'ކ 7o  *`@@ (  * (  2 "@ "@(@"" 2`  2 "@ "@(@"" 2` 2"@ "@( @"" 2`  㿘H/` / 2  H 00U @ H 00JH 0@EHo o  @ H 000H 00) ,`@"`  "$ "@ ?&     @ޔ瀢c$ H 0㿘H/` /   H 00= ,`@"#`   `? * * "*  $ " ?&   ޔc$ H 0  >aX!>V@!m?㿘H/` /   H 0& 2 ,`@"` 2 $ " ?&  ] c$ H 0 㿘H/` /  H 01 2 * @ " @+  2`"  "` "@ ?&  H 0  H 0 㿘H/` /   H 00$ ,`@"`2 $ " ?&   c$ H 0pH/` /` 2 `&`H 0` " `* @*`&`H 0P ,* &`H 0D H 00<`,@ "',* ` '`   ސ  ڔ  /  (/`@ 2&``( $`,* &`H 0 㿐 >Ba@ 1' / `  ' Y '& |    v ?#*" @ @m  i e( _  沔  Q'`  '  H'<  2B 2 <(=    ' 3  @U.6 *  2*  @   $   "  ""@ >B!` "` @     R` ` "``R`6`   R` `  "`  "``R`6`  @  @  @  "J " ` @ *J@@ `J@`@  "  J   `?㿘  ` @A 2 @:      2 `  ``>  @8@    @  ` 㿘@ V`  ` ` ` @ "``V` 6` ` 2 @`  @  @K@J@ `@ ` a` 2[  :  4#@,`:`` V`4 `B <``2` `@ /@  "` T4# ( 8         2  X    2 @2` 0 ` 8 ( :` ?2" " ( * 㿘@ `   LJ  *L 6&& $ *`:` ` ``V`8`   @  $ $ &` &   2& & &  rn_addmask: mask impossibly already in tree㿐 >2!@ " @& >#>c j`!>#$@d@#@ %>L? "?%>$@4 !>>b6"b>2!tu ," 6$"@"@$">2*at@`  @֔ 2 Y`W %>2 6 0 M  0@`0>#>2at4`  >Zl`@ 0/       * $L` :  >L"J@2 $ $* <6   .  @ 2  :  @ `  * @ Mask for route not entered 㿘>7c䀢  "c     >Zc @   6 .  " & & & $Non-unique normal route, mask not entered㿐 @   2 ٰ  < =  ,:  @뀦``"V U  x   2 2`&  ` . `&  2$ $  & $`& ?6  . ` &  6   @.  <``:``T  6  .*`:   " T &  2  H $  2 ` *`: V 6$@2V$@$`F-T`:  $ 0?  & ;& T`@2),: V& 4# "  `  >[`@0א  Ғ 22V$rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Mask㿘K   @4 @ "@@ 2 ` Ҕ "  "  2  `"P K     >\`ڰ   >\`4 "@>7c"""c ? (" V V`: 4" `V`2  " 2   >\[`@ 2  2  < 2 &`2&`&``  ` 2``  "`>\1`p ` p &`&`&` & `&`&``2"`"`" Y" ````2"`"`&@"0 V >72@"@ & ? " ""䖒` >\`>\ؘ @"  &@&`&` &` &``&`"``" `2"`"`  # `. . #㿘V  6  ` `2  "   V  6     @   2  "  㿘  t9  &  "3 @ t&># , \" "   * * >`2$ \"" "  ">c"" >[`l$ >\`$ >Y`t$ >XcH$ >]a$$ ($rn_init: radix functions require max_keylen be set rn_initrn_init 2㿘>$"` >2`(4"``2`(!>2!`*` >]b0)   #> $c>]#(!*@@ c! >"#> "#?* **>2!tr >]ǐ#0㿘  > 7#># "$    4 4 >Baa $a" "a$  㿘 " `"  "` "@ 㿘   >B 㿀'H'L'P'T'X>B! I` @@2@ `" `@28  "  @ɒ 2.  ` @ 2$` 沔  `8<   M`    2 ``8  4`  0 raw_usrreq㿘 ` `| -    n -\`g.`>^#|  { { {P {P {P {P | |$ {, |4 | | | {, {P | | {P` M I "F 97C "> 9A0 8 1 8$ + 9` `€ " $ #Ȑ   2   2   9`& >^#5>K 㿘>$"  "  $* €  2 㿘l>["(㿘` `@  `4  @ &``  2   h>[ "('̓*` H /* &  6 € @"/>$ ` 2+>$ @"' 4!" 8ʒ @њ̢ " 8'̐ 4 8  4"  ` 8 4 8>$b`  "` ` А@, $'Ԑ @OH 0́㿘`  `@  `4  @ &h>[ "('̓*` H /* !  1 € @"*  ` 2&  @' 4! @c̢ " 8'̐ 4 8 $ 4"  ` 8 4 8  >$b`  "` `   А@ $'Ԑ @ږH 0́rtfreertfree 2rtfree: %p not freed (neg refs) 㿘 2 8>`_!?6 8*  + 4 ' ">.>`N!!V 8"!>`!0 D`"  ` ?@  "`    ifafree㿘 2 >`$" ? 0& p 8U 37 @  0@j 2   D  2 A`. "  " 4 (  4  2 "  @ >$">$" 4  @p$ 4  A  ``'@X`>$b "b $А@ޒ $'''' @ -㿘` `   C    K{  2  8 ?6 8 4 "  D `@2 D  D "  `@ ޲ "rtrequest delete㿘H /* !>[b(` * @ Ұ / 2   T0A`0’ 2`    >a"  4 x ?` $ 4 T 8  84 8$ x D` >.`  >.a` "a'@T 8  8`4 80" @ 2 D}  0 4 H >  :  m 3  |  d 7@  $ 4@f ~( U 7 @ r  2`  x " 9  ~ ~ 00 $` $ D` $ @@`P$ P`T$ T`X$ X`\$ \``$ ``d$ d`h$ h`l$ l`p$ p`t$ t@$ |`` @`'@ 8 4 8H 0㿘@ ?    ?    0 "  ?  8  (   |  2 $ * Ȑ @$ 0}  x "  4T 8  84 8$ x 4 2 $ x 㿘@ .@ ` .@  `  .@ `@ *@ @"rtinit: wrong ifa (%p) was (%p) 㿐 ' `)        8 D?@ 4 8 ` 3^ A  Y ````   @0T 8  8`4 8"`28`25 "1 8 D?%4 8>b#ؒ D    D` ?: $ D"` $ D $ @   &   @㿘` `  { $`@p `    >O` ?"`  >O` `?"`>O` `?"`>O` ` ?"` H /* !`  >#p   F `5` 2   |b H 00+  >O`  "`  >O` `  "`>>O` ` "`>#$ >O  `" ` @4`H 0route_output`'H'L'P'T'X 'İ@ `  % @2` 7` 2`>d XK('`'i  za  '` 7 U >'U +cp L0&@'Ԁ      @ 2: 7 '  >#p`'` "* ?`$>d"@*`  ` ؀ܐ İ  Ā$ @FP 82 8" Hؐ ךİ  8 $7 8>[ b(* @  / ܸ 2 8ݰ  7 8 "    [0Ā0 ' 0' ' H' 0 @ "' ' D' 4 "' D ' 06'Д @Ė   y  >È{, Д@  4& P&$ T&( X&, \&0 `&4 d&8 h&< l&@ p&D t&Hy& ؀  ? m E " "` 耢` ؀   "耢 : 2 ` ؀ ` 4 "#$` `"$ D "  D  ؟ D` ?& ' D"` ' D`  '` ' @$ @] P D "   ؟ 2' H  P* ' P $ ' P - "& @& "`` @ >O , 4 `zz ﰐ0!  @^zm 26Ԁ " >2#*>c(>>n 6  `" `" @`" `" ` "  `" `"` " 㿘@  : " "  ? @ 㿘 @H` @  T`Đ  3`l8 l" $@@` @4&@$'` " `C@& @T`B  l l" $@@` `&$`rt_msg1㿘 Q A`  ` ` L`d  T L`d(& >f<!& &   @h" @*@&@ ?   z@  5- -  㿘 &@`  ` ` L  T L2 "` @*@&@ ?    ``*& %  $      "y*  w  $ $    $  ,,4㿘>O , `H @"`"`@ "` >#( 2`2` >c(>>p>O , А@魒 $ "  8` 0 D4 V 4 /$ $ >c(2`>>p >O ,c`  +>c(@酒 $  ` " `    @' '` '`' "<` 02` `$"``"`"`  ` `"%`' '0'ؠ "` 024@""" "5  5 c(>>{``Ёp@   4`@W@ $ ' 0' ' H' @ "  ' D' @ 4   D ' Д ``1`- 4" t" P"$ T"( X", \"0 `"4 d"8 h"< l"@ p"D t"H @ 02"""А " ` "`&`&`p@Ò $>M#H"h `` 0@2\   @p''``G` "D` 084 T4 D-$ А" `s 2>.` @ 2*` @'` '`B'````"``  02` `"``$"`"```G "`&```Ѐ '''2` x  d `_  @G '' ' ' 'ܑH /* !&  0 >["( .` "` 2 `>gc (ؠ  ``.`0LH 0 w> @ '"&䀢   0 *` * " @吒 &route㿘 (@. &&X*` "@&$, & . .  6 㿘 ( .@Œ'@'h'@@`.`"* * ?*` "@.`"* * $, & . .  6 㿈 @@ `?@  ',@ `  "N @ &` `@2``@2  `@ *  @/@ &` `@@ ``@ @ `@ *  @ @ 2& &` 2  ,2@&"$@", ` @@2 ` ,``@``@<  @   ``?@X* ސ` 2  `@L* Ґ ` "``* 2` 2`, , , ,  @`" * 2  2 , , , ,  `@?#,2  4, , , ,  `@?#*2  2, , , ,   1>j!T-    `` \@Z`2`` "2 ` ` "2` `` "@ 2, , , ,  ` 2 ``耦$ `@ " `@. @.@ ` ," @.@   "& @& 4, ,ޒ     & `Ք `.` ` p.㿈` @#\@    &  ? ?$  $@㿘p\"4   ` `8 / *`" *  * 'h? # @7   @ * `+` @ 2 * @`l@ޠ r6   ' '@$ '  @ @ `  "  $? ' $ ` ? # @7  ``/   *`" *  * 'h *  * `@ 2   *    0 "@ "V  @"@ P"  *     * @2 2  *  `2    * @ 2  ` 2  `2   *  @"   "  `2   *  @"   " " `2     * @ 6   `  6 & @ 6 @ "6 @`?# 3  3  ; 6'@ $ ? `7  ' enc0㿘>K#@ 4`0`>lQ`0$`&$`< 4`4 7,`8>l#H$`>l!D$`| ,`:,`9X`(   8 rw @Ӓ 8 ($ $$ ` ` $ `  "` "`>K"# # $ encoutput(): no HDR㿘` 2>L>l~!0 & t  & x&`4 @" P4^ [ 3Y A P ` & P`@& ` > J /! H /* ' @ `"H 0/ 7&` 2" #!"  `">HT,@ 7)"T>O>  *`4  Hِ  H \ & H`@& \H 0 `&"`T  @ 404 㿘H /* !>> #!>laX@f#W >N#d`#>L` \@`8@ `2`H 0arp_rtrequest: bad gateway value arp_rtrequest: malloc failed 㿘`0>㸀 `L >L " ">l>aX#V `4` "  `0"+ `02 `4` ?a&`4`4a>` $`@`0 8,``@ 04`>L y&`\@" `` `@ `` @o@ `   @  >m`H0``@ 8,``@ 0 Y4`  q#  &`L >mp`p0L>5 `>"#`@o#"$ `4$&`4>Ncdcd $cd" "cd$ ` `D `H- &`\`@ ,` ` `@ ># >S h&`@>5`?"`` "` "&`L`4 ;&`4 "ri 㿈  5 % %  H% @>#( (4`  4H(4  ,  , 4  P V ` / / | arpresolve: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 㿘!>#(= " //  ^/  / /  r/ `"`L @ 2  `2 `\ >n`hZ ``0>L @( 4  2  4   ( 0C 4 2@  "$ $ `\  >n >L &`\`\ ", `4 ?&`4  >L`\` "  >L &`\ >c   $ `D@ 3`  `4`\>#`&`4&`\$  arpintr㿘>c L cH /* 'c  $c$ " ?$ H 0 >n 2 >n"耣     *   h@@2 >u >c arp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp info overwritten for %s by %s x`` `a``] >N#x @ ` 2 `<  H `<`2` z`" H`H`@ܔ  o>c(@Ք   !>o 8@U' 0\'!>o@H pĐ xH'ܔ @ @`? A =09  `@ᝒ !>o @' N ,`  ` \ >L >c $\4 ?$4 `%  |% 娐0@  `` ऒ @d  ``  0   `` ܒ  5`(5`` ऒ (4 / / | arptfree㿘 2R8>p X  0`  `   *`& 4 ?"4   W arplookup: unable to enter address for %s 㿐> *cc , $ @ 4 ﮒ 28 4? dd280  "L` '!>p@\    -㿘`H e >m `&`a6`㿘      *   h@@0ܐ㿘   /  >0) '0%#  > #Ā@#>c > `@z   >` Ҕ  >`͔  $c>ϐ 䥐㿈  4 % %  H% @ >#(   54`  4H(4  ,  ,  4   P Z / / | revarp㿘># >- "#> "c >  >q>XP2 ˗: #>??>c` "#> [ W   3㿐Ȕ[NULL][%d,] 㿘 2>q!H>qʐ!P >q%>q#>qX? a` 4>q!h ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d 㿘 >q!>q" >q"   >q $"  la_rt=%p la_hold=%p, la_asked=0x%lx 㿘 >q   p"rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p 㿘>q#< 4V 8 t>q \5#>q2#H^ >q-#PY >q(#XT 0>q @"#` @`">q>q#p`>q#x>q D#t D>q #9 H x>q L# L Route tree for AF_INET (not initialized) 㿘>["0>r >qc 0>r Ё >) > 㿘>   2  $    2  8lA    >"`"" "`$ 㿘>     2  8l!  & >`&& "`㿈'H'L'P >Bah'T  "ah'X ah`&0  `  堐  &  & " @:&  >Bh`"0  "& @&     >B0%>B0!h`  &` 4  2Q " " 8 @"'K``'>N#x  ' t <`' `Y `2` 2@8 ? " .&`@ 2 &`>)"#``'  ` t <`' `2`0+< 8 " '``5&`0!`'>N#x 2 ' t <`' ` 8 >s! `2+@8 @"% 2`? *  0 `(.G&`@ߓ &`>)"# &```'  ` t <`' `2`0>B!h "4 < 8  2d2` ?@>N#x`` ``<`2` `>N`0& >N#x` ` ``<`2` ` `t`>B @ ```2@`z>B&`ah` "`` "` o m k&`  "f d !h "4 ]< 8  2" `b"0N?@>N#x`` ``<`2` `>N`0& >N#x` ` ``<`2` ` `t`$>B @ ```2@`>B&`!h `" `?`>t!|*`  ѐ ѐ ј ј ѐ &`@)K㿘H /* ! & 8 ?    4 2& Ґ@ -E& @ޑ 2& >)"#& H 0㿘    8 ?   4     @ 㿐>) XH /* !"'>N#x  ' t < ' '  3#>)  ? $   2     @H $  $c  '   t < '  2 H 0H(>   2   " "  2 H@ >cXis   4`H /* '>H`8`  2` H 0 $@$``$`4`   9>G `$` c$` $`*`2`2` *` "` "``` `$` $` ,,  $ @84 4     " "   ' //@ ' >Bah`  "` >>Nx`" `,`( " `<`2`, >Nx`"  `4`0 " `<`2`4 <  8  ?      *H" * :Hin_control㿈 >N#x      < 2  !@".  !@"D  !  !@z !@6 !0!#@ 0!!@q !@  !0!%@f !    ! 2 < H@  < 2  !@2  " 1  B >u#_  x hV  7@ڮ x$ <>Ncx`$ @`" <"`$ $ " & D$ T$  d$  , d4  , T , U$ $ t4 / >2b )"b   T   `   2<H`@<2   "  3 1 !@ !@"N4 ! @0 !@x !@0 0!"@"#4  !@0!!@ 00!#@0!%@0 D$` H$` L$` P$`4    T$` X$` \$` `$` d$` h$` l$` p$` ٰ  T' X' \' `'`$ T`$ X`$ \`$ `  $ T$ X$ \$ `  $  ͔  T$  ǔ  4 2` $ T`$ X`$ \`$ ``@ $ h$ 4   E   2  D$ H$ L$ P $ H@" 0 @q0$ d4$ h8$ l<  h$ p$ 44 "  ! 2 @[ $ T$$ X($ \, $ `  24`"4@[ 4 = ! 9 $ T$$ X($ \,0$ `@0 ` "`&  "@ <`" @ @"`@>N"#| @ <"@ ?  $   - 㿘`  4     `?# @6`㿀H /* '`D'`H'`L'`P'&`D&`H&`L  &`P  a  H 0&`D&`H&`L^&`PH 0&@`D&@ @ 0? @ ??&`,`4``,&`4&`h &`,`,`d`4 @ &`( @ {&`0@&`$4  `4`0`,2`(&`X2 &`8 @  &``U    ꆔ 2T4` 6`T4 @8 '@\?J H``4K` >MH ` "A  "9`2.4"!84"0X"* 0"& 824"8X" 8" 0" (2  ̀` 2  xH /* !>N#x   <2  t  $@    2  $  _&  6e  2 @H 0W &&  & >N#x  <2 2 & g 6H 08 t & t "`"tt&  / /@'`  a1؀  ` "`  "f 6H 0  H 0xH /* !  ? &  `"  "`  "@ / ' a2 ؐf 6H 0㿘&&  w & 6 (0"*`0>0 >0`H(00(  @ H(00( @* 㿘  d͔  V 7@% > ", > "$ , > "$ 8, H /* &@$ $ ` &`@" &@ 4  6 `  `* @  $ 4  `  `* @"  4  6 `  `* "@ 4  6 `  `* @$ H 0 &  㿐  8>N#x  >#p/ b 6 2  0 2 b `  `` `U` ` <`8  `6` @ #'  ԰ 1 2" 1#8  l$ 2ð  >b `@f  "  8 @2 0>b `@U " ` 8R @2` 0`& 026 6  `  >#># > k #  "X  #>#, 2 -`2 @9 , &@<$@$, 2 "4  \ 1?4* 2 : 4   >b  0@ ې86 6, &@&@, 2 &@4  % 1 4* 2  ( 4  { >b  0@ ې6 6@ 㿐`  `  ` "` / >N#x`" 0` ?`H  %$2  0`  4 " 0`X$` 0 2m` @  @ `@2R8 8  "  8R8 828$ 8  2 "  @ 2 ,  , `N$  @f ```@ 4 "`D`2``4` 2 4`A 4`>N#x`"M 1`< 8 2`D "`D`>N#x`": 1` ``<`2` `"/ 1`D`' 0 " ' ` 6@ " 0 0 2` 6 2  ? 12   1& 0`& `@26 4@[p 㿘& 6 4@' 8  @㿘 8"  " @V @ G@!P H /* & ` "` "  @ "`"`   @ "@"`H 0 c 㿘 &` `@Ԫ , , 64  0$ 㿘 &` `@Ԛ , , 44  $ 㿘` +\``'#.2 / 2  2  8 "  42  62   0 ` @2 㿘` `` 2  8   p @`& @@7 $ D'`0 '` '`4U`4  ` `0`䨚 0㉐㿘 @ & @㿘 @ @9/ 0.0`62.``   @ 2%``42!``0`"`0 `02``" `6``@2`6`H(@"`` `@ `4` `6 ( "@`4`  ( `4` `6 ( `4` `6 ("`H in_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d 㿘.2 / 2`@ @  * @ .@ 2$ 42  6 2 0 2@ `"  "` "@@ &@" #@&  2  >#  >}"*+ 2b3 interneticmp_erroricmp len  ` * >cbȐ "b?؀@ 2% `!  @*            >cb` q"` #m ֱ  h 8 $ ` d"@  $>}#>c"ȓ.`@` ` "` + $`` $`,`  `2 ,`2,` ",` >4`,``@ 4 'x' ` * '4 `x `@/*`4 ?@:$>}a#  @ $ $ $4  , * @@ $@V, 㿐'H'L'T 'P 'X>cb`\ >"`\ $@8 @  ٧ >cb`\ ,"`\  "& & @. >cb`` "``  & "@&  ` >c"ȓ*`@`p "`p `>~#*`  h h h | h h ` h h T h h h h h\>~#*  4 4 4 4 < 4 D L L D L D L L L L   =>c 8>c 3>c # >c *` `8>cb`d "`d<8  >"@#`>>$" *` *  *      >cb`X "`X>"< 2F. # >cA.>"<   #>cb`l k"`lO @6.& *&>"8 ^ D>c `2> >""T >Ԑ"P L .`h& 2 >c`  4 2`X ">c`X' >c bȐ7 `h "`h*  `@3" 0/>c# b *` `!>>cb`d "`d"@> "`# >bP"`  $   2@֒ 0՜㿐   `*`'  ?  " Մ % >N#x`>`H>`  4 "`<`X>`<`2`H>"P`" H  2`H>N#x`H` % [- @    ԫ   $ "@3`"     8  D 2 $@ N  $ $@`  `4   `*@ ` $  "5 *@@ %  "`&  "& `     @ 2 Ԭ㿘   , & " & 4`@,"@4`  "" "    @  㿐@*T@Σa#*& .  . @ 㿘`    *0 >"8>"<sd 㿘.`` .2  ,`2 . @m2`@i,4 . 2 @c@_ ,`6 㿘 %>(#  '>?(#@ >2`>,4 2 "  ?`c( 5  >2`  @*  #> 5 `(" `(c@4 `$$`(>#` ,2 , 2 @֐*   * 2  , , 2  ` @c`  ,2`z>2` >2">L> > "`$  ` ? 2㿘>"!/@ >L > $@1>w1> (  ("  (2& (>" @!/@ c4>#>%> `@ұ >@ͪ 4`> >>`2$>`>@ . 6 %d.%d.%d.%d㿐>'c1> 0ip_init㿀"7"7"7"7"7#g77777  й  >>#P# *"@ *`" *  *  * " * ":>$"В *@@6*@>"``'>$">    2S@""#*"@ *`" *  *  * " * ":+  4 `4>W"!> >""b>N"#x#x" >0 H@ǒ  "   2`*` @ (  #@   2  >0 H   2 *   @( @ " @ 2 ipintr no HDR㿘>)# #> aH /* 'a  $a$ " ?$ H 0   >2!В  @ 0؁㿈'H'L'P'T`'X  Ր` @ ҽ6`>N#x >N#`"# ` #Յ  2 `  &`  <  >Nc`X "`X2 <c` "`  b 2 >Nc` "`@*|6 *  >Nc` "`@6 >Nc` }"` >Nc` t"` >B & & ڒ"@ >B!` '  @耢 ]>"" @ R@O'쀢 2C<8  *>N#x   <2  t` @ ```2@`2>N(`"(>" >N(` "(@ 0 ?@"    2 >Nc`  "` H /* '>)耢   H 0  >W"H 0 >W!Ā`" ` 2@ `@2 @`@2@ ` @"@`2`  "2 6*` `">Nc`` "``H /* '>)"#H 0 `* 6*  _`>N#9> &">b   @d &dH /* '>)"#H 0 l EZ  2" d &dH /* '>)"#H 0 R"'"@* 2@H /* '>)"#H 0 0: &@ * @H /* '>)"#H 0 "6>N# 4># 4>$  `+  * *    0>Nx<>H"5  4 (8 `40 !`"!< "  `2< 4"<X" 8" 0"  (2< 2H 㿘 ` ? *@  $" /$  Œ >N`>WaĔaĀ &@a" "a&` <.`  .`   6` &`   &`   `&`2 `2`  ?V `          2     `` " ` @>N ͒ `2` `"2` & '>    @  " @ "@+ ` "` "Z EⰀ ?$Ⰰ 2 ` &` " &` `  &  &" %&  `   ` ` @ "` n  ?c * @  >Nh`@`"h\ ?$8Z E>b ?"b   EZ "%" 6 `& `& @`"``"``@"@e * @$   `*`" $  @$``ύ"ZR E>b ?"b㿘 "%> y ?` "` "Z6 E ?$`"  "` "@?㿘H /* ! H /* '>)耢   H 0  >W"H 0 >W!Ā`>N# `@? *``  $`  2 `H /* '>)"#H 0 H 0㿘H /* '>)耢 "  H 0   "H 0    >WaĀ  >N# `!Ē``$`!Ā 2`H /* '>)"#H 0 㿘>WaĀ  2'>>N# >"*` , Ⱁ: @ ? a`0$aĀ >attempted source route from %s to %s 㿀   * ?쀥>"` Հ      D$ D"o  "L % 2%>" "̠ `}%` 2 %Ѱ ?@ @'%`r  2 `}  }Ő @'䀢  H` [$  ,< @8t@ `?@8n%E }C   H`@'䀢 s H6   V,$ | (  ?2    *` n$?% `  ?``(b^ Y%`}Ɛ "$% H   G | "%  ,' `   ` ,`%+ >" @X 3 1  $   '@!> #H'     `+`# 4 >Nc`P "`P㿘>@"? >@  R8 828>@""А ,  ,$ >@А">@"Ѐ   DK >@save_rte: olen %d 㿘@>"  > `+ !> EY>2 "b$?㿈 / /' 7׫ 2T`88 `4 `84`8`4 $$* `0  %>M#H ! " `0  @2    ` @ȹ  "    2  2  ip_srcroute: nhops %d mlen %d hops %x %x %x 㿘!>"   "F %>*`  & >"P" >*` D@@" >q"p? *` *`  ǒ@   @  '> " "@X@$@ > @>" $>H"㿘  @` *@"   "`&  "& @* @@$@forward: src %x dst %x ttl %x redirect (%d) to %x 㿈 >" ` `> `  P ! >N`' 2 `>N(`9"(0      %>@?,`>@"  `@   T 8  84 8>@""А , ,!>@`"$"Ѐ   ɘ ` D4 ̙  @  2 4 0/>  `)>" %`$> > D"4` 0 > 4 "` 0  >"  > p>"  >@"Ж !#\  @  >Nc`( "`(>N#`$ "`$mˢ0i`, "`,dAJ >#*  ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (   >@"Ѐ   @>Nc`L "`L  㿘`T ?` N>!X*`  ) ) ) *t ) ) * * *, *@ *T>5">0">+">["Ѐ ) >">">#>#> #>#>"i -㿘 d># @?1 ?`,>"̓*`  * + + + +0 +@ +` +P@Ӑ@@@r@% @*@m - U㿘># @  ɿ  j& k - @F@Z 4㿘0!30!4 0@V0@H( >   22  2 2 >/ >G܅(   2   2 L" 2 >  H  ?4# 8# <# # # #  @>D>%h* ( "`$"`("` , "` ip_mrouter_init: so_type = %d, pr_protocol = %d ip_mrouter_init 㿘!>#(  V >RdaV 2; - R  `4 -"2 ` (. ` >' c ""c ! 0! 8>/e֔ >G"c>7 @F!>!X>" x>!  8):#(  >(b( ip_mrouter_done 㿘H /* !>#D  >% h, 2 * @*`@`  @  >* cD2  , >* @/>2#D>" x>! 8  #>Gcܑ. @ " @   c!>G#T 8$#>"#H>"# H 0>#(  >ǒch  #  "  "  8  > @ x >x  "  Source routed tunnels not supported. mdecap%dadd_vif #%d, lcladdr %x, %s %x, thresh %x, rate %d rmtaddrmaskp "  (  `*`  * >%`h   > 0 #Lx"  2 w 1`` >Zahm -  8R @\ `>a 0@T > "cH T`4 @ R -/ /' a1`؀ CH /* !$ $ $  , ,  $  $ $  $ $ $ $$ ($ ,H 0 >D `2D>#( "    >!>!>!   #\ #`~ x   S( 8>`t"`t> " p/ /'  a2 ؐ@ؒ Ddel_vif %d, numvifs %d 㿘 "U  %> D@ *`I  * >%`h > 1H /* !   x* "*>* @âD>*2 ?* @*`@ ` *  *>2#DH 0>#(  >`З*~o2   >D2`*0@ * (D2  *"`@"`L㿘 L`" @`R 8 2@`"  "` "@R~ 8add_mfc update o %x g %x p %x add_mfc %s o %x g %x p %x dbx %p multiple kernel entriesadd_mfc o %x g %x p %x dbg %p add_mfc no upcall o %x g %x p %x 㿐 "  +8  H /* !> a "a  3 3   2 2  >/c  >Gcܑ* @   2   @2L " 2> a` "`>#(   > }c @ >7` @?*@GH 0  22   2 2  >/c  >G#ܑ,@K >7 2A  2<L"8 * 2    >c@> h}v#\>#(     >L}jc@ "L @?-@L`"@``@@Q 8 2@2-  3>#(   > }=c P 8O  2 H 0! 7$ $ $4$8$<$H$D>Gܓ, $ " "  $H 0 del_mfc origin %x mcastgrp %x 㿘 "h  +>b #(   > |cȑH /* !> a "a  3`3`   2 2  >/c  >Gcܑ* @    2   @2L " 2 > a` "` 2 H 0 1` "` " P 8H 0 㿘  8_  t    ?ip_mforward: src %x, dst %x, ifp %p ip_mforward: received source-routed packet from %x ip_mforward: no rte s %x g %x ip_mforward: ip_mrouter socket queue full 㿘>#(    > b|E  (   2 !>#\#@` $#\  >|.b0g  c8 ? ] H /* !> a "a  3 3   2 2  >/c  >Gcܑ* @   2  @2L " 2 > a` "` > H 0@w >c( `"   >{˒bh  8Ns   H 0 7 沔Ԗ  2  O 8H 0 722   2 2  >/c  >G#ܑ- @   2  @2 L   2    P 8   N%* O 8ĦH 0 7 ł  `  `  ǭ`>O 8ĄO 8H 0 7 L"` ** > !`># $` 6  >{.b`0 8Om$`0[Oh 8H 0V 7>7$ `$ $ 4$ 8$ < $ @ @> *@D @ ? * D`@ ?4 >Gܓ-  $ " "  $ !$ L>  8O."H 0  L   L ` "$$$H 0 expire_upcalls: expiring (%x %x) 㿘H /* !  > !>7 @ "'>G#ܑ,@ "  @ ? $ @ @?,@ >#(` %   > z`82 @֢`H 0>!X>!  2l:wrong if: ifp %p vifi %d vififp %p 㿐 >#D `>% h, @*`@"` >#(  >b@>% h, * zB> >`x "<` &<  " `4 >% h, @*` 2 @ `@y*`HD"" * "@ *А"@"@"@ *`" *  *  q"p       AZ 7&D>&HL * *  * ># ?"H @2  $, "$@",( " @"(>% h4 8 &4@>#D *&8 ,,2  `"`D ` (`D@ &@&@ @;`D@`D>* cD2  ۠ D 㿘 沔  ß+  `  `  ʒ` ` 2`@~0 @㿘   >cTL   6 H /* '>H`8` 2`H 0 &&  &  6  z O & &  沔 !>G#  J&  &¥0;# d" @4t 1> #0$#0 $  $  $  $ 4 4 `$ ` $ 6 ?.  &   `@w*`6  ?& ` @0 @ip_mforward: no tunnel with %x 㿐'H'L'P'T'X  < 8  B >#H 2 @ ~ 0x>`p 2>%>#Dh*` *   "D @ D * >> ` ">#( N > x`P0H" t >" p> t   & "@ & "& ">  & `"0)  6 > !H /* ' @ `"0 &  2" #!" "H 0㿘@  !  "& @T0+ # > ,`",0@>"0% 0@  > (`"(0@@1>%h"("** :H( >*  ((* ( "`#" " H 㿈>%`h& *`" *  *  : H /* !   >* *" * @' ' ' @ " & @ @̐  2H 0tbf_dequeue: vif# %d qlen %d 㿘 `>%`h& ?*`" *  *  : >* +"* * * ?@`  @"`"` ? >**@ *`+"* @@ " " "  >c,?`& >>% h&* "**  aHwV:㿘># @e  >"/< 㿘H /* !@   1>* >% h&* "@> !, * ,*  : * "@*`@ @`@@(?`kH 0 $  % $ߢH 0 phyint_send on vif %d err %d @H /* !     0  @ 0%     ' / @/>c(` >` >%h& *" * * :v H 0㿐H /* !@ #*$ ,  @F,    @$&  2 @ #@& & H 0port %x prio %d 㿘` & 2@ * @`0  @ <@ @ 2 > 2> F 7>#, > a`vUip_output no HDR㾨'H'L'P'T'X   ' >v"`@ `<*@ $ 44* = * @$>Nc`8 "`8 * >"t  ۀ``?Ӏ` @AS `2 @   ,  -  4  $ $  ,   2%4 `  :`5 " 7``  : `) 2`y 7`4  4 : E A4 ɱ`"x`0`"`  `` `` g`"`" `$ AR8 828 2 4 ` 2O M   A`@ /a /``'d`` @A` ` ` `` 2 ```@   `` ` 2`2  ް AR8 828 `a` ` $ ɻ &2@J 4 "R8`@" R8 828& 2  -` -@%``2`t A>NT`"TɃ `D "`tH$ "` "`X{R8 828 g  c 0`\ 2=`>L` ; >`X@A}`|`|y `p$ `x, `\`l@ @B*"`$" ````h@8``d`l@8`@A\`|`|X `p$ `x, `\`d@ @B "`@2` `@`  @4 @F`   R8/8`  `@4 `   "    "R8 8`  `  `@ܓ*`4 ``2W` R8 H828  (  Ⱦ  ` `R8 828 `   AȪ &2@8 4 "R8`@" R8 828&    -` -@%` "lې 2 l :>N  , 2`2`t>Nc`T+ A`D "`t4 `@0< 8 2d ` " 4` , 2U 4 ,U 4 @2  >Nc`T 3 i"`T$ >N#x` #x` "`H`<`2` >N#x"  <2  t` @ ```2@`   @   4 ": H$ `' "` 4   1 2   <@8 (`! >4`>B!` ' @ " A` < 4 @4  |ΰ@>Nc`L ( "`L" ?  'Ͱ (>Nc`< 7 "`<`'@  >cXE   4`H /* '>H8  0 H 0 $@$``$` 4` /  >G&`#$`' $ $  `$  $ @ * < * @'$` '@:`?Ȑ*@4 @4 @ "@' 4  4  $@$` " @4 4 >Nc`H "`H@ @ $ %44  @44  $` |2` >Nc`D "`D  8R8 o28א㿘`  ?? #@ @``@ 2$     " @> >cXD   3 H /* '>H`8`  2` H 0 ##  # 3  W  , @#    & @ & # @  >G& @ &  `&    & & `  `& 4 㿘  * ?쀤``  2 ,   4 "$@l$@`?" ,   㿘 `>#p Y ؀@ ۀ 2S`>!x*`  i l i i i i i l j j j j j l l l l l j k\ k\ k\`@3/`" ` 2 ``>",*`  j@ jH jP jt j.`e.`l `` &`` ?&`` `` &`` ?&`` `` {&`` ?x&```@Sr`"p ` 2k ` "``  "``_ " ``[  ?X&`` ?ߐ T&`` ? P&```"N ` 2I ` B >0-0*>"6%.`K 2 .`"6.`K 2 .`>"6 .`K ".`  `@<4` *  @&` *` |`v> ԓ*`  m, n mp mp mp mp mp m, m m m m m n n n n n n nL nL nL \ '` "S$`  `$` `C L K ' @=$` >!*`  m m m m m0`e.`l``+ ``2 ``2 $ `@" " ' $` ``  2  " `"``"```" *㿘 ``&`  `K yG B``   < &` ` :`@< $*` ` $   `%@#  2$`` &` ,` $ۦ` ,& 3 㿀@ ? X 5B2&@( 7$ ,,4?`> *`  p q< qh q s<"  2 >N$#x` `H ``<`2`H` ` ` T`4@" 1$"߰  2۰  ,"԰  2а  8˰ ,"ư  2° < 8 2 >N' / *j" " 1 @`#x` `H ``<`2`H` ` `v T`4@r  `2 @@"   s 0o ;!,  "`f 7 b4"_  2[ < 8 "Q >N #x` `H ``<`2`H` ` `"9 1 ` 2  @"  ,  1^  6, ?  " ?4 -  @@@@C  5&@㿘 i   &4 " ' -0/ "` ``@`>N#x`" "` ``<`2` `""`H"" "` ` `` "` ```*@  -㿘    `  `B 5㿘 沔  ` 4 `@ٓ*`4 n; 㿘>W! 㿘 >W!!   >A"#d m`"0 @250`"  @2- ` @2%  沔?  >8c`  8  82 m8>c`ʖ s0ܒ  0 f>N# 0 4`" 0" 4㿈'H'L'P'T`'X` ``>  ?#`@=  2   ?"   ?"    ?& `&  x  "    "   &  .`6`m.`  6`0&` &` /.` ?#$  - (@@  "`  `@ 2 <@6`  >N6`>Nc`\  "`\@㿘 ` C  ?쀢" 5k3d1 0' @" ` 8`   `  ?&` _\ Ғ ' " ``  "@  - K Yrip_attachrip_detachrip_usrreq㿘 ` ` ``2 `.`> P  | }$ }H ~ } ~ } ~ ~ ~( } ~ ~ ~ ~ ~ ~ ~ "`>l# > #p>#tɐ >Wڞa x`u, m` "p 9ũ >l#ΐf >M#H "\ 1? 8V 1 "R$ 0e6 "M 1J$ 0 D >M#H 2 `= 1? (`6 /)$ 2.` ' 8 2! 9 @7 2    -ܰ ܻ>l"#؀㿘>)* @ " d*`> #@"$@4 4 $  tĔ  t@/  $ $ $  $ $ $ $ $$ ( $ ,$$ 0@ (4 p㿘 ` 8  E>  2 >c`q"ɰ  `  "  2 4>c  ` " `,#@>cc` "` :` B B:`@ E "" 2  9$ "&`&`>c#  #  : Ȗ B !;  ` " $$ Ւ   `"  "` "@?ɒ E`2 $ 6` $ $" & $ $" $$V  $=  "9    D@23    D & D  `  $` "  "  Ŋ 8? E`    D@"  8   㿘 (H /* &>2!, !!, .`2  >2<`" @"  R` 2 6 2햂>2!,!,<`"  @"  R` 2 @  0 2c# |' $ |` 缒 `   2   s$   `"''@ @ !4` 4`$*  >cc` A"`  2 * 䀤">cc` 0"`0' @ :l 2 >cc` 7"`@  `$ M 2 `@B @2  2   ' ' 'ب  ` '>2`!,'``ߒ츒 2 <>cc!` $!```7  2 <! $!`V Հ`2|*@ 8 M >7@"```"``"`` "` `"``"``"``"`` "` `$7"`$ 0 2 ڐ 7 6`' 0' ,Đ  <`'~ 6?#<* .~ (#6 V  #\@V 2 `7 2 @, D2 `" <@2 (T@2  "  >B &&䀠[$"@ $ T"@ 4 X<@* V 2 >c#!` "!>B ؐ"@  `Vf \h"  @\>c$" ` <` B Ł8&$$T@2V6 2|6| '\\ $@2B  2> <D@8"" 4 42 8>c 8  D@&D B 8`@`  "`" S"`     6 6@ @ & " & <D@8"" 4 & PD"@@ & V &@    `s`I``m@2 `` @c #_`< 8 W [  R $   **`  "` @2 0``' 0 ' 0ǐ6Ð@ &@  7('Ā  #\@9܀>B&8!&8<#>B>ab@ 8&L&,&T&(&$ `6>c~6L6 `&D&P>cc`$a m"```>cca "a$"@ `T"@ `v` `8" `T" ``ː@ ' =Ǵ`Ā`" 6( &$&(6`&L`&D&P (6$8" ">c`"  ` `6~.|.}  Vf`"@3X &X 6 &@@"@ے < >c@c`' `#`В@ B ;`?&00&H #`2"D`܀ <D>B " Ҁ 4&>c# #  : B!;  #!D" >` ``&6ߠ?䀤>c#6 <  B ;   # >cc`< ` #`@ B ;`n&"@'"66 "V 䀢 " @t>c`"D@ @ " ?>c# Ѐ  ,# В : ؖ B`; V 2@D"  (}@G ˴@ `D@`>cc 6` "` ؑ<  B; ؐ "'  `" `>B &&`(``@?* : `> *`   = 64$6>c `-" `@ǒ 6@`eV >c$ #``]"  ` `6~.|.}  ?&0$" 4TV䀢 ` 26<@E>c#` $`V >>cx 6* :  *X< ( 2 @) ( @’&\66f&(&X``B@<``@V\@(&@ &X&(X@ @&X`6>cx &6X\ 8&X6T#@ >cc` "`>c$# #@  #  <`@ B  ; >B ؐ"@  `Vf" h"  @ST@2V6 'Ԁ 2X6X\ @L@|?#*  8 &X\@  \<"@ &<\   |< "&<| \( &$&(V "   `0, %`0' %`  >N#b6  6 6@\ x6 `  `@? x 6 `0@ @4@ @$` <@ ` 䀢 2&<4@2 &<<@>cca "a&<t&0 &4&t 'Ԁ` "9D"5DV 41D8>`x (6,H@ " $D&H8"  ? $4 @4ِx ?.x怢@! @OH"@ 4&H䀢 2V`DV @D@2 .2,   68D>c㈔ &D  :  B 88֒ `ۖ`6V`"1V ,  xD 6`&DV "      x6 6 6@b x6 6    >7Θ(`Y:`Ԁ` Q@֐0M`2`@2 0B`' ##`< 8 `  ` '   @Ā  8    >7Θ (` :`ƐĀ`ݐ㿐7R\@ N  ` $I "    ;& 7&25& "1&` +&2)& "%&  @6 `  8 . 2& '` `  " & !6 @>B & & &@ @otcp_pulloutofband㿘 > 8  &@`6 >c p < @*y x@ *x `"] ?& >c  l*(8 2 l( 2 l(&  n(8"@2 n(4 2 f (2 l(2 n2 f l2 R n(882 *8 2 2 z㿐  @ @` 8   * *  V"  @`2 Tl>c c4* 2 $`Tl 2`@`l "/`T`P @@a 4p=@`$4l`p "*`z@`H4n: 2 @:`4nlTn* :  : p 44  4`T ?؀   <? ̯'  `>#8`@8 @*$`b ` "?(48`d`"`@ @@B>`x@ 8  \4```"<@@@->`x@ 8 8$X`h .  * $\tcphdr too bigtcp_outputp`T`$ ` `?  8T`dT`@&`X`$`X`X`(`< `$ "@  T`>L`c @ 24`\@*  4`\@< ` 2``$4`$`(` `(  `$\@ @, <D@8"" 4  Y`  Q L` M `t2` `G`(`T@,A ? `}#* 4`P`D" `"*` 6/ <*  6* `2& 2# `,`$" 4 " `( " \  T`  T` 4`@   " (`8``$`( /ؐ /ِ7֐֒~ `    @" `  `~@#@'` ` 2``2``  a"``ؒ@B ">B `"@` "```"@  >G# d>a "u`L`  2 `(>cc`l "`l`(`T@ >cc`P<`X #`P@ B  ;`X>cc`D<`H #`D@ B ;`H >cX4=   4 H /* '>H`8`  2` H 0 $$  $ 4    >G #$ @  d" "$ p}  $& 7 p $ \@ "NM$  >cc`h "`hc`x "`x`,`$" >cc`p "`pc`t "`t >cX3Ҕ   4 H /* '>H`8`  2` H 0 $$  $ 4  D  >G c$  $ $ `  >`ϐ!} ( ``  `(`T@$`(2 `(2`(T` "`T`(& `D& ؒ }p <* 2 * @& . <2 6 `}`& `}?#* 4`P`D"@ & 2 = 6 `,`("@` @ 8  6  . `$$`, 5` @@5`$L` T` 25`(`($`(`(` $`(`4``(`T"@ $`(T`f  $`T 4`f$`h>cc` "`T` 2`(`$@"`T`` 4`4`4``T@"@ 4$`T  T`  @$  5`` l-`` e -`` `@`  >c 7 A` @@ #  2T` 4`zc`@   "`@`D`P@"@ 4$`P`D`$`?# @e4` tcp_output REXMT㿘V  l *`V n:`@:`>_ϐ#>V c* @@G 6 * :   x  x6 V   `6 㿘>B "a>2>cy!,㿘     s   (# &  @ɒ  ,  4 `0$ ` $ `6 6 `42""2 2* <*@ " * 2㿘   8 < D @ 8" " 4   @ `  N >G (@ |& && (& `` `&`&`  ` 4 6``6` `(`& &&$ $   * <*@ $ ,  }<4 4 4 @Y 6` @Ē4 6` > " .`    㿘  1ޔ  . @6 &># & `># 6  6 & 6 l> #6 p*` l6 nV n* :  :  6 6   6 & X& \> "$ <, l㿘 V `  86 <>cc`  "` >cc` "``<24 $V z 24 $@㿘  88` T* @@ <n@ "j   "e P @ V l*"@ *`" *   l`* @ 2 $ l$ l P  V n*"@ *`" *   p`* @ 2 $ p$ p P 2  d \" d h 2  d2 :( *`2`2`@@(  @ג`( h`@ 2 $ h$ h`"  "` "@ 2 E 2  " ?2 $<Lv>cc` "` 㿘  .">"̓.   > 8? >|# `0 >2 ' * `!, u#\0!, Π  < X㿘H /* !>2!, !, ?#>c#  <"  "    2`  ` $`  2 2>>N# ,* "c` ,H 00O : < 1T  ". T` `4`*  2    8@ 2 `2 2` d T f4 d` f 4 f2<.#>B>ab@w >B` $a "` H 0 060㿘`q>c``" 0`V   >NV dc` >#6 M 6 * :  >c 6 c`$ "`$V z  <c`(> "`(V  l*` * V n:  @[: 6 *  p:   6  6  V ` 6 ;  l n* : @6 n6 l X $6 f <@ & (  2`@ (  @/& X& \6 0]# , $ ,V  >V d#@6 l>cV n* :  @: @ 0 <=$ 0 . 8. >c#4 "4V `&  8  `>>#>N#`V d@ 8  "8   $ D?>#6 ># 6 >c< <"<{tcp_usrreq㿐 ` Qn  ِ b 0H /* !  ` H 0` `F B   #H  4 Ð   L ` ˆ  | Ð ä   8@  " T 2 x4 <= 6  4 쀤 4 < 8 'r 2װ   j' ϰ  6  ǀ  $Ԑ 7 4 ~ ?#<* ,~ (<T>cc "c 4>#~#>Ba4 k$8>ab@ $a8$,$T$("$$ -@C }&@\ v0q@& k\bl 5]`&@H 0f 4 2 @"K !2G  x  A  = #& y7*@ x 3,x`hd\"" 4 \# 7s$\@ $, i,,y˄ ϒ.@>Z"(     H 0㿘 H /* !` H 02f 6b 6x H 00P3 <E$ *"!  (  "`` 6`?# @6`"  `$ `@4 6`̐ 0 > ' " "   *` "@`"@H 0㿘`` >`< 2 >#>#i >2>a, `& "`2    ?4`p ` 74`㿘 V ` 8f   T  :  A 8@  p㿘V `>#*`  ǜ ǜ ǜ ǰ ǰ Ǹ6 8  6  V     8V  >N#b6 h 2Z 2W @ 'Q Вt˔ ( 2J?  A H /* !>2!,'' \̔ >cԔ" ʵ䔒  8@"?'8 ?''H 0 (&@Вt (㿘`Q ?` K>!̓*`  4 H \ t ʔ ʨ >-#>(#>##|>#>#A– >0 HBE @>#>#AO *㿘>7>c#Ёudp_input: received unknown IP version %dP'H'L'P'T> #P'X`"#P  2``#P>Z\#0R  `/ѐ   ` :   2   C$   `"@@ 4> > cP` )"`$ " `' ' ' ' '``@ ` @T7 7`*   > P` "> cP`  "` р2 @͒  //@7  @'//`7 ' <8  " `' 4 "t `  "& "@ & & >7#В#Ѐ J > #P 6`@2?0`"  @27 `  @2/4@@2*! 沔  в85 ސ`  $`D  8"268> cP` x"`Д  l>  p` '>7 #'@`ɸ 2-`> cP  $ @ `  2`  $  #  ?$ ' '  '  '  ' 7`04 7   @/ `  "& " & & 8 8 > 8’ 88   0 cP` "`GB㿘 i    tU ` & $$ $  㿘 82 $ 8 8 8    8 \㿈> )!D>"̓.  ? >|# `0 >7 ' * `# #\0#В  㿀'H'L'P'T'X  ` `` `0 8H /* ! Ɨ " H 00| 2 x 9 2   ?"   ?"    ?' `'    J 7     ' A 7`?#( G ( @ . `6 `0& ` &`6>#6`4  66 6@l6*  "6`6`l.`e.`l> .`ecP.`$ "`$`8`@``` 0ߐ&``&`0H 00@udp_usrrequdp control data unexpectedly retained 㿘 `  `ϰ ``2 `.`>!   ֐ H H T P X @ P H  , H H H H H  H /* ! >7OcаH 0  > > c } `> bx* lH /* ! ČH 0d  _ 8H /* ! ŅH 0 K ڐG  @ 9H /* ! +$ 0H 0` ?+4`( @! .(@& R ]   - ->U >W![V㿘H o*@aH 0㿘`!  >0   *0  *0> # > @ > > =@(#)ip_fil.c 2.41 6/5/96 (C) 1993-1995 Darren Reed@(#)$Id: ip_fil.c,v 1.20 1999/02/05 05:58:50 deraadt Exp $IP Filter: already initialized passblockno-match -> blockIP Filter: initialized. Default = %s all, Logging = %s enabled㿘H /* &>   1>B!>#@  >V|"H 02 ">. @< p>W!@8+x!>" &!>``(>" >ː @"`(H 0> ؀  >"8>"@>"H>"`>VE IP Filter: not initialized 㿐 'H /* &!>   >`>B"a>` >"`(@ @$ @@@H 00 >V#H 0 #>`0q^ >ఖ'' ''>''' >''> 'q='@ Ȕ   >["Ѐ O )"D@* )"C@E "H@"y  "E@"s 8 )"B'"> "P@ 1 "Q@+ )"=@) )"<@ %Y 0"W@0"V@ )"F@  )"G@0"A@"D 0 0)"K@02"J@8 H /* &  @ H 0"  )@1H 0"=@; )"<@"T@"?@{>"@\>% "B@"E@  ">@"^2"@@>ڢ  "H@? "I@ʀϢ 0"A@" )"F@"H  )"D@ )"C@ 0D )"G@? 00"M@ 0"L@0 "N@ 00)"K@#02"J@k v 0,p? , H>``] Ѐw>Ԓ o>Ԕ " @jc>. @ p>`&`Ԑ " ]"`Ԑ 0p >ఖ'' ''>'' ''>l>''> 'o'02"1 x0-'(oՔ @ oΔ 0" @,&@o 0  @   @  H 0㿘>M#H @.        X "  & X Pok ` `T@"` `  `T@  " `T 2  >"l$.*> Y*.> @ `  `T@ "  >. @ pL`a " `TL`a $`?$``T* L` $`TL` $`?$``T $`TL`| " L`| $`t?$`t 0) `@ 0)  0)"K@  n $ $  % )!@   "  2 ` ?  "  `? $`  )"=@ )"D@, 2 a   ]   ` ` ?"` 2  `T@? I&1$= 8    @0 I$  (   `"`  "` nh  $ $ !@ $$Ô    $ @/       㿘 @㿘 !    h >Gc $9? ! 2  ($ $$@ $  $   4` 4  ` @$`<* @ $`  ,`  ,  @4 4` ,     , > 4 ,  㿘$   p` @A 'ؐ +` "#`2@`, T @ ?``@2 `4 3'܀ 2 A0 `0'@`"``t "`t` 2`>> Ԓ`*    &`,"@ۖ$>``p "`p&`,@ ` 24 < 8 2@@O4 @ |؟@2 (" ?  ( 7 @ l'Ԑ >cX#_   6 H /* '>H`8`  3` H 0 &&  & 6    | >Gc & m'  ޛ * =  * @&& $@:`?Ȑ*@4  @ 4 @ & "@ 4 4 y  &4 @В4 '@@ Ԑ J$ 44  @44  & @|؟`2 >` "``` "`@R8  8 28 7耥 @(#)fil.c 1.36 6/5/96 (C) 1993-1996 Darren Reed@(#)$Id: fil.c,v 1.15 1999/02/19 20:52:22 kjell Exp $㿘&,.66?66 >`  6$.<@.0(&`@.6` 6"&0`6` &>|@>   ```(/ /4.*`  /  @2 `  `.߄:&. @@:'? / @2@*`a" *0& 66K`K O`L(` 2E ( "< ( :4 ( (, ( 8$ ( * (  (`R(  ( `R   T K`JO`N(` 2E ( "< ( :4 ( (, ( 8$ ( * (  (`P(  ( `P    ` @" `D `E `D `? ` `E 2 㿘 66 ,&, `* ``?*@" `? > " `"@(@2@ 0 0  ` `@   ``  ` `   `@ `    @ 0` H?#@2 D?@2z ڒ "r X F2 ` H " X ` 2d 2a" (] H  2W X" T@   \  2  T@  * @*`"@*`@` "`* @*`"@*`@` "` $ $ `  $  `.6 6 &,  &,7,`6 6 &, B`  A    ? ?@  "    " $ "   @ @4 @"b '> .@*`"@*`@`H? "`H> .@*`"@*`@`D "`D$`(4`$`4@@>> Ԓ`* @ $`,"$>``$ "`$@  Ȁ @ € L.$*>.` @  >iC 0> .@*`"@*`@`< "`<`, >  T &% $ > Ԓ`* @>$`,` ؐji 0" > .@*`"@*`@` "``, @ ' >"l $`, > >)cx "cx>)cx` "`(. @ @ w? > .@*`"@*`@`( "`( .@*`"@*`@`,  "`,> .@*`"@*`@`0 "`0@ O? > .@*`"@*`@`4  "`4 .@*`"@*`@`8 "`8  \ @ >> Ԓ`*    $`,"Ö$>``p "`p$`,@> @$`, b @ "> .@*`"@*`@`  6"`  > @> .@*`"@*`@`  "`  /> @+ > .@*`"@*`@` "`@  > .@*`"@*`@`  "`    沔v   >.@*`"@ *` 1" . .* "*  ` " !  `  !'   $  @    l $l 2 6   t t  ?`ђ' `ɔ    z  `  ` `2 2? 2:* 2 㿘@` `` `` , "@*`2`   ` 6   & "@=& ?c 4 *@ 2 @ & "& 6*6 *> @d*> 8` >  0  *0     2 2#㿐, 2 `TҘ   I#   6& & `& "㿐. 2    I"㿘 "#  "@&  2 TԖ I' 2&㿐>.  p@>@1' " / > ,    >     > ,  >  &@@(#)ip_nat.c 1.11 6/5/96 (C) 1995 Darren Reed@(#)$Id: ip_nat.c,v 1.20 1999/02/05 05:58:52 deraadt Exp $`?( 2 2 :2`?(( 2 2 :2   X IO !@f7 XH /* & ` >`$!!Ē @ `($` `, $`(` @ >   ` "Q@"x "R@>$"@>%  "P@ 0"W@"0"V@ 0"S@     e֔ XCb 4 $ ?$ L D "  T@0 D $ | $ ,$ : $ ? $  ,?  (  ($  0 " %   @ 4  @Y"@ $ %>$c` Q"`D 2K %  2   "@+ I>$c`?7"`$ 34 #>Wa" e" $>Ĕ 0>" (ek" ,0"ef @ ϐe^ 0" @j'   @|' 4eI H 0` I㿘 H@ "  L2 @ @"@ @  L@ "  82 D D"@ D  8    $ `$     "@ I>$c`?"`@+@ >$ I"㿘!>W!А@X%%@U%>!  !< $ >$"#㿘>!İ !>$# `$  "@If I`?$` $ 4    `   2  2 ? "㿈'L'T  `L0 X I  [ @ X.2 T&  ` ```'`,?  ` 쀦/쀢 `,?쀦#L(쀢?2(`  ``, `` '"`,` 4`*``2`@* ```,4`?` $`` ,` `` `4` * `2  ,`4`, 2`2``,`( $``` / 2  2 -` @Ɛ-2``L'',2(@ʚ 2z`` ?$` ` & 쀍& `?& ` c 2  2 @$@6 .6 0 6 ,` '`"& ` & ` ?& `c 2  2 @-2 @6 .6 06 ,?# 2@ 2@ 2@ 2@ 8" 2@ 2 0& ,2 T-2 "' 2`` 2 @?# 2@ 2 @ 2` 2@ 2@ 8" 2@ 2  & >!o& < @"* !>W!В& H& @" @̒!o* %& L& D"& 8& (L& $(& PT>!Ȁ& T &2 6 >$ڒ I 26>$  " `"` $`㿐  @ `0  /(;  ` ` 22 `0   `*``$  ' `   "  `  '` '`( @ ' ` + '`(@ @ @㿘  &`0@ `   "  T  ?` c  2 @ $` `c  2 @$`?# 2@ 2@ 2@ 2@ 2@ 8" 6 T ` 6 6@  ``  6@  `J> T @` * #@  .@  < ?# 2@ 2@ 2@ 2@ 8" 4@ ` 6ڒ "> 0  ?# 2@ 2@ 2@ 2@ 8" 0` 6˒ >!&㿘!>W!!o@* %` (.2 /`2 `"  P@2 D 2 D 2 D @2 D` , 2 D 0  D ဤ` 㿘!>W!!o@_* ` (.2 /`2 `"  P@2 @ 2 @ 2 @ @2 @` . 2 @ ,  @ ဤ` 㿘!>W!!o@(* %` (.2 /`2 `"  P@2 @ 2 @ 2 @ @2 @` 0 2 @ ,  @ ဤ` 㿐' '     $  04 㿐 ,  T@2 (t?( ?@? ?   "  0 ?@  @? P  ' '8 A>!Ā =` 25 "1  "+ $ @ 2% 0 2L D 2L D @  " 0 "T  @ 2` 2 `[" `  @{`>!& $@ `( `$$`(`$`$ ?@6 2`0 " 56  `4@J @>a쀢   >!$@  2  `T `$2@ >$c`? "` 㿈 '  ?@(   ' '쀊 " 0   좒 M ?@ @\ A  ' '( 3>!Ā /` 2& `쀊 " , (  2 0 "   2   @ 2` 2 ``    @@ 쀢 >!$@ `( `$$`(``$`$& `& ?@7>$ 4c`.`쀊 " 46  `4@l @>a쀢  >!$@` 2` >$`T `X>$B>$cذ? "cذ 㿘㿘H /* &>!!  )?>$#? $  < <$@@b#G $@ 2H 0㿐H /* &>!`< ?#`P23`<`8`"/`<`,?2+`<` 2'`<`?2`$`` 4 @ 4 @ 2@ 2@ 8" 2` 2 $``<`2`PH 0h ' ' ' (' $' ,7 .7 077?' 8 >!Ĕ @   8@2@'쀢`'Ԑ ''̐  ԖИ@ P@(#)ip_frag.c 1.11 3/24/96 (C) 1993-1995 Darren Reed@(#)$Id: ip_frag.c,v 1.11 1999/02/05 05:58:51 deraadt Exp $>)#P>Z\" >;>" " x ` /` ` 7 ``/` '` !` '` , "@+,    @E >)   I  , >)cP`  )"`cP  $"cP & " & & &  ^} >!?6 . `>`"* 2 @6 >)ДP`"А "㿘>Z\ "?㿘>; " & ?x ` /` ` 7 ``/` '` !` '` + " @ +  "6 #>)#P @” 2&"`  "@ "`&" & &` `" @ 2 26  6   $ Ր 㿘>;   ` ` & "`㿘>Z\  !>Z\*`" " 2*`㿘!!>[!\ I]$` ?!!>< $`  "" F I`2@?㿘H /* & !>Z!\>)#P%>,`&?2*  2 `""@`""` $ IЖ$ $2ב,`!>; >)#P%>,`-?2*  2" `""@`""`$А $$ "" Ғ I2Б,`H 0@vz@ @(#)ip_state.c 1.8 6/5/96 (C) 1993-1995 Darren Reed@(#)$Id: ip_state.c,v 1.13 1999/02/05 05:58:54 deraadt Exp $>8>ؐ >5" 0" $㿘 H /* & >5#>8 )>, 7 @ ` $  H` I 8  ` "$@ $ 2  $  $?@ŒcN I!ذ ?%!@ Δ ő,H 0㿐 "U@ "@>%" 0"A@2 \|  8 ' \n 4  8\h H ?@@ 2?>!؀(  >8``? "`'// , $ $  @ $  `5@``"`0?"S`0? @ " @  " , <? " @?`4 8* 2 `@4 :*`2`@ @ , <>8>a ">$ `0 4 :*`2`4 8 @ $ < *$ @ 24 D4 F  @ $ @>8 "  @`? L>8`4 :* 2 @@>!4 8*`2`@ "$ V? L Iٔ   >8``? H"`[ L@8!$  $  $ ` $ (?$ ,`?4 04 2`4 44 6@>5 `` , %@# *@ , %,` $" ` "`($ `($ $ $ @  ?$ >ؒ @"@   㿘    `?  " < @ "  @ < "& < < @    "& @ @ <   `& `&  F@$ D@4! .& <  & @6 D& < & @6 F>8` "`  &   &  @ǒ H  㿘` @^( @ " ``  "``" `" `! ` = `9 ` 5 `1 ,/``80) *  `: `  ` `  `  /``:0 * `80    `,`(2 `2`02 `6`42  `%02 㿈?@ڰ @ " 0 `  U  >8`>8``!` @ *>5#@ >8#>8 $ @20 8@2+''#\ 6 " < @2@   >!$   $ ` $`  }$ 2 $s>8`!  @ *>5#@ d>8 $ @2''#\,3` "  "@9  2 $@>8`!  @v >5#* 1>8/>8 $ @2'''#\,3` " @>!$ $   %  $ @ c 0 2 $>8``  "`㿘 >5#$ Y I`2@`a >"!؁㿘H /* &  >5#>8 )>, %  ? $ $@ $ 2  $  $?@c I!ؐ?%!آ@ 2 ב,H 00 `  "  `0( "`e> c>!a(@ >!@ Z>τ( = > = = = >4 > > > = ``D C A(@ `= (@ `  `(@ >`'>>>)!`` >  `>! >!` ` (@  >`>!>! (@ h7 ' ' ' ' $/  %`/逢` ` 87 :` 7 H/ I/27 <77'Ԑ ''̐  ԖИ@ @(#)$Id: ip_proxy.c,v 1.4 1999/02/05 05:58:53 deraadt Exp $ 02 2@  J Є  ( (J `," #@  JЄ  ( (J #@ *  PORT %s %d,%d,%d,%d,%d,%d PORT40@ ` 2`@ n*`"ؐ@ ` R//>В`@X   ` '\\* \`2 * \`2 ,`@ @n \`J@ 2JJ`  J \ Y>` `` >`\ `#\(2#`#d4`$<Š )@%@T  `6`d,`'d`,`'`(3`  hWϔ 8@9 55'`  &` 8+  >Ȓ U#&` 㿘O227 227 Entering Passive Mode 4@ 2`@ *`鲐"@ 4`4 4//>Вc@  `&>Вc@  㿘 0ҖV2 2 ``   `  㿘 "_  2[ ` @2V   08` V` I `2` `C ` |`aՠ @`@` , @ 5 X I )  & @ X&` & `& ` `. @6 `6 & H& L>2 <, >a& P& T#a& D& 4&#㿘 2  8 "F? 2``0 `4[* `2 @>`*` * " *   @?`(" @` `$ ` ` @l `4+4`  < @ @$ < $ @㿘>!  " ` 2  (@~  2 (  $   (  " 㿘 2>2 4 <*`@ @2P P"@P>! !2T T"@T H`  L    I  I㿘` 0@   0(U&. Q `?/`/ @@/ 1 / P /  @`@# `@?`@ @'`/  0  (P``?./ ((@@/ 0`/ P$Z/ R(V`?/`/ ((@@/ 6/ P$ / ( @`@# `@?`(@ @'`(/ $ 0$  (P``?./ @@/ 0`/ P / @&@# * @(#)$Id: ip_auth.c,v 1.5 1999/02/05 05:58:49 deraadt Exp $㿘>\>`Y  >'"Ȫ   , * @ ?2D  02@ @@}  29   >) >)cx> "cx, * ?T" b\ -"T?b\`>'"Ȓ   `D  $b\`?" b\`@>""d$`$b\ " `, >)cx`  "`㿘>"\>"`@"@? >)>"`>"\$   >)cx`  '"`#"`>)x  >T`"  "T#"`>'ȓ, @*`@ " " >"X"  @ Tڔ 8>/", " >$ڐ"d fr_authnextP  )"F@  )"<@ . )"=@>) 0 "N@"F>)!0"L@E0"M@i >"h  "h" )   )"=@2 2  $@ I 1&0 I   T  2$ >"X$ $ $&@$ $@ #xTk $0!>"d>"`>/"* *@ *`>'"Ȑ@TU 8"d  $"d$"d >"d!(>Ӕ8" !>0T? D` >'bȑ, *   0`0@2 >/b, @ ?# `# "@ H /* & `$     + >)cx` C"`cx` >"`:>   @    7`# ! "  2" "#   >HT# `#"T>O >  *4 T  TҐ  >)cx` "`cx` "`  72>'"ȑ, * ?">"T>"\? ""T?2> >"`   `D  #b\`?" >\>`@>""d"`"\H 00 㿘 >'">/" "`Db$?$``D >"h "h $  I2㿘H /* &  >'">)#x>/"@? $@ "D.$?$ >T`% ?"TD `D>"h"h>)#x@?  $@ $ Ւ I  $ 2@H 0㿐 >[>Z!H>% 0b"@*#"@ǐ>W*  "ᔁ``?@,(`  " ($"  " ( @   4 " & "" $(  $" 8 ؒ@zϔ    `"4 ///7  7''Ȕ '''̔ 'Ԕ 'ė*  >W2a  @Ё㿘`>"p.  >>Z!H `>` V"`"p. "  @ .``@ I  >%@  0.  $#    I3  T M$ $$$@ @  RS  2  V `@@>ZH.   "@"A"  ipl sleep㿘  `` #䀢@ H /* &>% 0-  >[" 2(&`H 0->Z!H!(>֔ \ \H /* &>% 0  >[" &`->[" ->% 0 ` # %H 0  m I  H /* &@ " %@  >% 0-" >ZaH>[""@ H 0㿘. >["`">Z`$@  7 I@`2`>ZaH. >[""@ >%`0@ >"p" "@ Encryption + Authentication + Replay ProtectionHMAC AuthenticationSimple Encryption, RFC 1829/1851Keyed Authentication, RFC 1828/1852IPv4 Simple Encapsulation "> @?8  >6  (4  >ipsecnotify ` 8`2  2   ]@y d *` /d 2` 0"` ""`` *`  2 2`  62`  42`ʐ 82`A 5  0 $ /y /x'|x@ `"` `"` 2``@ `  `R8 828 %  #>א ? $ >X!aؗ+ "  *  #  耢 `` " #㿐`& P'@"@ K @x"@$ p P | P|  , x $ >L  :`>bx: P@"",/ 2 2 ??# &@` 'ʒ @zђ'  (?@  ??䀦` '@ 㿘@   @ @z!>M#X*`  p2 |@@x 2 x 2 p㿘" K @xr"㿘  K  @xh 㿘>0 * @x    @  ` $`"` ` "` y K ` ې 㿘>0` | %>L w@b>0 $"  v S K`"`  : `@ 8 ``D ` "``X: `h B 8 ` 8`@ `"`: `H 8 ` `L  $```X: `` B 8   $` >>L!>`#P!X@{" ꥒ 㿘 D>0@ 2@"  ( & "`" & " & @ 8"`  2  "&   !>0>0>L !> #P#P꟒ >0 >L`>!X@z" \ 㿘b8 "(   @w 2@w! 2@@w 2@w! 2"  ߐ 㿘 >M#X,` "` Ě "  `a,` 㿘 x  p | | @  @ @y!>M#X*` &" b8"" "b8"  㿘`b82   &b8 " "@` "` K㿘 x  p | | @  @ @xݒ!>M#X*` " " 2$ 2 `" `""` `" `""`   @"8 "  p#>"8bt"8?`$bt p x' |" ""  L" " L K`  㿘>L>># >x;`> P&",.`2      * SPI = %08x, Destination = %s, Sproto = %u Established %d seconds ago Source = %s, Proxy = %s Flags (%08x) = <none> , uniqueinvalidhalvivpfstunneling> xform = <%s> Encryption = <%s> Authentication = <%s> Next SA: SPI = %08x, Destination = %s, Sproto = %u Previous SA: SPI = %08x, Destination = %s, Sproto = %u Currently used by %d flows %u flows have used this SA %qu bytes processed by this SA Expirations: Hard expiration(1) in %qu seconds Soft expiration(1) in %qu seconds Hard expiration after %qu bytes Soft expiration after %qu bytes Hard expiration after %u flows Soft expiration after %u flows Hard expiration(2) in %qu seconds Hard expiration in %qu seconds after first use Soft expiration(2) in %qu seconds Soft expiration in %qu seconds after first use (none)  `>bx "bx!> @uM&@ x)>L>M#X,` `"`b,>"x@"@&b,`|`pLŔ @>ڒb`x1  >ڕ; `P b 1c `L @ >1tc@a}`a|L @ >1dcP>1^c`>`1Xch`xQ>Qc`  >1Hc` `>1>c >17c` @`>1-c >1&c`(`>1c >1c`@ `>1 c>1c>ڒc0` ``>0cȰ```>0cذ```>0c`p|L  @ >`` x0Д`p|K @ >``H x0b8 " `>ے`0>`$0`>`80`Ȱ>0```   >ە; `@@ c 0a`    >ە; `H@ c 0a(` `(>0vaP`!`0>0max` `>0da`"` >0[aȰ` $`X`\   >`X8`h@C@ c a`h>ےb0?`$"``X`\   >`X8``@C@ c bP``>ےbx0#`'>0b>0c` `2sb,`ah>M %d.%d.%d.%d㿐#>!> c' 2  " $c* >/ac. (unknown address family)㿐  " 1>!'㿐'H'L'P'T'X>Kc`c "cU   `   z 2  _&  >K B><  >  J&  "& "@ & & H /* '  @  `w#  &H 00$&   2" "#   >HT# `"T>O >  *4 K 0K H 0㿘   >Kw^o c` "`   ` "   "    ?& `&  w        & 2 > 7<* @*@@ $ `, > "4 ,  , 4 ` 4 4 $ $ &   >K   `*`" : 8@ B >8 #  `*`" :   @ B ;  "   ipe4_input(): should never be called 㿘>."X vӐ`!>#@ $`" $ `   y 2 #@ $#@x @rE /y /x'|` 3 2 `v>c@` "` " ` v>c@`, "`,  >Kv>c@` "`#& `X`\ 2=>L` ; <`X`| `|I `p$ `x, `\`l@ H"`$" ```h@8`d`l@8z`| `|Iv `p$ `x, `\`d@ '"'P'T'X '\'`@'h`'l`'p` `€ 2 >c@` "` 2!a  P `xO*`` \ @`@"av>a`\  a`"   "  u>c@ Y"c@(6 >K#( '`p ' Д ''Д 'ܔ '> H /* '  @  `u# >c@` "`H 00$&   2" "#   >HT# `"T>O >  *4 I 0IĐ H 0p!>6# $`" $ `   xm 2 # $#x@q  /y /x 2f'| 2 `uz>6c` "` " ` uo>6c`, "`,  >Kud>6c` "`#& `X`\ 2=>L` ; <`Xm`| `|Hi `p$ `x, `\`l@ "`$" ```h@8`d`l@8L`| `|HH `p$ `x, `\`d@ "'`'d'h 'l'p` `€ 2 >6c` "` 2!a  ` `w'*`` l @p@"at>6a`l  a`"   "  t>6c Y"c$6 >K#( '`p '  '' ''> H /* '  @  `t# >6c`  "` H 00$&   2" "#   >HT# `"T>O >  *4 HÒ 0H H 0Triple DES (3DES)Data Encryption Standard (DES)㿘!@= 㿘!@= 㿘! @C㿘! !@C   㿘  >#  `䀢`*`" *  ` *: `(& 4 & `  @6 v*`2 6 v v°"  !    L? &!@o ! L6 &!@o!@A!! @A`! a@A 㿘!  ` @``!0 @oo! L&! 0` ' v  J>6 *  @ v ;>6' ' ' ' 2' <`v `*`"  " > >6`8#@ B ?`8 0@ B ; 0` "``(`8@8``,`<@6 `"`0`8@8  `4`<@ '` `/ؒ `*` `" / `/ ` /`v  `: / `: / `: / ` : `/ ` / ` / `  /ߤتА@m }ȶR "FS' "$u ">6$@ .@F7F3€ 6   *АF@$F'@%&@lÒ"#F€ 6  @*'@%&߀   *tȀEԔ   `*``v"  "  >6`"r 0M u`vu` * @ ud  >6r>6c  1"c? c/7 `v * " " 77'' ' ' '   *  `@P*`7 0'P%>6 ('u"( p' *  u  2 7 $ ?tS v' &' '' '  @k'$@@k '@ @?#@ >6r>6c`@ ( P"`@#8:@ B >8 8@ B ; 8 "(8@8 ,<@ 008@  4<@ &@  ** //@/"@/v : /: /: / : ////ߪؐ@kpsкQ "@DD' "$@tI $ %@D   @  *$@&€%Dl@Dh@k   @ @* @&`€%耥  ??"6   "%@% qU   %M 7sΒ  >6pA p>6c 7 9"c 7 2/////v  ////ߐvC  x  ?q l vgP 㿐`4 `   ` @` $ *` ` 4`   `` . >cT   2H /* '>H`8` 2`H 0 """2 n 2$@pb 0 $` ` $`  `& @    . HMAC-RIPEMD-160-96HMAC-SHA1-96HMAC-MD5-96SkipjackCASTBlowfishTriple DES (3DES)Data Encryption Standard (DES)㿘!@9V 㿘!@9N 㿘! @>Ș㿘! !@> 㿘!@% 㿘!@%; 㿘!@-o 㿘!@/  㿘!@3㿘!@5  㿘   > $ p@ 䀢(*" *  ` @*հ `@8Ѱ   >#В 8@ 䀢 *" *   `@"&  & & &"$ &" `"6 v*` 2` ?`S>#*`  ,   L &!@k @=`!>`! L &!@j!@=T!! @=O`! @=Ja(`! H L &!@j H!@$/`  Lx &!@jԒ !@0 ` ( Lk &!@jǒ (@2Z!`"Q     L `6*  & L` P &"@j` `@""` >b  @"" *`2    L `j*  & L` ) &"@j` `@""` >b  @"" *`2 㿘 `! ">"@ ! ,` " `@j\!! L`` ! "'"  "!?`>#*`  0 8 @ L T  ! H  !@j1!h L&!" " " `""@j#` "Z L&""   `""@j` "L L&" 㾠`'`' ` ' qH  >6  *    :  q9 >6  >6""  :`8# B?`8 "" :  0@ B ; 0` "``(`8@8``,`<@ `"`0`8@8  `4`<@8 '`' ' ' 2`'  `<'`y   b @sb$  >6c`  "` 4J>6c`  "` C `v `*`"  "" >6 >6`+""Kb @@`v(`  + o"@ `>6` "@, 2`$ @ @@ €b @͒   €(@ia >6`"`v    + "   @`v$@@gX}R "@'">6 "%p9 $@ .@@v@r `€ 6   *@W@%@R'@$&@g"#@D `€ 6  @*'@$&߀  *o'@ @  ` `*``v"  " >6`'"    ? `oR"@ `voN` * @ o  >6`"l 07l>6c  0"c  /7`v * " " `" @77'' ' ' '   *}: `@}*`7 㾨'P ' ' '!>6#`( o@$`( 2" # 7 $# 2  pl[` 7 $`'" 'Ԑ '"     `*`":  8@ B ? 8   `*`" : `8@ B <`8  "  ( 8@8  , <@ڒ _ ` 0 8@8 `  4 <@ ' ` n` K  n5  v' $' '' ' @e'$@eʒ '@? c  k>6c`@ ( ?"`@ ,@ '  +@  " ** v  @#>բ v>ЪЀ " >ɒ v*2@euY`" Ȓ>>'  ">6 "$nN $@ `, @>    *€  >m$>h@$%@e !   @*`€ $%ဥ €" >0 €>!     ??"6     "& @& k1       & 9 7@m  >6`"jǰ 0)jĐ>6c 7 ""c" 7 2/ v=Ӑ  {c` {\{WP#@  2+   " : (# "   >6 22>6 (#    Keyed SHA1Keyed MD5 㿘  >  @ 䀢,*& $ ,  &  L  6 t* v2 &"=c t L m &"@e  @"""  t" € >M"@e @  㿘" " "@e t" L&""   `""@e` "֒ L&" ``  Xlؒ >  * `l˒ 2 >c@  D"c@  * @  >  `*`" : `8#@@ B >`8   `*`" :  0@ B ; 0` "``(`8@8``,`<@8 `ig   "`0`8@8  `4`<@ &`' ' ' ' '/  * @7/7 7b` <`  *  : @8%>M  !@   `@  `0`  *  `@  `` ``@ * @&  `>Mb` ` ""x> @ $@`$bo> ", 2$`@ b`t``€@d” P>' ' ' X' ' /   *k  ?"& @ & ?"&  %% %   % * % ?# 5 `+` yv5   `@*`5 @` "@@`"@@ `" h !>#@`( ` ks$`( 2 #@ 7 g$#@  * "@"@  :`8@ B >8  `*`" " : `8@ B <`8 "(8@8,<@ hf8 " 08@8  4<@ & * `k#    H *jm?# <h6>c@`@ ( "`@* @' *@ * '/77 7/ 3/7 '' /Б</7p'p` ;(`  *  : 8p#>M  !  p `  `0pb`  * b `  `p` `p`b * & p` >Mb`   * "@`x "@p, 2$@`@ @t`p /77 /    ??"6     "% @% g       % 7 7 `*`j6 * $$$$ 4 $Р <,Ѡ, ҖH4 Ԑ$    *w `€p&  g5 >c@ 7 "c@HMAC-RIPEMD-160-96HMAC-SHA1-96HMAC-MD5-96 㿘  >  8@ 䀢 *" *    @"& Y & &"$ &"     L `6*  & L  &"@bx  @""  >b  @"" * 2    L `j*  & L  &"@bQ  @""  >b  @"" * 2>M"@b; @ 㿘" " " `@b-` "d L&""   `""@b` "V L&"  , X`iY >  * `iL 2 >c@  q"c@  * @   >@ `]"   `*`" ?`8 @ B >`8    `*`# * # >#@ 0 @ B ; 0` "``(`8@8``,`<@ݒ -`"`y`0`8@8 `y `4`<@ &``y" b ub$  >c@`  "` 4>c@` "`' ' ' ' '/  * @77/7b` 9`  *  : @8%>M  !@   `@  `0`  *  `@  `` ``@ * @&  `>Mb`  ` ""~> @ $@`$ u> ", 2$`@  `€b` 8` ``€ @a N>' ' ' X' ' /   *gg  ?& ` & ?&  %%  %   % * %  + ?c 5 u5  `@ *`5 @` "@@`"@@ `" d !>#@( g"( #@ * `( g 2#@ 7 y$#@>  `*`" : 8#@@ B >8  `*`" :  8@ B ; 8 "(8@8,<@d dK 08@  4<@ & @ *f”  ?# <d>c@`@ ( ""`@* @'*@ * '/7 77/ 3/7 '  @_' /Ȑ /7p' `2 'd\>c@`  "``& h 7o   *  : @8h%>M !@  h `@  `0h   *   @  `h  `h @ * @&h   * "@&`>` "h, 2`$ @ && / 7 7 / 2  ?"   ?"   ?$`$  d     $N 7 `*`f` A&& & & 4 & Ƞ <.ɠ, 4 ̤@$ А$   *6h € 6   € 6 & @`cl"@ (>c@ 7 "c@H";j" &."  v" 0" " " " \p    @````$`(`,7`0`8 , 4(` 0` - 5 ) 1 ` -5, 4`  @,` 4`- 5 @` , 4 - 5 ,4,` 4`- 5 , 4 ` - 5, 4`  @,` 4`- 5 @ , 4 - 5,4,` 4`- 5 , 4 -5, 4`4 @,`4`- 5 @ , 4 - 5`< ,4,` 4` ,@` - 5 , 4  ,` -5, 4@ ,`4 ,`4`- 5  @-` , 4 - 5 -, 4,` 4` ,@- 5 , 4  ,`< -5, 4@ ,`  ,`4`- 5  @-, 4 - 5 - , 4,` 4` ,@ - 5 , 4  , - 5, 4@ ,` ,` 4`- 5  @- , 4 - 5 -, 4,` 4` <`  - 5 , 4 7z㡄`  - 5, 4@5,` 4`- 5 4@ , 4 - 545#`܄ ,4,` 4`4 - 5 , 4 5`< - 5, 4@5`  ,` 4`- 5 4@` , 4 - 54` ,4,` 4`4` - 5 , 4 5 - 5, 4@5,`4`- 5 4@`4 , 4 - 54, 4,` 4`4 - 5 , 4 5-5, 4@ -` ,` 4`- 5  @- , 4 - 5 ,@,4,` 4` ,- 5 , 4  , -5, 4@ -`  ,`4`- 5  @-, 4 - 5 ,@` ,4,` 4` ,`4 - 5 , 4  ,`  -5, 4@ -` ,`4`- 5  @-`< , 4 - 5 ,@ ,4,` 4` , - 5 , 4  ,-5, 4@ -` ,` 4`- 5 5*TN5`@ , 4 - 54@ ,4,` 4`4 - 5 , 4 4 - 5, 4@5` ,`4`- 5 5@, 4 - 54@`' , 4,` 4`4- 5 , 4 4 -5, 4@5`' ,` 4`- 5 5` @' , 4 - 54@` ' ,4,` 4`4' - 5 , 4 4-5, 4@5`<`4' ,`4`- 5 5@, 4 - 55(0@ ,4(` 0`@1 -` 5`) 1 4`@ - 5, 4@5@ (` 0`-` 5`5@ ) 1 - 50@ ,4(` 0`@1 -`5`) 1 4`@'Ԅ -5, 4@5@(`0`-` 5`5@) 1 - 50@ ,4(` 0`@1 -` 5`) 1 4@ -5, 4@5@(`0`-` 5`5@ ) 1 - 50@,4(` 0`5t$@ )-` 5`) 1  @, - 5, 4@ -@ (`0`-` 5`@-` ) 1 - 5 (@ , 4(` 0`@ )-`5`) 1  @, - 5, 4@ -@(` 0`-` 5`@- ) 1 - 5 (@ ,4(` 0`@ ) -` 5`) 1  @,-5, 4@ -@Ԅ (`0`-` 5`@- ) 1 - 5 (@@ , 4(` 0` ) -` 5`) 1 5\5@ - 5, 4@5 (`0`-` 5`0@ ) 1 - 51 , 4(` 0`@4` -`5`) 1 5@ -5, 4@5 (`0`-` 5`0@`$'܄ ) 1 - 5`@1`` , 4(` 0`@4 -` 5`) 1 5@-5, 4@5 (`0`-` 5`0@) 1 - 51 , 4(` 0`@4-`5`) 1 5@-5, 45]@ , (`0`-` 5`@-@ ) 1 - 5 -,4(` 0`@ (@ -` 5`) 1  @) -5, 4@ , (`0`-` 5`@-@ ) 1 - 5 - ,4(` 0`@ (@`'Ԅ -`5`) 1  @)- 5, 4@ , (` 0`-` 5`@-@) 1 - 5 -܄`8 , 4(` 0`@ (@ -`5`) 1  @)-5, 4@ ,(`0`-` 5`@) 1 - 5 ,4(` 0`@-` 5`) 1 @- 5, 4 @(` 0`-` 5`@Ԅ ) 1 - 5 ,4(` 0` @-`5`) 1 @ -5, 4 @(` 0`-` 5`@) 1 - 5,4(` 0` @-`5`) 1 @ - 5, 4ܳ- @(` 0`-` 5`@ ) 1 5 @ & @  & & & &X @   &   @@V&  \ ?  ." \I& \  @" . +  `  `  `* *` * `  `& 6 ? +  @   * *`  @*  $ `u 6 `@?& \, @-ג X`\ @* `\ ? @V7"@  +` ` ` * *` *    `\ 7B@V @`*`'``2* 3'  @ .@ 2 . @ . @ .  P/>Ȑ- @           $ ( 0@@) 1 @ @  (`0`@@ .6@ @  ) 1 @ / 7 @ @  @.6@ /`7`@ @  @/ 7 @@(`0`@ @  /`7`@@@) 1 @ @  (`0`@@ .6@  @   ) 1 @/ 7 @ @  @.6@/`7`@ @  @/ 7 @@(`0`@ @  /`7`@@@) 1 @ @  (`0`@@ .6@  ,@  4 ) 1 @/ 7 @ @  @.6@/`7`@ @  @/ 7 @@(`0`@  8@  < /`7`@@@) 1 @ @  (`0`@5>.6@  4@  * 2 @&Ȑ@  ) 1 @/ 7 @  8@  < * 2 $  @.6@ * 2 $ /`7`@ @  @/ 7 @(`0`@ @ z , @ * 2 @$ @ /`7`@) 1 @  @  4* 2 $ @ (`0`@.6@  @  * 2 $   ) 1 @/ 7 @  8@  @* 2 @$   @.6@/`7`@  <@  * 2 $  @/ 7 @* 2 $ @(`0`@ @  /`7`@@) 1 @  ,@  4* 2 $ $@ (`0`@* 2 $ (.6@ @  ) 1 @* 2 '$ ,/ 7 @ @  8 @.6@* 2 @$ 0/`7`@ @  @/ 7 @ (`0`@  <@  4* 2 '$ 4@ /`7`@ ) 1 @  8@ * 2 '$ 8@ < (`0`@@* 2 '$ <.6@ ؒ@  ) 1 @* 2 @5>&Ȑ/ 7 @ @  @.6@/`7`@ @ * 2 '$ Аؐ @/ 7 @* 2 @'$ @ (`0`@ @  /`7`@1 @ * 2 @'$ @ ) @ @  (`0`@.6@ В@  * 2 $  ) 1 @/ 7 @ @ #ܐ * 2 '$ Ȑ @.6@/`7`@ @  * 2 @$   @/ 7 @(`0`@ ؒ@ Ȑ* 2 $ @ /`7`@* 2 '$ @ @ ) 1 @ @А (`0`@@ 6* 2 $ $  .@ @ ) 1 @* 2 @$ (  / 7 @ @ @.6@7`* 2 $ ,  /`@ @ @/ 7 @@0` @Ȑ* 2 $ 0@  (`@ @ /`7`@@@1 ؄* 2 $ 4@   ) @ @ (`0`@   .6@ @К@+`3` $ 8  ) 1 @  / 7 @ @ؘ(0@$ <  @.6@/>  /`7`@ @@@*2 %Ȑ @/ 7 @@ @ (`0`@ @И+ 3  $  /`7`@@ @ ) Ț@+`3` $  1 @ @ (`0`@   .(0$  6@ @ ) 1 @.6/ 7 / 7  @@     (0$ @  4@  @     * 2 @$  /`7`@@   8@      * 2 $ @ @  (`0`@ @ /`7`@@@(`0`@) 1  ) 1 @   < $     * 2 @$     (     , * 2 @$  .6@@        * 2 $ $   / 7 @ @ @.6@/ 7 @/`7`@@/`7`@    02 (   * 2 @$ (   @  4  ,  * 2 @$ , (`0`@@ $   8      * 2 @$ 0@ ) 1 @ @ (`0`@) 1 @.6.6 @ (@ < 4   * 2 @$ 4   / 7 / 7   ,@ @ 8   * 2 @$ 8  0  @   <   * 2 @$ < /`7`@@ 4  @     * 2 @$@ (`0`@ @ /`7`@@(`0`@) 1 ) 1   8 $ @    * 2 @$   < (       * 2 @$ @ .6@@@  ,     * 2 @$  / 7 @ @ @.6@/ 7 @/`7`@/`7`  @ 0@     * 2 @$   @ (`0`@(`0`  @ 4@     * 2 @$    8     $ * 2 @$  ) 1 @@   <     * 2 @$  .6@ @ ) 1 @.6@/ 7 / 7    (    * 2 @$    @  ,@   $  0 * 2 @$ $@ /`7`@@ @  @     * 2 @$ (@ (`0`@ @ /`7`@@(`0`@) 1 ) 1  @ @ 4 ,   * 2 @$ ,   .6.6  $@ @ 8 0   * 2 @$ 0  (   <  4  * 2 @$ 4 / 7 @@  ,@  /`    * 2 @$ 8 /`7`@ @ @/ 7 @@ 07`    <   * 2 @$ < (`0`   &@ &  & @ & & H";j" &."  v" 0" " " 㿘 . &  6  & 2 ? ? @"  &,  ?(@ @ ?   @ &&㿐  (  * @ #  *`2 * 󀢠>c ` !! !># ` !!     " @*`2 .  㿘?@?#3. 0 0( (@7`.@ 0@0(`(3. 0 0( ( @7`.@ 0@0(`(3. 0 0( (@7`.@ 0@0(`(3. 0 0( (@7`.@ 0@0(`( 3. 0 0( ($@7`.@ 0@0(`((3. 0 0( (,@7`.@ 0@0(`(03. 0 0( (4@7`.@ 0@0(`(83. 0 0( (<@7`(@ 2` @2 * d(`(@D@&@&㿘D?@?#3. 0 0( (@@7`.@ 0@0(`(<3. 0 0( (8@7`.@ 0@0(`(43. 0 0( (0@7`.@ 0@0(`(,3. 0 0( ((@7`.@ 0@0(`($3. 0 0( ( @7`.@ 0@0(`(3. 0 0( (@7`.@ 0@0(`(3. 0 0( (@7`.@ 0@0(`( 3. 0 0( (@7`(@ 2` @2 * d(`(@&@&1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىyP?#>ah#"`H`H *`2`*0 : `* `0@* 2㿈7 .#6,   2` @*2"@7'' #,  * 2  2`*``*`" "@  , 2 m.``* 2  2`*``*`&@&  * 2   㿈7 / #7 ,   2` @*2"@7'' .2 9x'q'$,  * 2  2`*``*`" "@ .2  , 2 N'G'.* 2  2`*``*`&@&  * 2  ִ 㿘.66㿘.6  ̔` * 2  `㿘.6  J` * 2  `㿐 @6` * *` *  '* *` * @ ',.2 . ..`.@2 .  .@ Ѳ`㿐 @6` * *` *  '* *` * @ ',.2 . ..`.@2 .  .@ Ѳ`0@ԟ k/?%z!?/M`@ϟIԯ'@Жuncaf"(h;oY#yw_PC@/V|ҽ-4lHam"T/*2Tk"V:Af@ȧ9/M/-ޗ?JRvD7,QYoZ z{hА."TY5Km/PdfI-3";K4]E@1?.Ueձʭ-Էm P"@ nO8O[rVL/ŜSITFiXcE]WSj9=7*T:x}_bvzB j)r'^Pg8Ƶˌ*ZJ'ѓk*҆Vґ׉C`B\u &ql-sJ5&{M 0n٘&fVH%^V c|cp EP(r#Hp -;MyBA &G LGMj| ^\#Y8r۫Sn/#qFVEn9 q+A|ʉiHCyB}B{ZIݏ\e  [i~9?Caz zUrQyNr5Zc60_ }/{Y6 DDY̳A; *{B [%AzzƩX0ދw?Nyi${[P5%a_b1T UKc]h!fY=cs4~\g+!a9b60W;`/d:͜F5-' zyl0%7^oo; jEt'N:4Oi>M5YdE8Cfr%c3N?( 'ᛥզRTUfpdw M&g!CX`T0orSGUb]hVk-n;ۦк=\w 3L9{^+_Soa Cd^xc"g&рI"{^U-%Rr7yҕ LHϢ 0qc/ S!ET(5c)1BƎI# 0(_qȾ`a輨M/".pN40';yaٸHi?(;CZᗘv/܆7ӱÓnƼ>Q7Bh(Re-jw5'K \n.ے^)XXOTi{&g̅`HK8` #l8~ I` 5sܱGLV>#d8^FB kzOdEA^\#>];Cוr~m|llq`9spvE#@%]=G`6KDʐPQHX_0.r| ],*IPڈ'WyoIR}rY}@EE]t>OuVi#A.`' v䶔etyvwvNHam❄/}4 ȖH0b \8D=`nm`T:IW'H+8 $hE%;` E}(/P4b +md+10ZRXAB휤1\2>F63S57 ާ{sJO{dWQC~(zc _5y Cddc$J(_OC@ " 07O-${MQgqL-_d_ !S>^'Ҹ_Bar%΄q=Ko&;~ԄT~DmLl&I߮63P?~w a8rPP.wWOgF3Ti 1M5=\f][̩o꟒oF"/9F}mCOC!N ? (X&Hn>׊ptw|- %y 껁(;#iޭ8t߇b!@7{ @YVOv/@U{ MV3i5W#'ȰVÑke^anu2Uw?[-;%m;$ cf8( 2T2bZg,uzT1w&16o FjHVZyjLRC~/v t,߷t*M . k|AT嶠5!=B,|&aeR1%i &c1\!^ rIyٍ 1p>d >Ӷ È0lrqn/ބkD؋V9ñ/ʴ1x(o}2X~$ŗ{sa0-!!))*\e0,Ъ?\Ԟ, T ͆_wޠ:xV^V!\uㇳQ#wE)/i߯zpIJ[̘v9F څ8/sgD)k)I/•fgni~/%p^QS$jlD!>Yye)CA9y+WMN҂z) Gl ыiWw@~˳PM xQ VA$ VWUnaX $K'{UahwdlkDMfdi~կI/07O,5jsI@v;M(BDHsnL )_}Oao.w+᪐r<}F+YEEYTNmHo |cD_sVjprn] `yE`۩11\"NB\rr,%@N2N/@g#\xnu"xMkXnD O?H{wv#uV_F*+ (=8 6RJf;tQZרխly ueXJh&pSF\l(vk07h)҅6*$gk %huUD,eI40ʸ"W ubIb~U^vSEFmG,lLHg3|hC\2US `ߡWc톹^9283Ia7b^~N#tq܇&3@~C/ ^A (lؑ0~foo䬘s`*4-K6%░#% =HI6oJ8@CzT¼pOWAZ:TUY5|ūZǵޯ:G:S%e=~jT&IQwP[]Dlvȸ!`Xi[)Y;LJ]5UkLD5$bI/T81q(TH9)[u/@3+gf-V*o` ('Md)P,2\K6ޠ_AP! NhÁ\yCMIP8CA<?f϶&`ued$zHܩóf(` ߨ5mw 5k*HiMuN{:_Cg7I3BfΌAT:lG()G%7j+z \D7bB ntgr9X7EXVn0!$Eˆ)^18FXJNFFPx)C_$;,NmdTJOëoxnn<UV6;]޻a<tb3<L(m tyl{nwe\R0+@`>x7T0}ȧm2羾-yy"SuwXkxoZc\]3򎿰€vzҰyBq3j'`CP=Ăm+NvH%6f(NAa =IϺ߶_撮d:枨 +}?pP+ObZjyb.H@@Z,Қ"-E4S֙)nIloIrB~>VofblqTL+*)9ܰX򮞢RVLf.v9Si.Ӡߦi>҅tFL+OuvV]93x2#O=2]K&ǟ/<~~^O?v)f=oEӵ4+4NrgU="Ҩ`g8k0=8}cQXӐTyGawY-WSVXNcF.xe~yU@0ј5?P=@!IXLQ6p΃yǔqoKK0 ڽ5dw$,ϰ/ t*Bv-:7ޚޱ ,p) @$:7ϴNy ]H 1hZfB1?ru3 BQ\}mc@!d SWz13]oCqF8"ΔԸGi[bUfg N[GLoŽĸWrndzx]D`Փl 9_] c~2p PI) *m~SHX~;t.R/G~'ͤ![<z8BOv5`9'5ɯ{6 g{qp-^3TIZd,= p4wB&Ob$ҿF%dN>7`xͥE{_ v"1.{$%r_m LPm=O%#so(%Iy4azn|n6lTAV'JA<șgmB`{u $ž9g;?q0T;2dB̰E}JBp} W[z?Z MΤ(y043w;S7x倳Nhȳ~ 9|*OC/}"6ʢ7ߓ+$W4xgaoHR^^A$e.{@鎠XӐ[HV8Wrs޼[d1~OPa`{ I8,v%ѷ%$K vGX YѤf 0nN&Qd# Ph㿘````((. @`@ @("@0`.`((> 6(> `6> 6>(@&``D("@06(6&6(@``H ("@06(66(@&` `L("@06(66(@&``P("@06(6&6(@``T ("@06(66(@&``X("@06(66(@&``\("@06(6&6(@` `` ("@06(66(@&`$`d("@06(66(@&`(`h("@06(6&6(@`,`l ("@06(66(@&` ^`0`p("@06(66(@&`4`t("@06(6&6(@`8`x ("@06(66(@&`<`|("@06(66(@&7 *7 *7 **6*6*6**㿘@```((. ```((. ` g > 9>  7>  <5> |('@06`(6`6``(& 8 x ('@06`(6`6``(& 4@ t('@06`(6`&6``( 0 p('@06`(6`6``(&@ > 9>  7>  ,5> l ('@06`(6`6``(& ( h('@06`(6`&6``( $@ d('@06`(6`6``(&  ` ('@06`(6`6``(& @ \('@06`(6`&6``(  X('@06`(6`6``(& @ T ('@06`(6`6``(&  P('@06`(6`&6``( @ L('@06`(6`6``(&  H ('@06`(6`6``(& @ D('@06`(6`&6``( @('@06`(6`6``(&@0`*@0`*`0`*`*`1 *`1 *`1 *`*`h   '` Ȃ   ) &@(&`(&@`(&6 `& ``   ޶ >>>>    ` Ѕ(@(@6(@6@7 (@@6`('؇6`@'6`۰(7 7 #''߇6 (@6 6 . @'6̄@'6(6ӵ.(]'؅(@(@6(@6@7 (@@6`('ȇ6`@'6`˰(7 7 #''χ6 (@6 6 . @'Ѕ6@'Ӱ6(6۵.('' "J @  0(0@(( @(@((('@0(0@(('@(@(=(@(0(0 @(@((('@(@(0(0'@(@((('@ "! 0Z, > 0U@(@ @@('@@('@<@(@ @@('@@('@)@(@ @@('@@('@@(@ @@('@@('@@ ('@ $`@ @@'@@'@@ '@ `   >` Ȇ؅)  &  &@ H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F㿘 >!x! L ,`&@ @ * ``$@`` !㿀 @'  '      @  $    ' @   @@  @ @      @    @   @@  @@  @   @  @   @   @    @` @  @`  ` @  @ @`      @    `   @  @@   @   `@  @@ `   @@ ` `  @@` @ @`  @`  @     @  @ `  @ `  @@` @ @`  @` @ @      `@ @ ` ` ` @  @@ `   @ ` @  @ `@ @  @  @ '   `   @ @ ` @ @ `  @  @  .@.`.`.`.` .`.`.`㿀     $'@'@          @@  '@  @ @ @     @ @    @@@   @  @@  @  @  @   @ @ @`   @ @`@ @@ @   @ @@  ` @   @   `   @@`   @@   @  @   @   @ @`@ @ @@`   @  @  @    @@     @ @`  @@`   @@ @     ` @ @ `@  `  @@ `@` @  @`   @@ @ `@@ `@ `   @@ `@ @ @ ` @ @ ` @'`     @ @@   @`   @ @.@.`.`.`.`.`.`.`                              A@@A@@A@@@@A@@@@A@@@@@A@AA@@@@@@@@@@@@A@@@A@A@@@@AA@@A@@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                             libdes v 3.21 - 95/11/21 - eay㿐  * *`  * '   * *`  * '@.@2.`2.`2.`.`2.`2.`2.`''㿘`@7`(@7 ?@(7` ̄3(@7 ?@(7`UUU(@/`7`/ 7 @h >   @@6.?(666 ?(@7 7 7 6.?(666 ?(7 @7 7 @g)  >`x? @@6.?(666 ?(@7 7 7 6.?(666 ?(7 @7 7 @) 1 /`7`7`UUU(@1 ?@(7` ̄3(@1 ?@(7`Ä(@"@"`㿘`@(`0`/ 7 h@ >   @@6.?(666 ?(@7 7 7 6.?(666 ?(7 @7 7 @g)  >`x? @@6.?(666 ?(@7 7 7 6.?(666 ?(7 @7 7 @) 1 (`0`"@"`  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$   $ $$$   $ $            $$   $ $$$   $ $                0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((           """"    " " " "((((((((    """"( ( ( ( ("("("(">   @* (  >  ` `(  㿘 >!L@-  ` `  㿘>!H  א ?  ?>!#>! ? # 33 *`@ *  @ *`@ *   *` * 0@ Ð# @@ *+` @ 2@(  2@0 UUU @ *3`@? @ *@0 @ **`?#@0 @< @2 @ @+ 3`+`@0(3`+`@0(@ @ `?*3` 3` <*3` `3` 0@ *`@b 3` 3` 3` 8*?*0 `0 <@*`@e 0 0 `0 0@*`@g *  &@`3 ? @+ 3 @&@` 㿘2㿐)è#'?% ̤3#?` !UU !U + @ * @  + @ *   +  * 0 @ * 3`  *@ 0 @ * 3`  *@ 0 @ * ''`?0 @* 3` * @0 @* 3` * @0 @* .@3`.`3`.`3`.`.`0.`0.`0.`㿐a"@  o.6/  !' "` `  """"  o2  @9  `   3r  '  7  60 bind failed krpc_call: sosend: %d RPC timeout for server 0x%x rpc denied, error=%d rpc denied, status=%d h   / 'А Ԕ6H/ u'̐ " %? #=#  ` /o ^'̐ " "@Ԓ= o / '̒ "   , , $ >cxQ  2H /* '>H`8`0 2`0H 0 """2 .  "   #=  3 >cp  '̐ 2H /* '>H`8`, 2`,H 0 """2 .T '̐ `"` , , $ 54 /̀ >$}# >cx  2H /* '>H`8`0 2`0H 0 """2 .  "  #=@  ǀ .   %>$  .Ւ  <`$@ $` @+{ >""& & & & &  &  & & 4& 8 @ ' @ '$`$`  沔/ g'Ԓ  6 `' >$#贖Ѐ "/-'̀ 3@/&'''ԒД̘ؖ 9Ȱ # &P&@`!` ` >b  >%  ` >% `   1  ' 7>$#杒`  @` ? 1R̀`''@'Ѐ`.`.Ѐ .5aԁ㿘` ? hL  -Ԓ `l?H /* '!>-#P   , #P& >O @" > !2`  * >H`8` ?"`  $#PH 0  "  & (& $ &  6   2& .   &  "@`㿘 1.  "     ?     0o0Ē.@&.: 㿘 -a  "   "" " "  "㿘  0  2   @ " ` &@.@ ` .` `.` `.`0 nfs_read modenfs: bioread, not dir NQNFSNONCACHE: type %x unexpected nfsbioread nfsbioread: type %x unexpected 0 | aD'>',!  2 հ а @" @b  @ @!I`@`E!` ``>'!@yb @ %`{! "%`{ `@@#!/bin/sh - # $OpenBSD: MAKEDEV,v 1.56 1999/02/01 00:35:53 jason Exp $ # # Copyright (c) 1990 The Regents of the University of California. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the University of # California, Berkeley and its contributors. # 4. Neither the name of the University nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # @(#)MAKEDEV 5.5 (Berkeley) 5/28/91 # # Device "make" file. Valid arguments: # all makes all known devices, including local devices. # Tries to make the ``standard'' number of each type. # std standard devices # local configuration specific devices # # Tapes: # st* SCSI tapes # # Disks: # sd* SCSI disks # cd* SCSI cdrom drives # ch* SCSI media changer # uk* SCSI Unknown device # ss* SCSI scanners # xy* Xylogic 450/451 disks # rd* "ramdisk" pseudo-disks # xd* Xylogic 753/7053 disks # fd* Floppy disk drives (3 1/2", 5 1/4") # vnd* "file" pseudo-disks # ccd* concatenated disk devices # # Pseudo terminals: # pty* set of 16 master and slave pseudo terminals # # Printers: # # Terminal ports: # tty[a-d] onboard zs serial ports # cua[a-d] onboard zs serial ports # # Special purpose devices: # audio # openprom # bwtwo* # cgtwo* # cgthree* # cgfour* # cgsix* # cgeight* # cgfourteen* # tcx* # bpf* Berkeley Packet Filter # lkm loadable kernel modules interface # tun* network tunnel driver # *random inkernal random data source # magma* magma card (makes 16 tty and 2 bpp) # spif* spif card (makes 8 tty and 1 bpp) # bpp* bpp # xfs* XFS filesystem devices # ipl IP filter log PATH=/sbin:/bin:/usr/bin:/usr/sbin this=$0 umask 77 if ! [ "$os" ]; then os=OpenBSD fi # SunOS shell support functions if [ "$os" = "SunOS" ] then PATH=$PATH:/usr/etc # SunOS has chown in /usr/etc add () { expr $1 + $2 } mult () { expr $1 '*' $2 } hex () { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } trunc () { expr $1 : $2'\(.*\)' } unt() { expr $1 : '[a-z]*\([0-9]*\)[a-p]*' } fi # OpenBSD shell support functions if [ "$os" = "OpenBSD" ] then add () { tmp=0 while [ "$1" ] do tmp=$(( $1 + $tmp )) shift done echo $tmp } mult () { echo "$(( $1 * $2 ))" } hex () { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } trunc () { # XXX pdksh can't seem to deal with locally scoped variables # in ${foo#$bar} expansions arg1="$1" arg2="$2" echo ${arg1#$arg2} } unt() { # XXX pdksh can't seem to deal with locally scoped variables # in ${foo#$bar} expansions arg1="$1" tmp="${arg1#[a-z]*}" while [ "$tmp" != "$arg1" ] do arg1=$tmp tmp="${arg1#[a-z]*}" done tmp="${arg1%*[a-z]}" while [ "$tmp" != "$arg1" ] do arg1=$tmp tmp="${arg1%*[a-z]}" done echo $arg1 } fi for i do unit=`unt $i` [ "$unit" ] || unit=0 case $i in all) sh $this std sd0 sd1 sd2 sd3 sd4 xd0 xd1 xd2 xd3 xy0 xy1 xy2 xy3 sh $this cd0 st0 st1 rd0 sh $this fd0 fd0B fd0C fd0D fd0E fd0F fd0G fd0H sh $this uk0 uk1 sh $this ss0 ss1 sh $this pty0 vnd0 vnd1 vnd2 vnd3 audio tun0 tun1 tun2 tun3 sh $this ccd0 ccd1 ccd2 ccd3 sh $this bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 sh $this ipl sh $this bwtwo0 cgtwo0 cgthree0 cgfour0 cgsix0 sh $this cgeight0 cgfourteen0 tcx0 sh $this lkm random local sh $this xfs0 ;; floppy) sh $this std random sh $this fd0 sd0 sd1 ;; ramdisk) sh $this std random sh $this fd0 sd0 sd1 sd2 sd3 rd0 cd0 sh $this bpf0 ;; std) rm -f console drum mem kmem xf86 null zero io tty klog stdin stdout stderr ksyms rm -f eeprom openprom tty[abcd] cua[abcd] fb mouse kbd mknod console c 0 0 mknod tty c 2 0 ; chmod 666 tty mknod kmem c 3 1 ; chmod 640 kmem ; chown root.kmem kmem mknod mem c 3 0 ; chmod 640 mem ; chown root.kmem mem mknod null c 3 2 ; chmod 666 null mknod zero c 3 12 ; chmod 666 zero mknod eeprom c 3 11 ; chmod 640 eeprom ; chown root.kmem eeprom mknod openprom c 70 0 ; chmod 644 openprom mknod drum c 7 0 ; chmod 640 drum ; chown root.kmem drum mknod klog c 16 0 ; chmod 600 klog mknod stdin c 24 0 ; chmod 666 stdin mknod stdout c 24 1 ; chmod 666 stdout mknod stderr c 24 2 ; chmod 666 stderr sh $this ttya ttyb ttyc ttyd sh $this cuaa cuab cuac cuad mknod fb c 22 0 ; chmod 666 fb mknod mouse c 13 0 ; chmod 666 mouse mknod kbd c 29 0 ; chmod 666 kbd mknod ksyms c 122 0 ; chmod 640 ksyms ; chown root.kmem ksyms ;; fd) rm -f fd/* mkdir fd > /dev/null 2>&1 n=0 (cd fd && while [ $n -lt 64 ]; do mknod $n c 24 $n; n=`add $n 1`; done ) chown -R root.wheel fd chmod 555 fd chmod 666 fd/* ;; bwtwo*) rm -f bwtwo$unit mknod bwtwo$unit c 27 $unit; chmod 666 bwtwo$unit ;; cgtwo*) rm -f cgtwo$unit mknod cgtwo$unit c 31 $unit; chmod 666 cgtwo$unit ;; cgthree*) rm -f cgthree$unit mknod cgthree$unit c 55 $unit; chmod 666 cgthree$unit ;; cgfour[0-9]*) rm -f cgfour$unit mknod cgfour$unit c 39 $unit; chmod 666 cgfour$unit ;; cgsix*) rm -f cgsix$unit mknod cgsix$unit c 67 $unit; chmod 666 cgsix$unit ;; cgeight*) rm -f cgeight$unit mknod cgeight$unit c 64 $unit; chmod 666 cgeight$unit ;; cgfourteen*) rm -f cgfourteen$unit mknod cgfourteen$unit c 99 $unit; chmod 666 cgfourteen$unit ;; tcx*) rm -f tcx$unit mknod tcx$unit c 109 $unit; chmod 666 tcx$unit ;; audio*) major=69 audio=audio$unit sound=sound$unit mixer=mixer$unit audioctl=audioctl$unit rm -f $audio $sound $mixer $audioctl mknod $sound c $major $unit mknod $audio c $major `add $unit 128` mknod $mixer c $major `add $unit 16` mknod $audioctl c $major `add $unit 192` chown root.wheel $audio $sound $mixer $audioioctl chmod 666 $audio $sound $mixer $audioctl ;; xfs*) rm -f xfs$unit mknod xfs$unit c 51 $unit chmod 600 xfs$unit chown root.wheel xfs$unit ;; openprom) rm -f openprom mknod openprom c 70 0 ;chmod 600 openprom ;; bpf*) rm -f bpf$unit mknod bpf$unit c 105 $unit chmod 600 bpf$unit chown root.wheel bpf$unit ;; ipl) rm -f ipl ipnat ipstate ipauth mknod ipl c 59 0 mknod ipnat c 59 1 mknod ipstate c 59 2 mknod ipauth c 59 3 chown root.wheel ipl ipnat ipstate ipauth ;; tun*) rm -f tun$unit mknod tun$unit c 111 $unit chmod 600 tun$unit chown root.wheel tun$unit ;; fd*) umask 2 ; typnam=`expr $i : 'fd.*\(.\)$'` unit=`expr $i : 'fd\(.\).*'` case $typnam in 0|1) typnam=; typnum=0;; # no type specified, assume A A) typnam=; typnum=0;; B) typnum=1;; C) typnum=2;; D) typnum=3;; E) typnum=4;; F) typnum=5;; G) typnum=6;; H) typnum=7;; *) echo bad type $t . ..MAKEDEV MAKEDEV.local0console tty kmem  mem null  zero  eeprom openprom drum klog stdin stdout stderr ttya ttyb ttyc ttyd cuaa cuab cuac cuad  fbmouse  kbdksyms  sd0a !rsd0a "sd0b#rsd0b $sd0c%rsd0c &sd0d 'rsd0d (sd0e )rsd0e *sd0f +rsd0f ,sd0g -rsd0g .sd0h /rsd0h 0sd0i 1rsd0i 2sd0j 3rsd0j 4sd0k 5rsd0k 6sd0l 7rsd0l 8sd0m 9rsd0m :sd0n ;rsd0n <sd0o =rsd0o >sd0p ?rsd0p @sd1a Arsd1a Bsd1b  ... . ..'boot܀(bootxx) installboot*binstallݐ . .. tmp#!/bin/sh - # # $OpenBSD: MAKEDEV.local,v 1.2 1996/05/26 10:25:15 deraadt Exp $ # # Copyright (c) 1991 The Regents of the University of California. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the University of # California, Berkeley and its contributors. # 4. Neither the name of the University nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # @(#)MAKEDEV.local 5.1 (Berkeley) 3/22/91 # # Local device MAKEDEV script. PATH=/sbin:/bin:/usr/bin umask 77 for i do case $i in *) echo 'MAKEDEV.local: no such device.' ;; esac done  @ 7y   @@7yҪ@@P^<@`bT U7y(A@7yHN7yM]7yM] H!A7yx7yx7y S@ /&A7x 7U_7yM1dp K6A7yn7y '+7y '+ Mٛ7y ' 07y '+7y '+/tmp m<7yMH7y /07y /0 ` +~m 7yL)7y 5XWp7y 5XWp QOO!7y 7y 7y LW!7y 7y 7y z mv!7y !7y !7y ,8^mC!7y .Ȑ7y .Ȑ7y 4%X†!7y 5V܈7y 5V܈7y 7 P-C!7y 8Qh7y 8Qh7y :u0  !7y ;L`7y ;L`7y N8!7yد7yد7y ԰Fw!7y :7y :7y0@e!7ya7ya7y+fog!7y\7y\7y&q !7yW7yW7yr z!7yRs7yRs7y !7y-7y-7y2@ B!7y9g7y9g7y ҃!B!7y`7y`7y e E! B!7y[>7y[>7yӸ IB!7y+ʽ87y+ʽ87y0Q u,B!7y8Nð7y8Nð7yxX \B!7y 87y 87y d8 UB!7y#{7y#{7y q&B!7y`7y`7y!7y7y7yʈ ; !7y!7y!7y"اb~L%!7y$ ̰7y$ ̰7y)fz]V|a7y1&i7y1&i7ykVx)~!7y2!p7y2!p7ya7y67y67ykVx^!7y707y707y}a7y:(7y:(7ykVx6=;!7yEX7yEX7y2dPa7y@87y@87ykVxצ!7y 7y 7y4a7yc7yc7ykVxh!7y 6(7y 6(7ys`ja7y 1f 7y 1f 7ykVx,!7y bP7y bP7yՌa7y]hH7y]hH7ykVx\!7y' 7y' 7ydoa7y"7y"7ykVxr!7yS& 7yS& 7ynDa7yN7yN7yD!7y(H7y(H7yja7yz@7yz@7y r3<!7yC7yC7y OvVa7y">7y">7y +6!7y#o07y#o07y xa7y&j(7y&j(7y !7y'X7y'X7y }a7y*87y*87y DV!7y,`Z7y,`Z7y  a7y/[67y/[67y !7y0\(7y0\(7y qa7y39 7y39 7ynDB!7y5P7y5P7yxbda7y8K7y8K7y\8!7y9|7y9|7y_a7yZ7yZ7yrzM!7y7y7yrQa7y7y7yrB!7y7y7yr}>a7y7y7yrj !7yҐ7yҐ7yr0a7y(u7y(u7y9wp%^H!7y*-7y*-7y9wp%jjOa7y.%(7y.%(7y9wp&^|!7y/X7y/X7y9wp&ڑNa7y47y47y9wp'6@ U!7y777y777y:'f[a7y@7y@7y9wp(R!7y 7y 7y:(XEa7yO@7yO@7y9wp)ɖ3!7y 7y 7y:)!7y%2p7y%2p7y205d a7y)^7y)^7y206*Y]!7y+'`7y+'`7y206yya7y/S̈7y/S̈7y2074!7y1P7y1P7y207ka7y5I`7y5I`7y208KF!7y7B(7y7B(7y208Ea7y= 7y= 7y209Uˇ!7yİ7yİ7y209JTGa7yYp7yYp7y20:=@.!7y87y87y20:#a7y H7y H7y20;Zy!7y7y7y20;Iƙa7yOc7yOc7y20<a!7y7y7y20<Qa7yݰX7yݰX7y20=r!7yh 7yh 7y20=a7y l7y l7y20>B!7y"57y"57y20>-\a7y&MP7y&MP7y20?J: l!7y(7y(7y20?/"a7y;=h7y;=h7y2`@:}!7yI7yI7y3{]@a7yX7yX7y2`AL !7y7y7y3{]Aٞqka7y 7y 7y2`B3!7y X.7y X.7y3{]BdM8a7y랈7y랈7y2`CQ-!7yM7yM7y3{]C#a7yXx7yXx7y2`D!7yC7yC7y3{]Dua7yo7yo7y2`E*!7y`7y`7y3{]ENoa7y#p7y#p7y2`F@!7y&`?7y&`?7y3{]Fga7y)`7y)`7y3{]G-!7y,U7y,U7y3{]G Òa7y/iP7y/iP7y3{]Hk !7y2K7y2K7y3{]Ha7yka7y7y7y !7yb7yb7yDU(*ha7y?7y?7y iZn!7y d7y d7yDU(*VlPa7yA7yA7y _?!7y7y7yDU(*u(a7y"ֈ7y"ֈ7y !7y#7y#7yDU(*%a7y&ܘ7y&ܘ7y ]!7y(`7y(`7yDU(*Ha7y+qX7y+qX7y n!7y,떈7y,떈7yDU(* (xa7y/s7y/s7yDU( j!7y1+H7y1+H7yDU(* J5a7y4@7y4@7yDU( H!7y5-p7y5-p7yDU(* aza7y8P7y8P7yDU( @vOJ!7y:7y:7yDU(* a7y7y7yDU( Z!7y1@7y1@7yDU(* &.a7y,87y,87yDU( N5@!7y^h7y^h7yDU(*zloa7y o7y o7yDU( X#!7y "(7y "(7yDU(* /a7y7y7y1 ŽE!7y~7y~7y1*M}a7y"[7y"[7y1 Ӵ{.!7y#7y#7y15x*a7y&a7y&a7y1 W%!7y(x7y(x7y15x*Pa7y+p7y+p7y1 W+E!7y,7y,7y15x**Wa7y0}07y0}07y1 !7y1`7y1`7y15x*37a7y4X7y4X7y1 nR!7y6sE 7y6sE 7y15x*4Gga7y9n"7y9n"7y1 ak!7y:K07y:K07y15x*a7y^(7y^(7y1 !7y7y7y15x*a7y7y7y1 y!7y7y7y15x*<̤a7y 7y 7y1  7'!7y 7y 7y15x*ܛa7y7y7y1 ԭ !7y7y7y15x*ۤpya7y7y7y1 /!7yG7yG7y15x*ia7y$7y$7y1 b !7yI7yI7y15x*m(a7y&7y&7y1 T!7yސ7yސ7y15x*a7y!7y!7y1 ~!7y"7y"7y15x*ua7y%7y%7y1 #5!7y'y`7y'y`7y15x*H@ < " @5 @ @@@@p@ ' @f@c@N L  @f@c& ) L@A@ 2  @'@ 2  @g@`f@6˒c f @6Œc  f @6c "  @g@`@   #\ @g@ `h g p@@ 2@` #\@@`%@#  g xg@!` g`@T  @~& ?  #  g@ڒ`@:Z@I,㿘N@ n N` o `@ 'h`? @⠒ J@ n J` o  `@  "  @  " @{/usr/sbin/sbinrealpath %s/statfs %s%s on %s type %.*s: %s already mountedforceupdatemount_%sexec: mount_%s %s fork%s/mount_%sexec %s for %swaitpid%s: %sh@N `h#h#  O@ f#h#@2@גh@5ђc \@( %@h Ґ@5 Z @5  # ƒh# h@!c h@cf@c@h@ch$h@CԖ'dh& 'dd@d* &  'd* &  'd* c`&i @ Ԓd 6i3i, @ ɐ`d , i@  n @?  0-i@ː (@z^ !h;i9 7i$`0@C@Ւh# @@   # i @@@~ @z}`@N `i@ P+   >  0"  !i@K X@v #  h@ h#@p @ %s on %s type %.*s%s%s (, %sunknown flag%s %#xs) 㿘j   L @ 3 < V >@ j )j'j  @" ? 2  @ ,@ ` `j j j @j h# @j i @㿐@'  @6 ,`@4u  @4n L `@ 㿘  #`?@4,    #@ empty type list㿘  N  n j@c  N  o  "c"#  @'Ӓ , `  @yS*  "` @ӄ $@  @' , , *@`$@ $@%s,%s㿘 L@ @|@| @y'  @Y k(@B1`@ :`@y8-o㿐@'h%fk ', @n⠰ ""&@N " -& @'j = . & @3 &&ݠ usage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special node[-adfruvw] [-t ffs | external_type][-dfruvw] special | node㿘M Hkkkkkaؖ"@U;b@@|H ufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %s㿘 g@3D`p  g@`h 2( @: "" @33  k @3-b kf@3&cX kk@"  " @  ,-o %s: option not supported㿘@ a  @p k@Oc蠒 5L n L  o  @& = 2*@ "  2   @2    &*@&kc@Ƞ @x#㿘@㿘@C@@{ 㿘@/@(#)cl_bsd.c 8.29 (Berkeley) 7/1/96@(#)cl_funcs.c 10.50 (Berkeley) 9/24/96㿘;! ?R$ 2!1; @ 4  H @"  1;? @21;  @;  ;! @"`1;!@͒?  !"  smcuprmcup㿘 ` $`"0$0K!܀ 8 !`$!ܐlb@^!! + 'x 'L! $!ܐlb@L!!  x@SdL@o#L !  "! x@?dL@o|# ;!@"`!" @x 㿘  $@Gݐ! "&"X K"""X 2 ! n  !!,""X    !"X$"&@ "X!&@ 㿘$ 2*  !̀ " !!đ*`  * @`8  0 @b 0@ 0 " !!đ*`  * @`8   m`@y& 㿘;@, !: `?;"?P"@;"?P"@ H "@ 㿘䠀 2@; );!`?R@;!?R;!@4@H ? @~ ?;!?  @ ;!@p;!@?: `?㿘 ` $`u!   ! o bt @u x@Sd! L`?"`` * "@ Ő ! x@8d0J  !L#`?`&``@ #* $#@   $`  !L#`?`&``@ #* $#@   $`L`?"`` * "@ | L@n1#0@v 㿘;!@7 : `? `$ ``" *`?*`?*`?*`?" Error: move: l(%u) c(%u) o(%u)㿘 H;!@֥@?   n H@ 㿘  $!  `";;!@$ ;@C!: `?xterm]0;%s㿘  $ \!  nb@0  n"! &!!  ?&!n"@L@m# `  $ &@$ ;!" @pHȐ  @! @wɒ !"U  @Q !`?R@;!?R  "t3;a@&@aa@Ђ   @  @q! @w ! " ! ?$$!` a@e a@i    @ Ā    "   $a!"a %susage: ex [-eFRrSsv] [-c command] [-t tag] [-w size] [file ...] usage: vi [-eFlRrSv] [-c command] [-t tag] [-w size] [file ...] 㿘M Hooa@@QeH@(#)cl_main.c 10.36 (Berkeley) 10/14/96TERMunknown]0;%s㿐@@gcА  "c@uz@b@@z"`o@u\" 2o"(@@$ \ $ `@  @ L@x0 #   $ H$ D$ <@G$ 8@ؒ "@x @@4@؀  @`? o"0@@l @v{ @v@v@w㿘@ǒ / 2  @P͒( 2&@U &/dev/ttytcgetattr㿘 @P!䰒 2$`$@@? $`$@mK "hT!"&! $hT!" @o!?"@0p @ @E ?@n!?@p@`P@w @v@ѐ%s: No terminal database found %s: %s: unknown terminal type 㿐 @?  M0M HpaH@Pl@wy  Hpah@Pd@wq $  ᤄ  $@ $  ᤄ $ signal-reset㿘`4 $3 &` !p@T 2& !` p$@I&` 2 !p@`  @=&` 2 !pd`  @1&` ", @ '   p@$   p@$   p@@    p@ d  p@^ 㿈'''@u㿘  $ @u!  @u!  @u!  @u!́l"(Xl"(\m8"(`m"(d"(hm"(lm"(pm@"(tq"(xm<"(|w"(n8"(n`"(n("("(w"(n"(n"(s"(n|"(ó"(%s:%s 㿘M Hqap@Ox`@Or # !q@!x@Oi@vv @(#)cl_read.c 10.15 (Berkeley) 9/24/96㿀  $! @ ! @ ?$!Q O   I !E  >$! @䀢 @  @/  @lŒ#'@\#* "@*`@*`'0!@%`q#`*` tnjǘ$Ǡ&` &` &` &`  @s' input $a" @t@2'°  p @u̔ '`'   p@@$'p? `0 `0, @mȀ 2((T` Ȑ ̒ Д''? '''''''''  a\@B(T @ p @u p 'p   @ " 2`* ` (  #   42`p  @$u ?& p@r   @Mt Ǡp8 @t`2a  1$a a . '  #    q@  @ ? "' a*@`'$a   @ʔȁlines=%lucolumns=%lup''''''$r @:{@t'@v 2 $r0@:j@tѐ'@f @ @(#)cl_screen.c 10.49 (Berkeley) 9/24/96㿘 (T   $@l 2g (T ?$(T``$ 2] `$ 2W $  ?&$$  ?&$ @   H 4!;!@ @i! H  4!;!@ @@ֱ!`)@z 2. a $a$ "' a`"# "   " *`  * @`8" ? @  x@ϔd  @Z  a ? $a 㿘`$! " @ 2 ! ""2!@  2 ! "" @ 2   @!! ?$!016|Vi's standard input and output must be a terminalTERMLINESCOLUMNS%s%s: unknown terminal typetcgetattrtcsetattr㿘  $a 2 "@i   s@  >@E "#  " ##* @ *`  8!s"@q @| !s"@q"` " * @ *`  8" @h !s"@p!`` !X* @ *`  8!X@T ! $# Lc@ `#  sؒ s@&^  s@" s@ސ"Ȁ2 s@ؐ" Z@ !;@@4!@ !@?  $aܐ @r  @j֒a\  s(a"$a\"$a\a$ a\$$a\ ,aw,au,av,a{,az,a~ah`@$ah    @ a\   s@@   㿘!;! $@ !  !@Г !@? "t !@Њ@F!@@X&!܁ cupsmsormsoelcuu1㿘  $! 2Q "Ttb@^!tb@Y!tb@T!tb@O!tb@J!!` ! 2!`@o} $!! "!@ov$!!!!,$!0$!4! $!X!$!8!$!<!$!@!$!D! $!H!$$!L!($!P!<$!T!0%$!<a!4$!0 $!4  @w!0   s@: 㿘@# $ 㿘@ " @r "  @o  & @  @st 㿘! "!@o&!! "!@o&!! "!@o &!! "!@o&!! @n&!%lup` А (u@7ݔ@  @(#)cl_term.c 10.22 (Berkeley) 9/15/96PH80(ذبؠؐ؈؀ph`H@8( װרנ׈׀xh`XHcursor upkkcuu1cursor rightlkcuf1delete to end of screendGkedscroll upkripage upkpppage downknpcursor lefthkcub1delete lineddkdl1insert at cursorikich1go to sol^khomego to eol$kllscroll downkinddelete to eolDkelcursor downjkcud1delete characterxkdch1insert lineOkil1 `H׀ٸhlakahaja㿈u"8  (v   @ ""@q8@q5@q2#\#`#d@ 2   v!X  4v+   @e "&"# b b`@ 2``"@p@p` #\#`@#d 2b  ը v!h  "C    @/ "6"3v@(a؀ "- @p@pɐ #\#`#d@p@p@p#\#`#d@l   Ũ  !D " $ "      @< 2 $ 㿘!D`  `$ @@ 2 `$ 㿘$   " @ kf%d233|This terminal has no %s keyfunction key %dH#w@ap @@5@  " @pE ` `  w@x !w@y! @@5Ĕ ?8 ?@p'#\#` #d@ܚ㿘 ` $`>` `" (T0,`I"0' (T`"(T$ ? &$ @0`?0  ! #!! #! ` ``  stderr%s046|messages not turned on: %s045|messages not turned off: %s8@|    = w@W8 @># 6 a؀ / w)     &a؀@` 6  w?c@ 6   w@  TERMlinestigetnum: linescolstigetnum: colsLINESCOLUMNS㿐  '  `h@nh?`- ` 2m'0ke" " " " *`  * @`80US!` " !X!X*`  * @`8@܀0C`( x@lh! ! `x@W! 6  x@`` x@G! 6  x@( " `" Px@l=!8  @ x@l4!@  @ 2&2& 㿘L#`? "`` *:  # * ##@А @(#)cut.c 10.10 (Berkeley) 9/15/96㿘 @?  @  2 @M @ܐM" `   M" I * M" `  I *   !@  `    2 0 2  1  2 1@"  1@M !$  @Gw  2,  @   $ $  !@ $ !@"  "!@ !@$  @? $ ,  "  , @8>   @ Z`@/ @"   @ E   @ ;`@ @  @{ (  "! M" 2  1I  e 1 !@  `  }  2 w  q  @ϐ $ ,  㿘 !@ @2z  2 3 4 5 6 7 8 9 `?π 8!@* DLT\dlt|*`*` *` *` *`*`*`*` @`2 ` `"  "`  @"@j5㿐 @z# 2(  @F    "" @l@&  & &  @2 ' "'     ' 㿘!@  "@F `"  "` @i"!@ 2 !,!,@0㿘 @FC <  @Ɣ  & @i &  @   `@i  @lH& 㿘`& "`@&"@ @2@㿘  @i@i@(#)delete.c 10.12 (Berkeley) 10/23/96002|Line length overflow㿈 -@ '@yސ  d d@R& d  (T   @v   (T @? ' @{6 2 @*z  @y6쀢 2 쀢@`? i#@@y _ d d@R^& d  (T   @vX   (T @? '@ @y쀢 2t     T!"``'@Ӕ耢"x( tt@Ɣx "Q &ttxT'!&T`@ki@`@zN * < @ 2R` @x쀢 20     T!쀢'@耢ޠ`x t@x " &ttxT'!&T`@k$` `@k" @`?" @y# ֢ Ԣ `6 @xj 2ް     T!"xa'@=耢a t@1x " &ttxT'!&T@jԔ @x4쀢 2 쀢 ^?@Z" @  z@ `    T!" x2'@*  "TtTx >&T  t@ܔx "g &ttxT'! &T@˔耢  `@jp" ?" @@@yP , #@@x7 " d d@P& d  (T   @t   (T @? '      ` `thT >"hT@g@(#)ex.c 10.57 (Berkeley) 10/10/96script 170|Interrupted㿘`@b "lذ   `"  "` "@@gc @gal 2 T  $|#$* ?# pd@ @2d`L@ d $d@< a< "a4a4*` `* @`8 2 @ b " b @ b "bbؑ*` `* @`8  `x` :hT ?@]`#hT 2q `(T   @t?  `(T  |@<c@<U @j^`x` 2`|#$ $`$ $@ΐ "`T 2= `(T   @t   2T`(T   `|(T @#(TT 2&d  &$d @jg 2 @l&@ O$ !#&*<=>@~080|Unknown command name1bca1082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discardedx  `|` "`` &a`&a`@ @w L  P & P`*@$`` @ `Qa &a` ` $`  *@$``Q  3`@iP `@$` 2 ` $```J  a &a`  $`  2 ` `` $``$`` :2`  ``$`J`:`? $`` ""2!` ?` $`J  "``? $``J 2`|`  `$```$`?u$`` "``J@ ` 2 ``$`? $`` 2` $ `("`@    `|` " 'J` @`   `J  *@$`@ 쀢   쀢 2 4``  `J " ` "`:2 `` $``$`` {`J`|u` s}@g#@  ``$`?"$`` `M"`   " ```?$`` $``2  }@ߔP` ?* : `h",*`  x'LJ@ 'JJ@J l p + - ^ #%`$`$` `" $`@ "!$`!$`$!$`(!$`,!$`0!$`4$`8}#pa$`0 I`*   ,@ c S$` L k s 0=; !`$` `$` ?$` J c" g" r `$$` `" $``"$@$`$$`$$$`($$`,$$`0$$`4$`8Ȑ"t$`(G b*  ,@ "`` !(@ $ `$`  ` `! "X@ H@  `  !р `  ""` #X "#P#P*`  * @`8 `   ` @@` `#@@ 0L < 0@2!` L >2` ` L`J ``?$`` $``@" 2`` "@ 2 "@2`$@2`%(`*@"X`$` (@`` $`$@2 ` $`` L $`d P$`h` $`" """*`  * @`8 2` ` " ``@ `|$`b4`|@*@$`$ "` ` $ " `  }@~OxV` `  $` >$` `` $` @  @h@@t8` $`J@ ! ``$``|?$`a`4`|$`` "``J "`  ``?$`` $`` "``J@ +2```$` ? 9$``J`@ 0 `  'S  0 'R@@oG  `  ?`$``$`J`  " `,` `?$`` $``"$`@x@P@/X` ``J\ `` J   `$``$`aJ` &a`  $` "`,` `?$`` $``@Ȁ@6` ' `J  2 ``'`?$`` $`` ~!2}`` #@"`쀢 "s``J "n```?$`` $`d`@2a`` "``J "` 2 ```?$`` $``M" @  *`: `|2`"Ȓ`$$$` $$`$$$`($$`,$$`0$$`4$`8Ȑ"t*$`( '$``  ? $`"``J@ \2 `` `$`?$``J "``?$`` $`` @``J @ `W``J`@ 03 `  'S  0) 'R@%@n. ! `  `J  '쀢 |2%, 2 `a &a`  $` ``$` $` |2, 2``  $``? $`,` `?$`` $````  $`$```$`#"@ "@ $`   L \", ` `"h`` `` 71`` "`   "$``` "`l` ` $`@s>耢 2M`耢 2 L`$`d $` L$`d Pf$`h$```p$`da$`h ^ 0*`` ' @$` $``  $`l@s`l 2"``   `l  `$`d $`$`d$`p`$`h 5$` "* 41` 2.`  $```@$` L 2$`l` @r耢 2`耢 2  L$`l`$`d $` L$`l$`d P$`p $`h`d$```h$`l$`p2` ` "Ȁ@2,`  $`` L $`d#4   L#,*`  * @`8#,$`l P$`p@r$`h 2`耢`" `  L@(` `l 8$`l` $`\ L s ?#+`!` "f `J@ !2a ``$``|$`!W4`| "``J "`  ``?$`` $`` "G` ?ϑ* : `F!#*`   LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLTLLLLLLLLLLhLLLLLLLLLLLLL@LLL` " `J ^"`\ l +"`\ - #"`٠ " `\ՠ  p"`|Ϡ  $`\?$`\`| $`b4`|( "`|$4`|($ 4`|( %(``?$`` $` ` " `J ."`| = + -" `|  ^" `|    @`| ( L 32 `| 4`|``?$`` $`z `J + - ^ #2 `@  1 2i ` M"@  2` `,`Q` $``|$` T4`|` M"@    L +2H *`:  + -2A `J - +`| `| 4`|`@ߖ \䀢L 0A``""@$`$`L a2 $`X`l`p$`d$`h ?$`l`|  4`|``@ ڀ @쀢 쀢 0܀ `@p $`T` ` "`@ @ `? ````'`>``@J 0 `  'S  0 'R@@kN  `  ?`$``$` `,  2 ,`` $` $` ``?$`` $`@ $ 2`` "` `J `  `?$`` $`` "` ``'`5``@J"`", `   'S "`, 'R@@j 2,`  ?`$``$` `,,` `?$`` $`$ @ E 2m``````@  b L NS?'L  o$ "L`` 2@` G``} c`  * *  !X@*@i:` @y0 L  ` "``J  $` 2``? $`` 2 ` ~@` " ```  ~@y ``` - 2I$`l```2$`d$ @2`d`   @o 2`d`|    @oҒ耢 2`$`l`d```$ @2$`  Ȗ @o 2$    `@9@3 22```  2'``l` L 2`l` "``l`d` L 2`d` " ``d " & L& P L@ P``$`}$``@ ' L' P '`+@ @w$` 2q`$ "  , & ,  $@2`@p#` @"!`   "`$ "`hT 2`@ ` "Ȁ@2`h|€ ` *@$`` `€ 2hT (T 2hT  @jm  2$ (T " $hT "`$$&$ " @y  "+$`\"'$  L @ ~@w0`:`    @n@ 2  L ~@wX` L`\ & L$ L  H L D`|`:! @4`|`@@?`|! @4`|`|b  "$@! "!!*`  * @`8 2`  ` @2"  L '@0Q'􀦠7`@J? "` ? `   'S ` 'R*`@hړ:`  `$` *` $```" $` @_$`` $```$`$`$"@S   |@0 h+~)~ `P "*          2@  @w1`@2 @  @w' @@\@`2 `P mk $"@2v'`| }@w ` `}@xK `     @I` 2?`` ";`!``J@ $` 0 `  'S  0 'R@@h<  ```$`  $` |2 ``   $``? $`` `|`@ ~@v@@k<   ~@v0 '&a$*@&$094|The second address is smaller than the first㿈& ` &``#' ` ?* :  2* %&&&&&&&&&&&&&&&&&&&&&&%&&&&$t&&&&&&$&&&&&&&&&&&&&&$`2`   @m*`l à &`p&`h&```l`@ &`d``&`?&``2`   "``` " L  " L`" `l`&`d P&`h &```p&`d&`h L&`l P&`p&```J ; `` "`d  `   `@[& L`h`l& L`p& P `` &`7&`@ 2  }쀢 + Z`` "   ` `&`d&`h&``&`l&`p &```l`p&`d&`h&`l&`p ` 2$``@2M ;`` "2 L   02"&`l.`` L&`d P&`h'&``  @͖ .   @ǖ (   @ ! !   @  `p&`d&`h L&`l P&`p &```` 2 `l`d@ @uQ & $0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0㿈'&`* &`  `J@| @     @c '` ?ܑ* : `8!`*` *D-,-,*-,-,-,-,-,-,,+**********-,-,-,-,-,+-,-,-,-,-,-,-,-,-,-,-,-,-,-,-,-,-,-,-,-,-,-,-,-,-,-,-,-,+| &` &`@k& 2 ` & `` @4&` @ m'&&``""@&`&` &` `@ &` @tXR'`J`@s  "`G'` &`m`  `J  / ? @tnx[ `` &`&`J /##H L& P&``@@`!p p#\ 6 ``""@&`&` &` *&` & P& L 2&@k% "  "`&`  M`b    +*`` &`&``  `J@ ` 2 ``&`? &`` "` M"@  2 *`:  + - ^2 %M & L& P&#` &`` "|`J@ ` 2 ``&`? &`` "j` @  2 `*`:  + - ^2Y`   2`   2 `+2? ``?&``&`J`-`^  &`` ?&``@  2  ` " $   ` $ :  T `$``" " &`&`  " 6    @sJ7 :   , & 㿘$ *@&$|@2 ``@k @X7`f$` 2d `P @`<`<  @`<@ $`@"` @$`<"@@X`<2 `<2+`H `P `D`@i " `D@i L " L(   & L@W`H@`"``"``@@W"|`L$`@Zp `L$` & L$`D $  `P $ &$ 㿘 `|`"2`| P  < <@& @"`@& <"@@W  <2@W H`"  "` @W"`|2 P`|"  098|The %s command is unknown㿐     (T!" x'@W1,@  t@K x %$ t t x(T'!$(T,@@Y @s`   ` `t@hT >"hT@WE㿘 @%@ #@%@ 㿘@ J? !   @ @ @`?㿘"Ȁ`"LJ@4 2  @   2 099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0㿐"     @q 0B @q0< @q07 @@RҔ 0/.#P. 7d77|77А @q~0@hq   @qkH0 @W @p@qa@(#)ex_abbrev.c 10.7 (Berkeley) 3/6/96105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end㿈`x  "`t0 @ 2u  @q  n @V`@ ?M"@  2 `t`_ W@`t "`t   Ex  `t `M" @   `_2      _@  @ ?`t@`   #\#` @#d 2  hT  "hT @p 109|"%s" is not an abbreviation㿘 `t(T  @@`@J "   @@q @(#)ex_append.c 10.30 (Berkeley) 10/23/96㿘@ 㿘@ 㿘@  273|Entering ex input mode.㿐   ` @z `d & L`22``d  `d`lҘ  2ְ 붖  2ΰ ` D`     2$$@$   .2 `! ` @eŘ$ ,  ` @e 2 Ŗ2&`&`$@y``(€   ` @ @Q s $2` ` &$@*Z`` @tǔ @*R@*N`@*q`|!3! "!!*`  * @`8 2`!< "!<`!< "!4!4*`  * @`8 2`@ `@ @W '' @J֖ 2 @````@e7  2 @@` & L@f#   & L @(#)ex_args.c 10.16 (Berkeley) 7/13/96111|No more files to edit㿘`x `( "  2` MH`!`x 2`( @W@  @|@|x`| @\ a q `x "J`(d@2$`(`$ "$`(@T   @T`$$`(d* $d`x @0c   $`$  @nF `t  @0 $   $`$$`(@TS  d $d @TH d@  2`|!  $ @T    "d`( $`(d ($d㿐 @` 0 @ `t@@T@  `| 2@T   @ @ @  "$"( "$ $ $$112|No previous files to edit㿘`(`$@2 ` @nN5 !@V@ ' @"`| @\ a  `(?@S  `|!  $@T4   `( d$`(($d113|No previous files to rewind㿘 $  @n! `| @[ a   $$ (@S  `|!  $@S   $ $$114|No file list to display %s%s%s[]㿘 $   @mÔ0PG " )@V (  8@ ?@   b b@(> ("("0 ("8"0@(  (T   @_ϖ  2  (T   @(b 㿘` `x @.ߒ   @mb `2`t@U@ &  @ "$@ $`@  $@(#)ex_argv.c 10.26 (Berkeley) 9/20/96㿘  @[$ $ &`t $&`x 㿘 @P $ * @@T $ * @* $ * @"  $  $ $&`t $&`x x    "'(T!" x'' @ߖ" "e '쀢!  t x@Ӗ" "Y $ t t x'(T'!$(T'#\#`#d@˚     t@T >"T@Q/   @@ J@ "` @ `@ *J@@ z    t@T >"T@Q echo x  ` "'(T!" x'' @b" а '쀢!  t x@V" 2$ t°  t x'(T'!$(T P*P *  *  * +  '@ #\#`#d@9   3@z  W  4@z  P cp " chch* @`*`  8L  M"*`:    @   L   J  ,L@[   1ML`  `  "  2@A   'L * ,@@b   @` ` t@T >"T@P㿘w )"tN  "h `N  0 `  'S  0 'R@ @\ؒ     آ`@$*` "  `(`" L " `   'S " 'R *`@\:` 2  ,ܠ ,$ $$&`t$&`x 115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #㿐\`d'@+N #"`  % ! `@ \`"`  "@SE'@    "(T t(T x >@  '(T t x@ " ' t t x(T'! '(T@ @ ֠O  Đ@S @'    "(T t,@@R@'    "(T t(T x >@  '(T t x@g " ' t t x(T'! '(T@ @U @Q`?&`( `N % # !2``'    "(T t(T x >@  '(T t x@$ "a ' t t x(T'! '(T@ @ E ,#`'   `"hT`thT`x >@  &hT`t`x@ - &`t`t`xhT'!&hT@@ޖ      @@i  ,'@%` #㿘 ` `$@&#`` @N, $`@N, $` 2` @i ` @jC`  P* @R$$` `, 2` @+ ` "@ @i ` '`, $  ` :& $ @Ni $@N$ 2 @iu  2 $ $  ,  @ih    , `, 2` @*ђ ` "@ @iR ` `,  " 㿘   "$    . `"  ` " @N>@ @N;  & @N4 $ $ $ $ ./%s304|Shell expansion failed㿘@x /    2,  @Qd @Q`@X 2 $ @j3^ @ 7 D L .@QE@QA@ @ `$* @ @Pa M@ / /, @PS`$*`  "`$ $$&`t$&`x@$  "@ <. @Đ  @h 㿘@@8@289|Shell expansions not supported when the secure edit option is setpiperfdopenvfork-c118|Error: execl: %s119|I/O error: %sx'D'H'L'P#X D#P*`  * @`8 D DP D 0`D cd  Dc\* @`*`  8'\'@ / '''H@L'?''@{''  D @h @ c 'D @{*4D @g쀣`@  ?"@Op? @Oj @0 @Od@Ob@O` @Θ  D@i@P @OO ?  @ @  #@C耠9D` `  tL(TL >&(T@ x*   D t@ x "I & t t xL'#@(T!&(T*  D@r "4 'L@"'. `'䀦( .N?  2.?.P#@H  @ @    D@h  D @+4 2 ` N  ` `" D @g.@ @(#)ex_at.c 10.12 (Berkeley) 9/15/96㿘`|  @`Q @ *2 . $ @2  4 . $  &$M"   I *    !@ `  2   `*` *  !X@@W @H 0e@(I 5`<$`<$`@ @(A  -`d"`@"`l" `P " `P ,`P`<`<""`@ 2`<$`@" $`< @  ` `@  @K,  $` @f ( $`H`$`L*` @"  ``@N%`,`@   | $@  |"  " |   |$`@(#)ex_bang.c 10.33 (Berkeley) 9/23/96!!%s 303|File modified since last write.! 㿀`t` 2 ` `   @KR@L@ $  @f:  `@$@2```@@c ``@@ c@ `` L  "> X :!$ "!!*`  * @`8 $T  @T  "l $T "$L$L*`  * @`8 2$  $@c@j $@  @)`?:$ 2 `` @ @G  09 `d @`&``l @\쀢)  &`l&`d `d`l@@K#\$` & L& P L@ P$& P$ @2 @ /` @(#)ex_cd.c 10.10 (Berkeley) 8/12/96120|File modified since last complete write; write or use ! to overrideHOME121|Unable to find home directory location%s/%s122|New current directory: %s%s㷘  X "`x`|!2`x  J / @eE` `x  "`t0 @Jܐ# @w~@D "  J   @e"k @J@w 2`x_ V`t `/"O  `.G `.2 !H  .2 !H  /; :!H " !@!@* @ *`  8 ')N@ @ :2`.@(@Ԙ.@@w 2N@@<(  @f # N@ `ڲ` @e @(#)ex_cmd.c 10.20 (Berkeley) 10/10/96dh80߬("t`x`XB(01B(`x`p;1X@08(F<|;"xP80h (h (Bph`HLBph80X(X(vxph(`80( L`xpv0hPH;10ɤBҴx`(P( \B~~~Ҵ~~~~~X~P~H~8~ ~@d~}}}߬(}}p}h|}H} }(|||@4|||@4||H|8|(|{D{{{q{{`{X{H{8{01{zzޘ~Hzzzzzzhz`E8zPz xyyyt(yyyxypy0yx pxxx$xxxxxxxXxPx@xXx8BxpxMxwwwPdwwwTtxwpwHw@QTw0wwV4vvvj4vvvt@vvhvX;0vHv0v(v vuupuuuXuuXuP!uHutuPX(tttyttpthP$`t8t(t x$`sss$`sssxl$(sXsPsHs@srrrrrr# rhr0replace previous RE with previous replacement string,[line [,line]] ~ [cgr] [count] [#lp]~display different screens of the file[line] z [-|.|+|^|=] [count] [flags]3c01zcopy lines to a cut buffer[line [,line]] ya[nk] [buffer] [count]bcayankexit[line [,line]] x[it][!] [file]xitwrite the file and exit[line [,line]] wq[!] [>>] [file]wqwrite the file and switch to the next file[line [,line]] wn[!] [>>] [file]wnwrite the file[line [,line]] w[rite][!] [ !cmd | [>>] [file]]writedisplay vi key usage statement[viu]sage [key]viusageedit another file (from vi mode only)[Vv]i[sual][!] [+cmd] [file]enter visual (vi) mode from ex mode[line] vi[sual] [-|.|+|^] [window_size] [flags]2c11visualdisplay the program version informationversionexecute a global command on lines NOT matching an RE[line [,line]] v [;/]RE[;/] [commands]vdelete an input or command mapunm[ap][!] word!w1runmapdelete an abbreviationuna[bbrev] wordunabbreviateundo the most recent changeu[ndo]undorun the tcl interpreter with the commandtc[l] cmdtcldiscard all tagstagt[op][!]tagtopmove to the previous tagtagpr[ev][!]tagprevreturn to the previous group of tagstagp[op][!] [number | file]tagpopmove to the next tagtagn[ext][!]tagnextedit the file containing the tag[Tt]a[g][!] [string]!w1otag[line [,line]] t line [flags]tsu[spend][!]suspendsuspend the edit sessionst[op][!]stopread a file of ex commandsso[urce] filef1rsourcesuspend editing and run a shellsh[ell]shellset options (use ":set all" to see all options)se[t] [option[=[value]]...] [nooption ...] [option? ...] [all]wNsetrun a shell in a screensc[ript][!] [file]scriptsubstitute on lines matching an RE[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]re-edit all the files in the file argument listrew[ind][!]rewindgrow or shrink the current screenresize [+-]rowsc+resizerecover a saved filerecover[!] filerecoverappend input from a command or file to the line[line] r[ead] [!cmd | [file]]readexit ex/viq[uit][!]quitappend a cut buffer to the line[line] pu[t] [buffer]putedit the previous file in the file argument list[Pp]rev[ious][!]previouspreserve an edit session for recoverypre[serve]preserverun the perl interpreter with the command, on each lineperld[o] cmdperldorun the perl interpreter with the commandpe[rl] cmdperldisplay lines[line [,line]] p[rint] [count] [#l]printenter "open" mode (not implemented)[line] o[pen] [/RE/] [flags]openchange display to number lines[line [,line]] nu[mber] [count] [l]numberedit (and optionally specify) the next file[Nn][ext][!] [+cmd] [file ...]!fNnextwrite a .exrc filemkexrc[!] file!f1rmkexrcmap input or commands to one or more keysmap[!] [keys replace]!Wmap[line] ma[rk] keymarkmove lines elsewhere in the file[line [,line]] m[ove] linelmovedisplay lines in an unambiguous form[line [,line]] l[ist] [count] [#]listmark a line position[line] k keykjoin lines into a single line[line [,line]] j[oin][!] [count] [flags]!ca1joininsert input before a line[line] i[nsert][!]insertdisplay help statementhe[lp]helpexecute a global command on lines matching an RE[line [,line]] g[lobal][!] [;/]RE[;/] [commands]globalbring a backgrounded screen into the foreground[Ff]g [file]fgdisplay (and optionally set) file namef[ile] [name]filedisplay ex command usage statement[exu]sage [command]w1oexusage[Ee]x[!] [+cmd] [file]exbegin editing another file[Ee][dit][!] [+cmd] [file]f1oeditdisplay buffers, connections, screens or tagsdisplay b[uffers] | c[onnections] | s[creens] | t[ags]w1rdisplaydelete lines from the file[line [,line]] d[elete][flags] [buffer] [count] [flags]bca1deletecreate a set of tags using a cscope commandcs[cope] command [args]!scscopecopy lines elsewhere in the file[line [,line]] co[py] line [flags]l1copychd[ir][!] [directory]chdirchange the current directorycd[!] [directory]!f1ocdchange lines to input[line [,line]] c[hange][!] [count]!cachangeput a foreground screen into the backgroundbgdisplay file argument listar[gs]argsspecify an input abbreviationab[brev] [word replace]Wabbreviateappend input to a line[line] a[ppend][!]append@ [buffer]@shift lines right[line [,line]] >[>...] [count] [flags]>display line number[line] = [flags]1=shift lines left[line [,line]] <[<...] [count] [flags]<execute a buffer* [buffer]b*repeat the last subsitution[line [,line]] & [cgr] [count] [#lp]s&display numbered lines[line [,line]] # [count] [l]ca1#filter lines through commands or run commands[line [,line]] ! commandS!scroll lines^D@(#)ex_cscope.c 10.13 (Berkeley) 9/15/96x`X00xPxDiscard all current cscope connectionsresetkill numberKill a cscope connectionkillhelp [command]Show help for cscope commandshelpfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameQuery the databases for a patternfindadd file | directoryAdd a new cscope databaseadd309|Use "cscope help" for help㿘 $8   @Z " $8M  ,$8`t `M"   `` `+M"   2L` L , L  M"@   L  @  @\Z CSCOPE_DIRS :㿐@A 0 "U @D     (T!" x'@  t x@ 2$ t.  t x(T'!$(T@C'!@c @  J @  ` `t@hT >"hT@A %s/%scscope.out8 `x@DK[ 2 `x@ @ibx @@= p `t,  @  @[` <  $!@ @v  @[D @ / ,@`@C @ 8 `4 @[ . &`&` @C#@-&` @  &@" $&`@ @?   @@l cscope.tpath%s:8(`@ G @ O@@)` &`, @[: Z  @  &`,@B @\l E @BA @B`,*`,J  `:2J 2J  @}  &`(`,!  @n 2& @` &`, @e  &`(`,  "@`,  @?&`,pipevforkcd '%s' && exec cscope -dl -f %s/bin/shsh-cexecl: %swr㷈'D'H'L?'''@mǐ D@m耢 D @mH?#` !0ED @Z?"@B!?"@B耢?"@B쀢?@ @B@ג @Ԓ @ђ @B@BH(L`@n"0b8@@f  D@[H@C @A@AH#`$@bXH#` #`@b`H #`310|No cscope connections running%d%s 278|No matches for query㿐 `    @Z(X @ @  $ $  @ ,   %%  2 $ " $ $ @    L  P` !`?`!'+ `@n@7 @B "  @>@1` 2  2  @YʔR $``|! a@/ <   @. 3 @2 $$ `2@$`" $@@$$`2@$`" $@@"    "`  L"`   P"`"  "  "   @>  @> sgdct efi311|%s: unknown search type: use one of %s㿘`YN@N@ "` "`N@ MN`  G&J#`#LN@@" L  &L 2LL 2N`@ ` #* * `!X@*`@I:` @Y!#l `L "    L  L  "@bXS # L   L  `M"   I * `!@` ` `@`2 ```  @AA @M#  @XД  & &  & @ .  * & @@]  *   .  cscope: %d lines%1[ ]%s: "%s" x%#`@m( ΐ@mt @ '* b`@X??'9`@mΒ( @Ӓ '``? "`@```@  "@ 2`*' @"Т  "   "   @@@   耤 ]耢 "Y쀤`"V@@@o܀ 2  @Βb؀    `.@@ @@@ = ( $ @?  /*  ' `@?$ ` $ $ $    @?$ $ $ @2 &"&  &??]'@  @WΔ  `   "c  `@Y@  8`( ""'%$@@w 2 &@@'`@&  '@ '㿘@!%s doesn't match any cscope command Command: %s (%s) Usage: %s cscope commands: %*s: %s 㿘`N@ @ cH@ܔ#  @Ւcp @Вc @˒c#쀢`#3c @    㿘@@  312|%d: no such cscope session㿐` $ ``  @ `@```2 ` @W * ` "` @` @`@ݔ @`"``"``@"@`, "`(@;`( @;@; 1㿘   " #a "    No cscope connections. %2d %s (process %lu) 㿘    @0bX0 % p @' ` 㿈  @Ma 2` '''  $ #\@u ` @. 0  "&  P" L@z" P 㿘@>Ӑcc쀢@    㿘``? "`@F``@  "@>2`2` % `? "`@*` >` @`">``? "`@` ` @`" 2` @(#)ex_delete.c 10.9 (Berkeley) 10/23/96㿐  2 `|` @@7A &   `Q`d`lϗ  2 {  2 `d@L& L 2  L 8& L @(#)ex_display.c 10.12 (Berkeley) 4/10/96buffersconnectionsscreenstags㿘`t `c" `s`b"  >`  `t", 8` 4 @bH 2/` @@0 ' @bP 2"` ې#  @ub` 2` @  @hbh 2` @,` `@6  123|No cut buffers to displaydefault buffer㿘 a@ 2  a 2  @US0]!@ "( #M b  2  @@]  (T E  @G  2 (T 9 2  !@ "( #M b  "  @@3  (T   @GV  2 (T  2  ! @؁ ********** %s%s (line mode) (character mode) 㿘!``*` *  !X@@E` !!Ȑ@F``@0%`"`` *` *  !X@@Es@M (T   @F    (T  2 @5@@2`@(#)ex_edit.c 10.10 (Berkeley) 4/27/96㿘`x  "`t0 ` `    @9 6  @9 - `t @C `@:`!@`|@B a 2 `|!,@:T  d ($d 㿐 @p 5 @ծ `| 2@:0  @ֵ @qv  "@ "@"   6 L"L P"P斒  "`$"`($ $ $$@(#)ex_equal.c 10.10 (Berkeley) 3/6/96%ld 㿐  2 `` @@5&  @ @JӒ   `d'@Pa @(#)ex_file.c 10.12 (Berkeley) 7/12/96㿘  2 `x` @@4 2  * &`t  @x 2`!  `@B_@8`&`?`c?  6`    @9B L@V   @(#)ex_filter.c 10.34 (Berkeley) 10/23/96piperfdopenvfork-cexecl: %sfilterforkwparent-writerp'D'L'P'T'X''܄`   D 3@b  '?'''\ '@fJ D %@fA耢 D @ؒc 'D @fG)?D @S?"@:?@:@쀢?"@:쀢?, @:{䠀?"@@ @= @: ?"@:j?@:d@:b@:`Dd \* @*`  8@4 / Dd " \\* @*`  8Dd \* @*`  8 X@ Dd " \\* @*`  8D @Sݖ@;͐ @:@:\ &@:DcL@7   'D\\䀠D  \L T   D `X @*`X? 0$ D@RT@9 @9'kD@9@cؔ 2#\@;y  #`DLcP@6; @;n@9\ D@l  'DcP@ښ   'D\ \D @   '܀T\TDL Pˤ    DLP͈   'T` D@HD DT? D `X *`X \D @ DX@ 2 ܀2 filter read㿐 @1Ŕ 2`  (T   @C   (T   , @ Ř ` @ @QX@9 @(#)ex_global.c 10.22 (Berkeley) 10/10/96㿘`|2@ 㿘@ 124|The %s command can't be used as part of a global or v commandppp  2$` @^ @ `  @QQ< `x "` `t "  "  `M"@  2 ` `\`|`  ` `.     \ " *2   \ 2 *  *  @   2$  @2? 0@     Ą @z#\ ذ #\"   @n 2ΰ  &  ' L' P @P' 2  @G `<$`<$`@`t@`$"@`'#ؐ '@5*  $` @P  $`Hؒ`$`L@8K $`D `P  ,`P  | $@  |"  " |  |$``d `ly d`<( (T 2@  @B̖   (T @`"``"``@"@@5}`@5{T@q{  d @Ef؀    ? ؘ ܄ @W?蒒 `0 "/ `@"*`@@"* `@ @ $  @   @P- " $ $ $`@$ `<2`@$`<"$`@(@q)  㿘``@52  a  @P [  |"W P "O<<"I$D  ? @`2`$ ?4$  $  /$ 2 ? @($ @ $@"` @$<"@@4ِ@=  $`  $` $ $@$`2" $@$2 $D2 P @(#)ex_init.c 10.26 (Berkeley) 8/12/96㿘 @$< 2&`$$ $  $ $    "@Ǒ $  @O   @&   㿘` $ d@@@@  2  , " @4i  @4c@( 2 @4\$`㿘`= @'/etc/vi.exrcNEXINITEXINITHOME%s/%s.nexrc.exrcؐx @  2  @Ӓ 2ΰ   |  "$$&2°  @4 " @7l @̚ I  @4 " @7[ @ 8 @4 "6 L 18$@ט  @8  "    $@  @"  2  @l 2g   |  "$ͩ$&2[ ! "!!*`  * @`8 K G8 @ "1   8+  @ 2  8@<@ @<@ @ "    |  "$Q$&  #\X 5   @. @6@.4@e㿘 `|   @ 2`| @N$ 3  $`|" $`|`|$ ` $ $ `2 $ @rc $  `$ $ @6f@rS $  $   $  125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner㻐@h  @` "` `" `` `?`  s @RД@ђ / =`@ْ$ 5@R`  `      @MJ +   ` `thT >"hT@2E`  `    h  @M    ` `thT >"hT@2 @(#)ex_join.c 10.10 (Berkeley) 9/15/96131|No following lines to join.?!㿈 2 `d` @@.* + @C   @L۔   "'(T!"  x' @p! `|  t x@p! 2& t &`l t x(T'!&(T`| "`d`l &`l`d`l@ `&`l`d`l   @A쀢 쀢`"   "(T t@(T x >  &(T t x@pe " & t t x(T'! &(T @pS { =@`|!:쀥  쀢 0J` ` + ''`J )!@ߜ ,   , 쀢  J` `   '`'쀢 @3 @J?  $?"$P " ?"$Pl`d$L`d`l@ @As @@Bt$  ` `t@hT >"hT@0  ` `t@hT >"hT@0Ԑh`l `d "@  $h@(#)ex_map.c 10.9 (Berkeley) 3/6/96132|No input map entries133|No command map entries134|The %s character may not be remapped㿈`|!  `x  "`t0@m  2 `""А@Kw  @1' #?` Mb  7`     ` @  2` @ &``t@`   #\#` @lk#d " W ("S `t `G26`t  22`t `   'S 'R@ @< "  " `t2`t ` "*` *  !X@@; @J @`   #\#` @l#d135|"%s" isn't currently mapped㿘`t`| a  @l   `t@@L   @(#)ex_mark.c 10.8 (Berkeley) 3/6/96136|Mark names must be a single character㿘  2 `t` @@+  `  @`d @@Iߖ  @J @(#)ex_mkexrc.c 10.11 (Berkeley) 3/6/96.exrc137|%s exists, not written; use ! to override%swabbreviate map map! 138|New exrc file: %s8`x  "`t0  #X@9`|@0 `|! @  ]`&@! R@c 2 # @1E @m5 9 ` @5 @m(  , ` @( @m   ` @ @[  ` @ @  #  @K: # @푐 "#  @K, @(#)ex_move.c 10.10 (Berkeley) 9/15/96X  2 `d` @@+ < '`h'`l '`p @2?'̐'Ȁ '  ē؀ Ƞ ؔ  /`T''@^   "  & L& P139|Destination line is inside move rangex 2 `d` @@*  '`h'`l'`p'`T@ @  @Ig0  8 `T  '" * 8    @A.  2   "'(T!"  x' @m&! 耢   t x@m! "ư & t t x(T'!&(T@"@F`&@  @>܀ 䀢@l䀢 @0 @>ǖ }` 8   '" "&  2 @>Y dǐF @ @=Ҙ܀ Q䀢@l䀢 G@0[` @> 9`" 8 "  '" "&  2 @> Ő ` `thT >"hT@-$L`$P 8 "l  '"  * 8@@ 2 l $l@(#)ex_open.c 10.7 (Berkeley) 3/6/96140|The open command requires that the open option be set141|The open command is not yet implemented㿘" " ""*`  * @`8   P@H% @(#)ex_perl.c 8.10 (Berkeley) 9/15/96306|Vi was not loaded with a Perl interpreter㿘 @H @(#)ex_preserve.c 10.12 (Berkeley) 4/27/96142|Preservation of this file not possible143|File preserved㿐  2 X` @@) %  @  @GӔ @_ 2 @> 2 @_В  2  @G 㿘`t@6o`|@5 a 2 @-/ " ` 2``|!  $@-  $ ($$@(#)ex_print.c 10.18 (Berkeley) 5/12/96㿘`|`d`l@8$  `l$ L`p $ P㿘`|`d`l@%"  `l$ L`p $ P㿘`d`|@`l  `l$ L`p $ P%6ld TOOBIG x  2 ` @@(} V QТ"? H"'䀦  @@$''  @ 26  @<܀ ܀  $ ܐ@`X  ܐ@  2  (T 2   @9=  2 (T 2 (" $㿘 'PP$@ 29  (T 2   @9  $ (T 2 $ aP @ "   (T 2   @8   (T 2 @<`X  [ynq]㿈'" """*`  * @`8   c'  @P 2J @ @;t쀢 2A  `@< 26 ` @ '&   @) ^ 2#  (T 2   @8   (T 2 c'  @  2 @ %c㿘", ""$"$*`  * @`8 2$#Ā "#ĸ$#Ā " ##* @ *`  8 -@ ,`$* @= 8% :m??h` @i (T a  @8+  2 8 (T 2V& 8ဤ `*` *  !X@@6 `*`  * @ a]@6l`2-? 8@'@N' @EX" @  (T   @7  2 (T 2 &??2 82@& 㿘'L'P'T'X$$4L4"@ @$4@$$4@L 3 b@)㿘 N@$4$($4@$4@ * 4`*`:`` $$4 N@  `@㿘 $4`  蔔 4 $$4 @(#)ex_put.c 10.7 (Berkeley) 3/6/96㿐  2  L` @@&^  ' P'`|  `Q `d@Zd   $ L $ P@(#)ex_quit.c 10.7 (Berkeley) 4/27/96㿘`| a@3, 2 @%C `  $$"&$ @(#)ex_read.c 10.38 (Berkeley) 8/12/96!!%s ! r%s145|Only regular files and named pipes may be read146|%s: read lock was unavailable `x   "`t0%&  @`! `#X   #P* @*@ `8 2 `  #P "  ` @  @*;   @* ֐ @* 2   ̐`xe  2  `x 2 ` ` ` @)c`t,@Z $` ʔ $ `@"$`t@@b $`@ `t@b(0ƒb0$`2$@&$$ (€  ` @k $ &$`d `t,@  @#\ 2 ` @&`$`& L& P L@h  P  K e 2 `x 7  `t3@)   !  !@h% "  @(  "  ?#? @2 ` 2`    @2o `t @@$N @Ȓb8 T @#l   @Dؖ@: < @ @ @& H@C~ 0&  T @2N  @Co`d@! $` `d & L``d & L 147|Reading...148|%s: %lu lines, %lu characters㿐    @#E 0`@} d  (T &  @5w  ` (T `    h  , @8 8`ͤ @1@樐 2, 2'`/ @HT (@B    ` `thT >"hT@'   @D@@t ` h @(#)ex_screen.c 10.11 (Berkeley) 6/29/96㿘@Z㿐`x` a`t @Ж    & $ &$ 㿘`|       `   ` `@#Ȕ  `X@ 149|No background screens to display 㿘     @Bex0K(T 3 -+  @4  2  (T 2%  @*  8@ ?@   c  `դ  (T Ԑ (T   @4p   (T c @(#)ex_script.c 10.30 (Berkeley) 9/24/96150|The script command is only available in vi mode㿘$   @A@ `x  i  @@ tcgetattrptyforkTERMemacsTERMCAPemacs:EMACSt-iexecl: %s㿘 3@P 2 @& 2&  @A  $ $ ?$ $   \@!?  .`h T ` d ?$ ` @)$ d?    @? @?$ 0W @Aw ?" @( ?V @(H"b@U "b @U "(b0@U @S `a @( @(  @  @  @ @( #d " #\#\* @ *`  8@ / `8@.  @Bo@@*_ @! 2  $@  &$hT  "hTselectError: timed outError: shell: EOFshellhА @)}  ''    3@( ` @* "@ @؃  " 4  ?2  n @@ݔ 0} $$@('" ?  @@˔80k @@ŔP0e) `   'S 'R@ @2   2 @7̀ H ̖@6p$ @  * $ @)@a'"'Д   @  " ? $ $ @@q0$@7b̀   ̖@62 @ @+151|No command to execute x@7@ 2  @5F쀢 2ް @+耢 8耢 6       (T! '@d 䀢 x (  t t@c x " $ t t x(T'!$(T@)_ @4ט܀ ܀ }  @ܖ耢  2 ' @?ݔh "@  ' @'  @  `  `8@'  `  "c  @?PE B   `"hT`t@hT >&hT`x ( `t`t@c`x "; &`t`t`xhT'!&hT  @cx䀢 % @(ݐ@@6 2    ` `t@hT >"hT@$qp  А@'Ԕ ''@ $"  2`* ` +@  "   4 2$ Д  @ɘ? *   @?%! '@Р$"  2`* @ `: "@  2 2$ `@5̀ 2˰     "'(T!"  x'Ȑ @bٖ$ #  t x@b͖$ " $ t t x(T'Ȑ!$(T  `@&$?  @  @>P| ' `   'S 'R@ @0   2 $̐  @ @4j'̀ V  * C$@Ā "'Ā "$'a"'А @&   ` 3`( `@* "@`@  @'Ô@2 +   @ @4"'̀  ̀& L& P& P@    ` `thT >"hT@#B㿘  @#7@# $  @>   @'w$   *@D   1 - * K2J@ %? K"? " KJ@`" J@K` ?ؔ  2" script-shell㿘 $@* @&$ ?" @%J ?"@%D  @ @" @"&     "(T@䠀 "(T 2(T߁"(Tttypqrs0123456789abcdef㿘@Aѐ# ? J# `R# "- M(( D, p,   @G,   t # /:?@O,@P @P%!@OS @- ?&&@@: @Py  `g@$ @$ĐL  p M 2   "c ?@(#)ex_set.c 10.7 (Berkeley) 3/6/96㿘`x 2` @L     `t@I   @(#)ex_shell.c 10.38 (Berkeley) 8/19/96%s -i㻘 3@K” /  #d  !h#\* @ *`  8#\ @$   $ 3  @   ` $ $$ vfork-cexecl: %s㿘'D'L 3 @K D d  (€  D` @@ q  (\ Dd #d D2bPD-D)bPLD@O` DJ D @"hT@ ÐG  2C :  >2= NN " "@@@$  ` Ú  8@;#\ ~   ` `thT >p"hT@     xhXH @ 0  pX@(Filesize limit exceededCputime limit exceededWindow size changesVirtual timer expiredUser defined signal 2User defined signal 1Urgent I/O conditionStopped (tty output)Stopped (tty input)SuspendedTrace/BPT trapTerminatedBad system callSuspended (signal)Segmentation faultQuitProfiling timer expiredBroken pipeKilledIOT trapI/O possibleInterruptInformation requestIllegal instructionHangupFloating point exceptionEMT trapContinuedChild exitedBus errorAlarm clockAbort trapUnknown signal: %d㿘 Ò#@  ``1#ؐĒ (@t0@(#)ex_shift.c 10.11 (Berkeley) 9/15/96㿘@ 㿘@  152|shiftwidth option set to 0㿈   @@ f  | " tt*` * @`8  @:4R  dlҘ  J t'J " tt*` * @`8`'J` >" | <" |  "'(T!"  x' @]! d   t x@]!  $ t t x(T'!$(Tdl@   @.쀢 쀢 "9L )J   !  Ā " * @*`  8 Ā *` * @`8@$    & L" `  "(T t(T >&(T x   t@]p x " & t t x(T'! &(T @]] % @ "  . Ā   *` * @`8$` Ā *` * @`8 . ?`@@ ה"" @/"  ` `thT >"hT@+: L2`@ P$@ P$ *`" $P`@& $L$P@]P ` `thT >"hT@pl d "@  $p@(#)ex_source.c 10.12 (Berkeley) 8/10/96%s8`t  @ &G@ BȀ    @  3"c @   @8 `@ 12 ,@ @@ ' ș>`̀@ȕ>`̀  "c @ @9Ė     D @(#)ex_stop.c 10.10 (Berkeley) 3/6/96㿐`|!2  @&  2  h€    2  @  @(#)ex_subst.c 10.37 (Berkeley) 9/15/96㿈`x `t  L   2L@gcM"    \2.  O . L   \" ,@2 L  \ 2 ,@ ` ,@ `L   2$ @& # @*      Ą @_#\ 2  #\$@  @Q 2  #\ ؘ @E Ȁ 2  & L   %"  "& @& &  L  2 L  Π L *`:  ~  L      (T!" x'@[^  t x@[R " $ t t x(T'!$(T L   \"K J& # ~L  \;  ~,@ `423 "D   "<*`  * @`8"< 2#  2 "D ""<"<*`  * @`8 2  "   @  @ ,@ `& 䀤(  @@ߐ &  @6   ` `thT >"hT@ @z   ` `thT >"hT@ؐ@㿐 ؀2$ @    @2`x    ܚ #\@1 Ȁ "`x   `t @b 㿐 2$ @͔   @2`x    Ě #\@ "`x   `t @7 153|Count overflow155|Regular expression specified; r flag meaningless156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match found㾐'L  'P` @  L P'!  '!|*`  * @`8!|  . . 'L@J@ɨ!t'  @?* :  i* ((((((((((((((((((((((((((( ((((((('(',(('<'<'<'<'<'<'<'<'<'<((((((((((((((((((((((((((((((((((((((((((((((L(((((`((((h((t`\ ]&`\`\?Y&`\hL$ L@[  "$ LJ  'L "   В  `l &`d@@,,&`l .L@,U`l (L #  $`?`.  @ɔ '' `?.    ' $@  'PL 'LJ  2) @LJ 2 ` `2 $ "$` ` $ "'  ` "'  ' ' ''''`d'`l8(  (T "  @'>   (T  L@) C  E   T!"x1')   "TtTx >&T  t@Xx "; &ttxT'! &T@X HL@='L ' '   ?  ?(  LP@@`"`҆ '`9 26 ( 22 ` @`(! '  @J '@ '  @4V  "'L *@  ' $',''Ԓ@'''$ 0̀ 'Ԁ '& LԒ @g& P ɒ`h@9- @  @&_ p ")  (v @(<q ДȖ캘 2f d 2_  @N( J  /䀢 q"P  yS (@ B  5,@ 3(  @ B   ` ( @ B @ C' aC '  @ '@ '  @3  ,L@;@, a' hT' ."hT& L$ & P  @ B 45$@ 1   @ B   `   @ B @ C' aC '  @G '@ '  @3S  "'$ L@@$ @ 'L @D@ ' ,Ģ$@  @*   (a@ ' @ '@@'  @3  "'L@@'  !  . @)" K  @ \`  & \$ & " '@)` 2 L@'Ԙ *   "TtTx >  &Tt@Vx "; &ttxT'! &T@V HL@='L' " (a@ ' @t '@'  @2  "#'L@'  ` Ѩ `*   (a@ ' @7 '@u'  @2C  "'L@ؒ@'    . @(T"   @ \`  & \& " '@( 2j  X `& X & `2 'Ȁ`2'!'''̀'ԐЖꪘ$`Жꢘ" Жڤ  L2& P P& P L@Uޔ P @` @&`P@  $@  @1 !   ``thT >"hT Ȕ@1 0  @ǰ 0 )'@ @㿐'H'L\N ! "!!*`  * @`82`! "!`! "!!*`  * @`8 2`!䀢 "!`!䀊 "!!ܑ*`  * @`8 L L`HM"   ``"` $@ @F $*@&$  $@ @Fې $ *@&$S HL@n 2e `HL@Ֆ L@] 2T   @& L'L@Ȑ  & @0ٔ  H@sLL*@     Ht@T >"T@H`" 'HH@  2 @ $ &$ $ &$ [[:<:]][[:>:]]㿐  @ @L ["i"D \ *c ."b"Do ~"E"Di`(f L < [ *% ."$"DX" "D ~ >"  O""DK H " "<"<*`  * @`8 2< & "D " "<"<*`  * @`8 2,  ( ""<"<*`  * @`8 2   "   "D " "<"<*`  * @`8 2   2L &&    T!"x'@S  t@Sݔx 2&t° txT'!&T`@Φ#Τ# ~ \L [""D \ * .""D  ~"m"D `(. L < [ *F ."E"DW."A"D ~ >N."#"DJ. #. . . . . .  #. . . . . . .Z ""<"<*`  * @`8 2L.2 "/ E."D ""<"<*`  * @`8 24.4 "1 -. , ""<"<*`  * @`8 2 . ".  @ "D " "<"<*`  * @`8 2 . .W &@&& ^.[]$*㿐   &   (T!" x,`'@R@,`  t@R x 2$ tY  t x(T'!$(T@` @J? / ?`` @J? $   ` N / ? ^ N ^,  `)Ц \N \2 NN  / ?2N  @ ؀ ", ,   $, &@$& ([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}㿐 @  @L "`  & @ `*@ *  $  *    T!"x@'@RY@ tx@RM 2&t: txT'!&T7В @ ^@,`'ж \L` "@ݔ   @ " .  .  Вb@ɔ   $. &@&& RE error: %s㿘є@ @  @. 0 @ є@-@ 㿘'H'L'P'T   @Ѹ"|7ML&\  "D ""<"<*`  * @`8 z   t*  Lڀ O* GJJJJJJJJJHHHHHHHHHHJJJJJJJJJJJIJJJJJJIJJJJJJJJJ JJJJJJJJJJJJJJJIJJJJJJIJJJJJJJJJ"D  "<*`  * @`8"<   L?Ц* @ ?@ @  ?| ?2  ?t  H"@ ` `  'R@`@`'`"  ` 0``0⌔   I   ⌔    G"*  @  !`@@"` @, `M@.@`      `   'S 'R@ @-   '`  @2 ` 耢 & @*`& @ړ*`& 耢 2  @,  耢 2 & Y  * "  )& '`"  ` 0``0⌔   I   ⌔    G"*  @+  !`@N@` @,[ `@.@`2mLL#P#T #@(#)ex_tag.c 10.36 (Berkeley) 9/15/96#\X 9   @  @@ %@   > $158|No previous tag entered㿘`x . 6` "`t@`t@ $` @+  #Ѐ " ##ȓ* @ *`  8 "`@S`(``*` 2 ` @+ݔ @`@ "  @ @B k $ $  @9 , d  $$ 2 $ " $ $   L   P `!2`| ``|! a @ ?    @ 6 @2 $$ `2@$`" $@@%% `2@$`" $@   $ @N`"    "`  L"`   P"`"  "  "  @h@c@h 282|Already at the last tag of this group㿘 2  @ %  @ @+.8 `|@T "   $ } ` `$ @ 255|Already at the first tag of this group㿘 2  @` %   @ @*( `|@ "   $ A ` `$ @ 㿘` `@X &`` @ @   ` @ʖ   $ >($$ 㿐` `@/ #&` @Gh 2; @  @[ 0` @ @ @ @G  "@ "@`"   2```  "$"( ~`"$ $ $$159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]㿐 @@2`x @ d   "`t0UV  @2J@` $O @ ? ?; Ԕ@* 9 @m@@"    /@ic' `@| 2@2 @ @+&0   @`|@ 㿘 @  ``|`@  @"  㿘@   @  & L & P@  2)   "`  "`  `2 @ "$ (&$@@  2@@@2 @ 292|Display too small.%2d ... %*.*s %*.*s*%s%.*s 㿘 2 8 @ 0 " @)Qx0x (T t ժ#Ȑ  @   (T ecW@Ւc㱔`㬒c` 2 `@` Ւc   Ւc  2㊒c@!`" 8?• @b  8݀@ 8 #Д#ؐh dc@@2 (T  㿈 @`@ \  %@ 2Q  "`#  # @2 """` "@`"`@2`$@"$`Ő "@ 쀢 "@` "`` "$`     @ $` @(p  㿘@ R  2@ @(c  $`$ `$ ` $ `$ @a` $ &  㿘`  ` !@ ,  @(=  @ؔ $ $ $ `  $ & 㿘`  ,` -` ``$ @   @(  @`  ($ ` "& `  $ & 㿘@` `"``" `@"@@ `@  㿘``@ @`&` "`@&`"@  `@2@@` @`$ "``@"@@ ѐ 164|%s: the tag's line number is past the end of the file165|The tags stack is empty166|%s: search pattern not found㿘`  `  0 @(זp0  @'0@(Ζ0@ <㿘  N@   / &@`()`@ S   @'e $ @ I` $  @'Z   @ c @ *, $ $  "$ `N@ ˲` 㿘 Q@ 6 `  @ 7 㿈@Mb   @ɐ'@ߐ /"  '' #\@E @fl (  #\ # @E "   S   &  P" L@J" P 162|%s: tag not found%s㿘@9 @E ! L & &  & & @c  " @K    ,    @2*&  @'` 3 #  " 2   b @'&c  ,  2 @    163|%s: corrupted tag in %smunmapclose'P` @B  #  &` @2     ̘@Q#\?  # @ &` ڰ P @P@* ̀ 'J@ ` '@"J@  *@' @hwx   " @|    ` P@l >PP@+Y'`@+T ؔ@%     t@T >"T@     ` `t@hT >"hT@ א@u =@P .@@ @@+@ - ( $ @ K  /*  ' @ >$ $ $   @ 3$ $ $  2 &"K& @ ݐ  @%|@   @%s %s/%s8'N /"@5 `@dʒ / ,@$ٔ`@R@!  /`@ &' /,@㿘&2  : !L  *L0@7 2&2  :  L  *L㿘@  ? 0  *N쀦 J" @ J@(8 *8  ?J` @ J@  @J  @  J@` ` 2?@(#)ex_tcl.c 8.10 (Berkeley) 9/15/96302|Vi was not loaded with a Tcl interpreter㿘ڐ @$p @(#)ex_txt.c 10.17 (Berkeley) 10/10/968@  8$    " @$$ `2@&`" &@ L $  T    m*@c* h%c  L  @t 2_ @c ۬ X+Lؔ @ M? * llqhmlllllllS @kO      @H ") $ ?` ې *` no0qqqqmHqqqmXqqqqqqqo 쀊 @   ` @J? \ဎ    @ @J? .@ &`"` @&@"@Mװ   π  $` @s 2 @   @s  @$`$ @2`&@"O&`  @2 @  @|2z y@)  @ J "` 2 `@ *J  @  $ *@ c* ` ?"`@ΐ g `"؀"  *" 01 @''  @G: "I ' @    '' @ |€ $ $  @ܐ@f )|@|€ @&Ȑ@M"@ ` 耢    * $  %c%6lu %.*s㿘@ !x" """*`  * @`8 2`  `@!"L``@!L@#㿘#Ā " ##* @ *`  8#| " #t#t* @ *`  8 ``J 2 @$``@*`?@ޒ$ @ؒ$@8$`    `@Fq` 2&` &` &` ``*@ &`    ``?*@ &` @(#)ex_undo.c 10.6 (Berkeley) 3/6/96㿐`L '`P ''@! , ` X 2 4 . X & 4 4 "  @m 2   & 4@    & 4@$`L $`P@(#)ex_usage.c 10.13 (Berkeley) 5/3/96To see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" 㿘ia(ea`aa]aؐYb The %.*s command is unknown Command: %s Usage: %s ^D%*s: %s 㿀`x Z `tM"    I *  * "Ȁ`"@@k  "@`@ 2@ ``!` G b*  * ޒb0j``ؒb!(@ `@^@ 2 ```ǒb0S"Ȁ`O" (T J`  @  @ (T <@2?#"Ѐ! [/@ G"*`@ `/@ / ]/@ ``/**  2 @ݒbؔ ہ`@    (T  @ The %s key has no current meaning Key:%s%s Usage: %s %s 㿘`x f `t` ` `@  @ `~4,``[`]`~ #``~.`$ "##*`  * @`8 `.` `!T.`& ,@ 2 `` !*` *  !X@@N W J !Ѐ !!  D  (T > #`& ,  @  `~ (T .`~.`$ "##*`  * @`8  aT.` aT.` "`a``~4   (T ͒ @ @(#)ex_util.c 10.23 (Berkeley) 6/19/96㿘\ @ .`* bȐ & & `& d& l & p`& h |!6 |& x & t$ x t( "@"` x t" x( 㿘 "#   ,0   ,@Cؔ0 "3 $,,`? &`@Ԑ@  &@`   2 ` $ ?6` ` 2 ,@2& 2&  `Ġ 167|%d more files to edit㿘`2%  0 , @"  ( "   "  (& 0 `   2  (ߐ # :@ 㿘 (€  $  (\ " " " " * @ *`  8 !`  $ 4!X* @ *`  8!X$ 8$ ? $$168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %s㿘 W". Ld| ?(  @@09 3p . @0' " @X0 @~0 @x0  А  `@g@(#)ex_version.c 10.31 (Berkeley) 8/22/96Version 1.79 (10/23/96) The CSRG, University of California, Berkeley.㿘 @@ @(#)ex_visual.c 10.13 (Berkeley) 6/28/96175|The visual command requires that the open option be set%luz%c%lu%luz%c 㾐" " ""*`  * @`8 2 `d @|  " & L`| (b  - @  ^  ( +  . L"`  P"` L@A ` 02``|  ! L`X@Ԕ! L@͔8  @= `|" @d" 4$b2 $ !   @,2 $`2$@&$$@  '  & `@|" 2  2  .a  &$ @(#)ex_write.c 10.30 (Berkeley) 7/12/96㿘@h 2  @ ؒ 2 &`x+㿘@S  2 @ Ò 2 `| a `  $$"&$ 㿘@2 㿘  2 X` @y !  @  2 @  2 `| ax 2  `$$"&$ ! 㿈  2`|` @ !  `x v`t L*`:  "  2`x L  `x `2_`dL !2[`d#X "#P#P*`  * @`8 2`     ` @  L*`:  "  2L L  L ` ` @  2 `d$ &$`t  `l@>#\ 2 $ @2 -a  `d `l@N` "``x  L >2`xL  >2`x L `*`:  "  2`x L  `x L `d`lP @͔ 2I `x 8  4@ `t !  !@@ "  @=  "  ?#? @2 ` 2`    @ ֒  Q `d`l@253|Writing...%s0\``%'@ 〧R!`O`@- d (T D  @'  `(T 8`   (h  @ɘ A @0 29  ?`& * & @ `  `@ 2V@h  <  @V 2 @( 2  X  @p@ `` (h `%'@@(#)ex_yank.c 10.7 (Berkeley) 3/6/96㿘  2 `|` @     `Q`d`l @(#)ex_z.c 10.10 (Berkeley) 3/6/96---------------------------------------- 㿈  2 `|` @e   "$` `X " $X$X*`  * @`8? `d`| (• @#'  @X`/([R` ,@"@&`d&`dP`d( "@ &`dK ?2@"@&`d&`d@&`l L '' P'@ 6` ?2@"@&`d&`df&`l 2: `X&`dX&`l 2, L  &`d@ ' &`d?&`l` @쀢 2 `l쀢 8&`l2 2 2& L @(#)exf.c 10.49 (Berkeley) 10/10/96/tmp㿘`-`0`0")    $`4$  @$`0"@  @d@b@ 52  @ۼ   @? `# @c `0@;  & @: @'  `0&`4& `0@2`4$`0"$`4%s/vi.XXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file%s239|%s already locked, session is read-only ``  ?#ߐ @6`@5 `6` @S \ 2&  @Ք  & ?& H& Tx Xt @. X  ``t W @(~ 2A` !xx  !!p* @ *`  8!p @ǟ$x@ʐ? @(#`@` ` 6`@  &` ` 2` @ &`` "@ @t @>`` $` 6`@# D7ؔ  @g D  @ , D, 4`  <  8 "  X . Xx& <|& @& D<  ,  @wPؒ @  /' (T2   'ؐ`@0O  L'@" & L @ `' X . X  ! @٘؀  &  @;x @ 2{`@ 2u`     "@   `@6` @ V``?# @6`   @ H@ "  0 `! 6`  @က$@`  `@   )    )   @'`&% @%  $ @2%$ "` @~&`` " X@4@u` &`  X @" L@+ L L " @h& L   @@^Y %s/%s㻘`2Lf& / .L / . L / @`?P&@ 2"Ȑ H&   "* @ *`  8" -L : 2 ?,$h@#8#,@Ē " L   `"& @͐  @ޔ   @y@`&`& -c option㿈 & L & P  "$$   2$@ Lr L2 & L& P #b(@ v ]I$  @ L S L 2 < ` " !l`& L`$& P &$ "!d!d*`  * @`8   & L  @ & L  L  @ p쀢  & L& P P쀢@8 & P L@;o P ' P L" T' P @'240|%s: remove241|%s: close242|%s: remove243|%s: remove㿘`" @? &@  L$  P $   14  ".`@   @]P@$   $  0@ "4"`  0@"0"@  @@& ` `"@    @+`@ C&@@@`X 2`H`L " `P@Ĝ  `L@p`P " `H@Ď  `P@`H?"`T@>`T?"`L@8`L "`P@`P @@ 244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy252|%s: write lock was unavailableaw254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters315|%s: appended: %lu lines, %lu characters257|%s: %lu lines, %lu characters   @       "쀊 """*`  * @`8     ?#<#8 >$ " $$*`  * @`8 0  @̎   #X# ɔ @x  ##@ , @g $    `X  `<@ `@@ `D@   H   &"  @$2  !0 " !(!(* @ *`  8@  " @(!  `x   @   @|   @ݐ  ` @jx@ @ ''@  2 '@#\#` D@Ғ " `X@`D  ,`X$`<$`@$`D  2  @- 0x   ?# @5  `X ,`X ``@?# @5 @(<`` 0 `!!8@ɔ HD$@@@°?8$? 8@a 8 H@ @@ N@ /2` 8? @ `@ @ H ..@.@.@ @<    ` `thT >"hT@ 258|%s expanded into too many file names.%d259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner?b? ! $# @ # 6\ #\     N N  @z 2@    @H@3 `    ?(T!c '   *  2! @7Ғ  x*  2   t@7” x ހ$ t t x?(T# 'a$(TL  *`: `% `/L  %" *" * L    %- d- `- @# ,@@ /,@` ?#@֐   @(b 40@ܐ`?c  "@k"@  @4 )*<    @a@%@  @ T 6  @@I$`@! ?>#@|   @@\ + :@ D "@ @ `ဦ   ` `t@hT >"hT@+ @z@@s @'x`   ` `t@hT >"hT@ݐ 㿐  @ɘ    yJ #$!&$  @ h 4J #" _& L -J@ /2*J` *&$!&$ ( J *J /"D& L'`'  @{ 021& L`-J /)J /%'$'!&$ ( J /J /"& L'`'  @I 262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override㿘 2 X6 0!$ "!!*`  * @`8 `  `@   `  x @  @C264|File modified since last complete write; write or use ! to override㿘  X   ` @ @265|File is a temporary; exit will discard modifications㿘 `"    @" @ 4  `2  @ 266|File readonly, modifications not auto-written㿘  X !$ " !!*`  * @`8 2" """*`  * @`8    @K`   B 㿘 `@J` & @? &  @- 㿘"8 " "0"0*`  * @`8  1 &# @  #  #@?  @(#)getc.c 10.10 (Berkeley) 3/6/96177|Empty file㿐@`` @֘    @h ` `"&`@jo` "`&` &``&` @.` 㿐`` ``")` 045`1@ ` `@&@  @&`?$&@` `&`@j< "&`&` &``&` .``?@`  &``&` @.`@N 㿘` 2 ` 2  ` "  㿘 "`  " " 2  ` "  㿘``@ *`   @`(&@ `@P`  @(&@` `"&`@i` "` &` &`&``?`  ?@    &` &``&` @.`@ 㿘 "`  " " 2  ` "  @(#)key.c 10.33 (Berkeley) 9/24/96079|No non-printable character found㿘  @Oa@p @=  @9  @5  @1 !" #ch@,Rch  R@:  ,R  8 *'S  M" ` J  ",p` 㿐 脔 $ !"` "  2" 2  h*  * h* "  "h㿘  *` , !X@(   ,!] ,@`  㿘@ 0123456789abcdef01234567+g bԀ" bḃ(`(8" b " b g( g  b" bxbx(`(8 g  g  gM⌄H g _+` gM 2 b ^+` g@ ?+`I  b"bb(`(8 \!+` \+`   8  g`0+`@  ? g 2`8 @* #`+` x+` g H@ @   0@?* @*`#`@ (`#㿐/bh @J  2㿘 ! ( !! !   !! )"@'$! !  ? @@ "!T ! ."* !#H!*"@ *` + " @* $!!!$!*`" * !3@ ``"$?@$$?$?$?$?$@`$ `,? `   'S  'R@ $?$?, Ԥ 㿘`  ` !  `?!!! "@@ `? @@!$!`! *`" !* @*" * #@ -` $?@,? ``   'S  'R@ 6$?$?, 0@"@ `"`"` " `"`"`" h` ب @2v  A>T A 2g 1x 2^ `?` #P*` pǜǴǴppǴǔ`   @GC   hT "hT^ 25 A22 * "@*` ` ` &@`&``&`` &` `&``&``&`? $$ $2Z ` ` 2V ` "S ` L`  ` 2` !H `: "G `   #\ @/ Ԁ`3$ "$$*`  * @`8 2`u r ` 2 !! !*`  * @ `8 !*`  * @`8*` *  T*  & ` Mb  2@) a@&@`&``&`` &` `&``&``&`? $$ $  " Mb  2   a.` &` &`.`}  *"@ *`@0~  `?"@ `$$  $  " # "##*`  * @`8  J F  @l ؔ x 2    (T `"(T 3&`      Ԗ" 2&    ˘   * "@*`b      "       "P `  㿘   "  @$8   @$,276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event316|Unexpected resize event287|Unexpected write event㿘`?` R*`"h Θδϔϔϔ$@\x @ <`  @ 85`  @ `.`  @ '`  @  `  @ `  @ `  @  `  @ y ` @, @  ( (  """ 㿐 !* "** "@*`  '!@/, 2$! @鴒 $!   ` @(#)line.c 10.21 (Berkeley) 9/15/96㿐 '@ ` @ 2 `  @X  ' 㿈`K'H   2 H 1H$@""  x |`   @`2@ `'@ <`H@" "@'H H 2$  +' H' '   ? 2H H@ 2'2& $ $  $ '  & 003|unable to delete line %lu㿐  'H  @  @  29 Ha  22 H@ H' '    H H@ Y0  @($   ?$  X @! X `, XH@ 004|unable to append to line %lu㿈'L L j J ' '''  ? L L@ 4 @*&  &X "X@!X`.XL @`L @ @ L ܔ 2  L@A2 2 005|unable to insert at line %lu㿈'H `H   F ' '?`  ? H H@ 1 `@:&``  &``X "`X@!X`X`.`XH@ H@ 9 @ H  2  H @ 2 @2 006|unable to store line %lu㿈  'H 걔 3 @ H' '?   ? H H@ Up  @"$  X " X@  X`, XH@g  H@ 㿘  ` s  2  $@ | x `"     `?007|unable to get last line㿀  2  D H &@$@"@  | x `" 7' '   ?    @۔(&@  &@/ *` *` *`$ $ $ $ $@  |  8&@ &@ 008|Error: unable to retrieve line %lu㿘 @㿘$ 2&  @   "  2  @. 2    @@(#)log.c 10.8 (Berkeley) 3/6/96009|Log file㿘&`&`  &`,&`0&`(&`$ "! @6 &`   @T`X  .`X㿘` "` @&`` "&` @N&`&`  &`,&`0&`(&`$ 㿘  X ",  L", P  "0", P"0@ /usr/src/usr.bin/vi/build/../common/log.c㿈     @+ "& $   ,*  @Z  (' ' ' '   ? (  $ ($ $a@Ȕ ð 㿀'H `X  b `,` .`X  2X &`,H ǘ H`"' E ! 'H  29 `   ( ``@+` ", &``H*` @ `@ `(' '`' '`  ?`(  &`(&`$a@\! 㿈  X " ,; V  23 $ ,    @+H  "' $   *  @  (' ' ' '   ? (  $ ($ $a@!W 010|Logging not being performed, undo not possible011|No changes to undo`  `X`  `( ` @ 0a@! ,`X`(' ' !`(`?$`(   ? b* 0l0 @1  `XQ  Ē@) B 2E `X d& d Ē@   23 `X \& \ Ē@  .   X " `& X& ` В@ ؖ '@'̀ `(@: `X  ,`X012|Logging not being performed, undo not possible`  `X` @e `(  `| a@?!u ,`X`(' ' `(`?$`(   ? W* 4444 儐Ȓ @  L@2 `X`( ڒ `X@ Ȓ @}  L@Β`( `X`1$`(Ē @n  L@2  X   X  `& X & `В @U ؖ '@4'̀ `(@ `X  ,`X013|Logging not being performed, roll-forward not possible014|No changes to re-do`  `X  `(`$@ 0@ 0a@"I ,`X`(' ' #,`(` $`(   ? e* L` `( @$`( `XQ  Ē@Ք   2B `X \& \ Ē@Ô ܐ 23 `X d& d Ē@  ږ   X " `& X& ` В@ ؖ '@|'̀ `(@ `X  ,`X015|%s/%d: log put error267|Log restarted㿘!@)e Ж @   @  @@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1992, 1993, 1994, 1995, 1996 Keith Bostic. All rights reserved. @(#)main.c 10.48 (Berkeley) 10/11/96exnexnviewviewc:eFlRrSst:vw:only one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.-s option is only applicable to ex.window=%s0hh i!$hhh `j"$h`$`$` `$`$`$`|$``$`|`|$` ,`p`0$`0$`4a,$a,$a0$a@$aD @@b`@@ bh2@ @bp @@bx    @@{    hT!  @$hT@A?j? 8c* HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH4@a #,$a ? hT ?  t r  rt#, t? #,h 0= @*     @@\  hT 2  @ v ``""` 2`$` " r$` "``""` 2`$` " $` 2_  ' 6'ĒȀ )"@`` 2"@`?"@@  2E  !ؐ0@`'@Ɛ'''''@U    @̘  (  @Ƙ  C  @  G  @ $@ "$   * @*`  8"4 ` X* @*`  8"8   r 2 d& r  2 `@c ۰ { ` " XX*` * @`8 2 "a `$  @ "$֧ 2  & r@= @缐   &@ c @n    @z r"("$@"@" 6$`2 @ 6  / {$@ 2  視 2l `|  d&  @ [ Y d !  @Y@鮐 ؔ  E  2 hd耢  hd@ ?   "$ ߐ @a9  2$ @ @  @ @ @Ͱ 0 @ %s%.*sex/vi: 㿘    @r    "   @j     @_ (T M H@y` l M H %#  `  @f`"  "` "@ l 2 ---c$-s㿘`@ "b )"0'8@@pb( "W @L +& -L  @晐  (&@ "0*@ `*` `*` `:*`@ @扐  &@ -*@@ c*`@ @y )`2'`L   c@s   &@ c @&   8*@ *` *` T t w2`@J  "``@  %s: %s 㿘M Hc@۔c@Ԕ`  # !@\#@ɒ@Œc@(#)mark.c 10.13 (Berkeley) 7/19/96"`8 㿘 `8`""`"@@4 `82 017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists㿘``" '@ ` " ` % ``! ` "  2 `` !8*` *  !X@@Ĕ &  &㿘``" '@D  &@唐    @ 0 2  8 "@  8"  " 8  8 "` "@" $"`  2     $ $ ,  , ,   8   *"02㿐`"   `= @  8`"7 `*@ ?`.`@&`@`2`"   2 *   "   8`  `*@ &`@`2` @(#)msg.c 10.48 (Berkeley) 9/15/96020|Error: %s, %d: : %s%.*s㿐'P'T  'X` G `"D C`< !Г*` <$ / $$ " $$*`  * @`8 ! T $T$$ " $$*`  * @`8  0  $@`@i`  "`$   ` `t@hT >"hT@䨐, '  (T!' @#s " x  t x@#f "$ t t x(T'!$(T` a8@t@ @@``@ <; 7L $ !H ` "* *  !X@*`:`@-'  L  P@"@' o@! P@x"@_'Y` $@!# @ !X@' E @  / 蔟 M Ha`@U   ` `t@hT >"hT@ϐ" 㿐0 ! # @ $#     ` `thT >"hT@㤐p`P@299|yanked298|shifted297|moved296|joined295|deleted294|changed293|added301|lines300|line%lu 㿐$@#  & X#* @ *`  8#  `\`   t   " \`` 0    "'(T!"  x' @"" v"  t x@" " j$ t t x(T'!$(T  #$ #\ 3`" ; , , ` \@'@\` ` `@ @@儐 @ , @`@v$\@ Ȧ ,`  蔔   ` `thT >"hT@⿐317|%d files to edit021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%ld%%]029|line %lu㿈  @ '   (Ta"* *  '@!Tt  x   t@!G x g$ t t x(T'!$(T  L + `*`  * @ a]*:`' `* *  !X@*`:`@Ĥ L`٢@ :,@` ,@$@(` $ $@  `@   b@ @v@_@ :,@` ,@`$*@&$ `  ?# @2#bЀ`b@@t @ ,,@` ,@`  X bc@͔@X@  !  ,,@` ,@`c@@? @"쀊 " ""*`  * @`8 0  ,,@` ,@`c(@@ @ :,@` ,@`)`쀢 x쀢  c8@o@!cH@d.`* * @ʒ@u0 ch@P@u@䠐@ ,@`$@'( 8@$L /2   8$@?@ *L ? 8?$@? ,? .,?,?,$@'ː     ` `thT >"hT@LC_MESSAGESLANG%s%sVI_MESSAGE_CATALOG030|The file %s is not a message catalog㻀@;< / "#L  2@j! K  @`!Ș K  $@   @  cp 2+"cp +H' ' '`  2` 2 `a@m  " `@cp "cp   0  h "cp @  " h㿘 h  @268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: 㿘`)!.` ,<L\l|``0 `P ```@@㿀Mb  :   4   .N  |*' '@'䀤    "  h   2   ?& *?  @&㿐&L  M"@ J  "L L  L  y` `thT >"hT@ߌ  @_ + .&  (T!" x!'@Q1  t x@E  1$ t t x(T'!$(T14"А & L`%?# ` *` * !X@*:` J@:  .`J@  @ L  .@(#)options.c 10.51 (Berkeley) 10/14/96JphXPH@KH8(OOOOKNxOphXP@8N0O0(O O0NO0OPP8x p`P@@0 @O@ PtQ P Q` QphXH8writeanywrapscanwrapmarginwraplenwindownamewindowwarnw9600w300w1200verbosettywerasetimeouttildeoptersetermtagstaglengthtabstopsourceanyslowopensidescrollshowmodeshowmatchshiftwidthshellmetashellsecuresectionssearchincrscrollrulerreportremapredrawrecdirreadonlypromptprintpathparagraphsoptimizeopenoctalnumbernoprintmsgcatmodelinemesgmatchtimemagiclocklistlisplinesleftrightkeytimeignorecaseiclowerhardtabsflashfilecextendedexrcerrorbellsescapetimeedcompatibledirectorycommentcolumnsceditcdpathbeautifybackupautowriteautoprintautoindentaltwerase     !$%+x)p/h1`3X9P6H7@58=0<(A ;>>HMHJKLwswmwlwiwawttytypettytstotltagswsmdsmslowshsectscrroreparaoptnumodelinesliichtexedebdircobfawapaicdpath=%sCDPATH:directory=%sTMPDIR/tmpescapetime=1keytime=6matchtime=7msgcat=%s/usr/share/vi/catalog/report=5paragraphs=IPLPPPQPP LIpplpipbppath=%srecdir=%s/var/tmp/vi.recoversections=NHSHH HUnhshshell=%sSHELL/bin/shshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s optionh'''''' >  @U  c   # @ @J.#耢 X   " `@?." M 2  !` `@4.!` B#X `.#X@L`  ($@@'@ #  @@2`0  H$@@'@~   P  P? '/@Ԑ'@i   `  `?7@'@V   p  p?'@ޮ'@C ͦ $@5@ޜ'@1    ?/@މ'@  -   ????@r'@  %$@@`'@  &$@@N'@ m *!  ! ? ? '7@7'@̔ V 1!8@ea( !@$@@'@ ; 3!H  !H ? ? '/@'@ $ 4!` !`? '/@'@  5!p !p? '7@ې'@p  8! !?7@Ȑ'@]  ;$@O@ݶ'@K ""զ = " " " *`  * @`8?2 '̀ А '̐$@*@ݑ'@& "  /h`€̀ 2 ̀"X$  " " " " *`  * @`8?'̠А$@@b'@  H!H!H "]@ "  O  "" !0G  @Z   @T > ! "   * @ *`  8 @B , "  *`  * @`8 2 ! " ! "   * @ *`  8 @ + @N  `@?!H@* @@@lr@'@} 2 @`@?*   H,  i all032|Usage: %s291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a boolean㿀 `q9 @ @c؀  a # L = ?2  = #֖R  L ꀢ = '- @ؐ `L n L o  '@Ȑ `@ !H$: ,*  `2 ` 2  @ ?2    "  0         `  s `  kP`s` 2+  ,*  a " ``*`  * @`8 2 *  a " ``*`  * @`8 2     2   2z  @&; 2r  茔  2h     @ |  @ u   ```M "@ ` ^@V `M=8䀤` ` `     ǘ@z    ` `thT >"hT@׿䀢    ` `thT >"hT@׫ J A ? ">   耢    ` `thT >"hT@{䀢    ` `thT >"hT@g  @  2   K 2 ,*  a `*`  * @`8@"    2| ږ 2s @%4 2k  茔 2a  p    HD o```2 `"   a- 2, ,*  a "``*`  * @`8 ,  ,*  a `* @ *`  8@w "6    2  k 2 @$Ŗ 2  茔 2   @ " @G` 2@`@x㿘.`*  a  `* @*` `8  @iv  d     2&`` "&`@e&`&` 2 &@@ "&@@W&@&@ 305|No %s edit option specified㿘.`*  a `* @ *`  8 J 2 2  H.`  ^h %ld%*s   8@ψ ? /`  !H@!Hp! !H$ `: `", ``",0`,  ',,*  a " ``* @ *`  8,*  a " ``*`  * @`<"Цh,*  a " ``* @ *`  8,*  a " ``*`  * @`<",*  a "``*`  * @`< ,5 1,*  a " ``* @ *`  8,*  a " ``* @ *`  <@ ,s*  ! "l,@ *  ! ,!@ر` `'K@ ! "   *`  * @`8 ";`: ! "   * @ *`  8 @@؆p&@ ! "  *`  * @`8 ,` ,*  a `* @ *`  8@b@`@.-" "   D@@ʒ 2    ?@RѪ  @6, !H95 @,  *`@@@ !(%4`@`@@Da0@&߲  @!H%,` `*`@@@-0@'a0%s%sno%s=%ld%s="%s"㿘` !H&@`(:  `:+ 0g+  *  a #X`*` `* @`8 2  `  #` @D +  *  @  #h* @`*`  8 .  *  a@ #p`*` `* @`8 + ` +  *  " * @`*`  8  set %s set no%s set %s=%-3ld set 㿘!H`!H!p 2!H$`+:  `=,` ,*  a "``*`  * @`8   @JaX` @Da`` ,*   * @ *`  8@.` *  a "``*`  * @`8 ` @a-  \2`` \?`&``@ \@* &@@gܒ`?`&``@ @* &@@gɒ`L@ Ӏ ` =?`&``@ =@* &@@g,*  a "5``* @ *` - 8  \2`` \?`&``@ \@* &@@g`?`&``@ @* &@@gy`L@ Ӏ ` ?`&`@* &@ @gf` @    2  㿀'a % @# 1 !H* 0''H N @#8 0!  @1 H@L@J &  @ 2    2L@033|set: no %s option: 'set all' gives all option values㿘 ܖ㿘@A@㿘@;@㿘`@"# !H 2i 2e  ! "   *` `* @`8 2 !  ޘ   ؘ F "   * @`*`  8 ǘ     ( ! "  *` `* @`< 2 ! " ! "   * @`*`  <      ``M㿘 !H` 2D ` 2@ ! "  *`  * @`8  !   !  * @ *`  8@ ! "  *`  * @`< 2 ! " ! "   * @ *`  <@Р M`@(#)options_f.c 10.25 (Berkeley) 7/12/96㿘  B  %  040|Screen columns too small, less than %d041|Screen columns too large, greater than %d㿘     !w 042|Screen lines too small, less than %d043|Screen lines too large, greater than %d㿘 !    Ж!J 0  Ŗ `<$`  & $X* @ *`  8$X$` " $\$X*`  * @`<$` $X*`  * @`8 P $X K H    H  > 2 $`` & $X* @ *`  8$X$` " $\$X*`  * @`<$` $X*`  * @`8  $X  H  Q? H  ?I 044|The lisp option is not implemented㿘 붔X 㿘ݒ 048|The paragraph option must be in two character groups㿘@   듔 㿘$ &$ $($"$ 㿘$@  @? $*@&$$ @@4 $ *@&$ $ "$ 049|The section option must be in two character groups㿘@Ӳ   B 㿘      㿐 h`€   $@8 㿐 h`€   ;P.@  㿐 h`€  "@@  "" ( (8@: "0" @  "" " " ( (8" " @(#)put.c 10.11 (Berkeley) 9/23/96053|The default buffer is empty054|Buffer %s is empty㿈`E2 ! `2> Ꙕ M"  I *   !@`  `` `@`2``2` "*` *  !X@+ ed  &`S 2Z  2``     \ & \`' '' < ` #B?' '`     \ & \`'' @2   ' 2     " T!    '@ 耢\ x   t@ ֔x " &ttxT'!&T쀢 @ @p@'  @e 쀢 `?"  쀢` ' @ " P @  P  ' `@&@< !&   X ~  `& X y& `'쀦 `   "Tt@2 T >&T x ( tt@ _x "n &ttxT'! &T @ L耢 â  @@ @ &ж 22  X " `& X & ``     \ & \`'    \ & \     ` `t@hT >"hT@@(#)recover.c 10.21 (Berkeley) 9/15/96%s055|Files with newlines in the name are unrecoverable%s/vi.XXXXXX056|Modifications not recoverable if the session fails8 * T" " ""* @ *`  8@  #  @  詖1 袔*@h#N` N $@@!?"@@` &`L { @E t `X  @.`X057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails㿐  X @, X?  P`-, X @i ., ) hc   €   Lf h   h   L@ڒ! X  @, X  060|File backup failed: %s061|Copying file for recovery...㻘 `"{ `X @ u `` €    `X``L ,`Xb `` `X ,`X``P@o`J  *2C " " ""* @ *`  8$@@(!?' ha `L@Ւ  @   @ " @W@  h  ` ` C  2 062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery file%s%s %s%s %s %s %s%s %s%s %s X-vi-recover-file: X-vi-recover-path: Reply-To: rootFrom: root (Nvi recovery program)To: Subject: Nvi saved the file Precedence: bulk%s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s On , the user was editing a file named on the machine , when it was saved for recovery. You can recover most, if not all, of the changes to this file using the -r option to : -r 064|Recovery file buffer overrun065|Recovery fileX@ @ޠ   Ė  * 2 " " ""* @ *`  8?@$@@"!ے   p   撔耦2 %T@^ %P 慔 L   /@%  ?"@o0?#@@o9!#\ `#` p#d #h?#0`H#l#p#t@K#xo6@̀o@[ #\a#`#da8#h#laP#pax#ta#x@#|a#@a##@#o ` B, `<@yc & <N 2& <8N .& @"2@٠?@ @c  Ҕ  ?%T @P .recdir: %srecover.r+066|%s: malformed recovery file%.24s: %s vi: no files to recover. 8 *f ""  " ""* @ *`  8@g 2 @"h    Ėpt / @Ő db@  @pb   T`8   I$@ "`0@ܔ  @x $@ `H@ɔ   @x 2 * u0,% @  2T`@0 T`@ @Y@p/@0@p'"@o %s/%s067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover('H * ""  " ""* @ *`  8@ ' ᠬ? H`''@  b@(  $P@ @h   ^      |$''$@ݔ "`0@  @wʒ $@ʔ `H@   @w 2 , 唖X0H,@ #c @   c @  07@ 2@@)@\4  # @\*  `  @%@@@˒a@ˎ0]@e  x= 0-  H`  @@@c  `"`P"`TH`!3` `X  @*`X?c @ ?+?@    @  @   ᠰ 㿘@?@v  " :   @˓ 0 㿘@?  他0.@;2`/usr/sbin/sendmail071|not sending email: %s%s -t < %s #@'  䕖0 (@D@Ȑ@(#)screen.c 10.15 (Berkeley) 9/15/96㿘& @$ 2& ,   ` & $  $ $  $ , x$ x$ |f$ ` "d@[ F$ d "`$ $$`, `@ $ ``" ``@T .$ `$ `؀`" ``@H "$ `$ ``" ``@< $ `$ `쀢 "* @ $  є  耢 2` ɔ 0 $ ` $ `@a8 d$ @$$  @l  &@ 㿘 ? & n `"$ @ " "`  @""@$ @y&$@   2 $@2 x $ " x@}  @v $ x " ] x " @j "$@d$@" @  ؀ "$@W$ @" @   " @J 耢 @D)@@`` 2``!``"  "`  `"` ``"" ` 2`"` "`@(#)search.c 10.25 (Berkeley) 6/30/96㿈 L  2v  ` `  ` P2N   'N@! ' 2$ @O @H`@`     #\ 5 J@ 2`  \2 @J` 2 @` @*` 2'"`     `2 `2 #\ 2 `@2&  㿀 \y 2ڰ ` B @ ] 2ʰ `@` 20?/ `  ' D $ " $$*`  * @`8  `@   `  d    (T   W  ` (T t`@  d @   " `Z@ W`$ " $$*`  * @`8   `E@ B`<  "8 ?  ?   @`"` ` (d@` a@{ &쀌` &@   ?& { `@ x \   "`@`')` $@ !?$ " $$*`  * @`8 2 @ @3   ?@ ꀌ <怌 '`  d   (T Ӑ  ҅    (T ǀ @A  d@ 䀢`2 @  $ " $$*`  * @`8    @ܒ  䀢 䀢 2   @͒  '  ܀ ܄  ? ?     @ݖ`d` 2z<    V쀢R䀦 而!ܐ@ ܲ `B ? 4?+쀢)? @  @`` C (d@%   і쀢䀌  &܀@   ?&&  ?('䀌 @{ 072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrapped㿘`1  .` 0H`x 0!  0   @0  `0  x0   0@ĭ078|Searching...㿘  ha@(#)seq.c 10.10 (Berkeley) 3/30/96㿈\ `d#\@š 2 `` @    "$ @$ v$  @' (  ު ` 5#  $ @ $  $# $ @ $  # `$ $  @ؔ $   @Èc  @Â@À "#  k - $ , $`$  !D $ !D"  "!D  !D@ $@" "$  J` 2    H* @*H 㿐#\  @&  @㿘`"  "` "@ @*@(   @"@  㿘\`2$@ !D O`  @8G`*@ 2< $ 28  @Ւ  @8.`*' 2# $ 2  @ 4`& 8 ``" `2&@0  $@ `2&@ 㿘!D " @¹  " @³  "@­`"  "` @¢"!D 2  㿘 !D  +!@2 $ 2{  @ ` *` *  !X@'`@H % $ c@$    @ ` *` *  !X@֐`, '@ % $ c@$ ` ` *` *  !X@͐`!cH2%s㿘 !D2 $ ""a@h`G  |   `   'S `? 'R@+ 2`` ?`&``@ @* &@@V`?`&``@ @* &@@V2 ` ?`&``@ @* &@@U "H` `C  | `   'S `? 'R@ђ 2`` ?`&``@ @* &@@U`?`&``@ @* &@@U2 ` ?`&`@* &@ @U2? " `   ?"` @(#)util.c 10.11 (Berkeley) 9/15/96㿘"*! @@&     @k& && 㿈о& 쀠&`?`  "@ '` 'J@ "  `'? ' B&㿘@ / 2 㿘@  ۠ @:. 㿘! $# @c&# ``"  ?  㿘! $# @j&#  "   #@  @  @(#)v_at.c 10.8 (Berkeley) 4/27/96 %lu㿀`0" @` @ *2 $$ @2  4 $  &$M"   I *    !@`  ` ` `@`2 ``2. `*` *  !X@А L= ` `""`0'$ `    k 2&    b 2  2 ``0( `$@ؔ 8  H   @(#)v_ch.c 10.8 (Berkeley) 3/6/96㿘 !.` !`$$"*` @/ @͒@a@ @:@K㿘 !.` !`$$#d,` x@ @6@@ @z@ "!㿘@  `@`,?`&`@`@ `<`@&`D&`H   "a㿈`0@` *!  "`4 쀢 3: ,`8 `0'h ` J@` ' `," `&`@`@" `<`4 `8@ `<`@&`D&`H 㿘@   `@ `< &`@&`D&`H  "a㿈`0@` *!  "`4Ϊ 쀢  :  @M1 `8 `0 '􀊨?`?J@ ' `<" ?&`@&`D`, &`H@ `8?&`8 178|No previous F, f, T or t search㿘% yP179|%s not found㿘% ` #* *  !X@" \@(#)v_cmd.c 10.9 (Berkeley) 3/28/96T@" H< 8< H|D hLDX@p8 DHLDDpp@ hX H( PDH08@ (XD , `t P0D D@"ݜC(8D@"pD@"`@LDH0(D DH`@"P8ܤ@ 0<lD L, p, X8@"($  mD hX8jdD (F pEHEp `@ 0 ElEd@"T  pHD@(Ө F `D xXeD H0r x D@  pD@ h`D `@D@8݀B"X nD @ x X@jD 0dF |D ̤ LDx`DP8XD (`@"p  x `HԈ 0F `x fD q pXs 8t@XD@"XD plD@"`@\ 0 ~ reverse case[count]~ } move forward paragraph[count]} | move to column[count]| { move back paragraph[count]{ z reposition the screen[line]z[window_size][-|.|+|^|] y copy text to motion into a cut buffer[buffer][count]y[count]motion x delete character[buffer][count]x w move to next word[count]w u undo last changeu t before character in line forward search[count]t character s substitute character[buffer][count]s r replace character[count]r character p insert after cursor from buffer[buffer]p o append after line[count]o n repeat last search m set markm[a-z] l move right by columns[count]l k move up by lines[count]k j move down by lines[count]j i insert before cursor[count]i h move left by columns[count]h f character in line forward search[count]f character e move to end of word[count]e d delete to motion[buffer][count]d[count]motion c change to motion[buffer][count]c[count]motion b move back word[count]b a append after cursor[count]a ` move to mark`[`a-z] _ move to first non-blank_ ^ move to first non-blank^]] move forward section]][[ move back section[[ZZ save file and exitZZ Y copy line[buffer][count]Y X delete character before cursor[buffer][count]X W move to next bigword[count]W U Restore the current lineU T before character in line backward search[count]T character S substitute for the line(s)[buffer][count]S R replace characters[count]R Q switch to ex modeQ P insert before cursor from buffer[buffer]P O insert above line[count]O N reverse last searchn M move to screen middleM L move to screen bottom[count]L J join lines[count]J I insert before first nonblank[count]I H move to count lines from screen top[count]H G move to line[count]G F character in line backward search[count]F character E move to end of bigword[count]E D delete to end-of-line[buffer]D C change to end-of-line[buffer][count]C B move back bigword[count]B A append to the line[count]A @ execute buffer@buffer ? search backward?RE[? offset] > shift lines right to motion[count]>[count]motion < shift lines left to motion[count]<[count]motion ; repeat last F, f, T or t search[count]; : ex command:command [| command] ... 0 move to first character0 / search forward/RE[/ offset] . repeat the last command. - move up by lines (to first non-blank)[count]- , reverse last F, f, T or t search[count], + move down by lines (to first non-blank)[count]+ ) move forward sentence[count]) ( move back sentence[count]( ' move to mark (to first non-blank)'['a-z] & repeat substitution& % move to match% $ move to last column [count]$ # number increment/decrement[count]# +|-|# ! filter through command(s) to motion[count]![count]motion command(s) move right by columns[count]' '^^ switch to previous file^^^] tag push cursor word^] ^\ switch to ex mode^\^[ exit input mode, cancel partial commands^[ ^Z suspend editor^Z^Y page up by lines[count]^Y^W move to next screen^W^V input a literal character^V^U half page up (set count)[count]^U^T tag pop^T^R redraw screen^R^P move up by lines[count]^P^N move down by lines[count]^N^M move down by lines (to first non-blank)[count]^M^L redraw screen^L^J move down by lines[count]^J^H move left by characters[count]^H^G file status^G^F scroll down by screens[count]^F^E scroll down by lines[count]^E^D scroll down by half screens (setting count)[count]^D^C interrupt an operation (e.g. read, write, search)^C^B scroll up by screens[count]^B^A search forward for cursor word[count]^A@(#)v_delete.c 10.9 (Berkeley) 10/23/96㿐`0 2 " ` `4`<  Ll 2H `4`<NP 2@ `Dɀ` ɪ 24   &`D+&`H`D  Ǩ    Ǡ  &`D`0   >`H @ &`0 &`H`0  > @&`0 @(#)v_ex.c 10.42 (Berkeley) 6/28/96X  `4 #\B ,[ @~207|The Q command requires the ex terminal interface 㿘 (€   (\   L"`  P"` `2-$`@ "$  -& `4`0(`` p `4  #\@.<X `4 `<#\ښ -H @>X `4 `<#\š -ۖ @suspend#\X 6    -– @180|No previous file to edit  -ѯp    2 #\X    y @@#\X 9   _  !0@t@#\p ;   E @!`0@ p`,'! @"@ p `4 `< %#\-   d?#`$ 2A   $' 5 !b@ 20  x 8  L&`D P %&`H@;Аp `4 `< #\ "$    d  2    $' @!'`  "#\0#\p ,p G   Ś @@p㿘` € @2 2 㿐  %L |  > :@@Hက 2w  x 8    @ 2i K J`!T "!L!L*`  * @`8   @ 2M     X  2C @;6$ ` ?"`* $@Iڐ Op3@= ! ` , & ,` $ @=v&$ 2 @ 2    @%㿐 L   & L & P P ` & P L&`D P`0&`H > &`0 㿐   @ 25 ޔ 2. @Q  " f# `" `" ` "  ` L2`L 2$  "`L$  @ "$ $ $$307|No ex command to execute㿐 L ؘ   L   @)   /Ͼ       $$ "$$㿐   2 @  2     2&  ƌ 2 & ``[ &  㿘   E          `X *`X  @(#)v_increment.c 10.12 (Berkeley) 3/19/96@80( %#0*lo0x%0*lx0X%0*lX%+ld%ldabcdefABCDEF181|Cursor not in a number` # +.`` + -`(`@)  `0(  ` @  `4   `8 M"    * p`8&P@>8 J`0'" $ J  X x M"@    0 H*`@b8:` =J  X00F D J@ 0  @M"@  ! *`:  8 90+  J@ + - @M" @ `0`   M"@ `0`   0ΊX E!M` !``" 04"01"@  *`:  8 9) ?Ȑ &0  "   $ "@  0 H*`@a:`  $@ ` $   (T! 2' x 2   t  x  $ t t x(T'!$(T @i@-@` 8x|  `q ` - | `#" *` | |`   " 4T | '|0`  "`  d|@{Δ# 8`< ` + xx:`@1  - "`'x? dx@{`c8 c@@@@@"$`4##  ' @'` ` `t@hT >"hT@182|Resulting number too large183|Resulting number too small㿘`  ``  0 @ 11Q@(#)v_init.c 10.8 (Berkeley) 3/30/96㿘 @!̢  &`$a,$a !H "!|@ $aD *  !D@!H!H$aH!| " !@q $a|   !,a!$a!$a 㿘 !0 "!D@!D "!|@ !| " @ ! @@&  㿘`1""`H`%"#L& "!" " #D#D* @ *`  8 " ""* @ *`  8@@+D@(#)v_itxt.c 10.16 (Berkeley) 10/23/96㿐`4   2   @2& P   *`" *   W@x@ & `4W& L 쀢 2 ' `"  P @& P #\`0( `#`#d @  㿘& P`4h P "    *`" *   @x@C  & `4& L 쀢 2'  " #\`0( `#`#d @ 㿘@  㿘@ x@   L&  2Z  2& P''B & P3 !` '*`" *   Ö L 24  L 쀢 2+  L  L ~ 2    L@ & L " L ?#\`0( `#`#d @E x`0`4`< > &`0 \쀢  쀢 ې@  & `02`&`8! "!!*`  * @`8  `4  `4k`8 2ܰ `4& L`8 & P  *`" *   2+`0`4`<@&`0" ``4`<D˘ 2  "#\`0h` #`#d@Ě " ``4`<D 2 > `8 :`4  2      (T!"`8`8'͔耢? x(  t t x "\ $ t t x(T'!$(T`8@!`4`<FM 2G `4`8 2= `4& L`8& P'`4쀢 쀢 2'* `8 :#\`0( `#`#d @? `   ` `t@hT >"hT@x@  & `4C쀢  쀢 2'"   " H`4  &`<?&`@#\`0(`<` #`#d@ x@J  & `4 쀢 쀢 , ' " `4`0&``,  &`@ @"`8`82`8@!4 `, "&`@ @" &`@`8 2&`@@!ڐ# `8`@ `, "`< @`4&`@ &`H&`D " `< @&`8`<`@&`D&`H 㿘`, "&`@ @" `,`8 2`,@!   &`@ @"`<`8?&`8`< `@&`D&`H@(#)v_mark.c 10.8 (Berkeley) 9/20/96㿘``4D 㿘@  㿘@ 㿈``<  2 "#&`@0*`<  ߘ쀢 2 `@쀢 *`,2`, `,    @"&`@`0 &`0 &`@`<Ք`@ "`,k @k "`< @`< `@&`D[&`H2`4`<`4@2 `4`@`8@2`4@ ߐK `<8 '2`4`8`@@(`4'`8'`<`@&`4&`8&`<&`@`4`8&`D.&`H`4`< '`@ %?&`<  p 2  @2&`@'`4v  `8쀢@  `0 &`0?&`@ @(#)v_match.c 10.8 (Berkeley) 3/6/96184|No match character on this line185|Matching character not foundp`4ܖԀ Ԁ  Ѱ `8؀  8XpJ >% <])  (<( ) > [{[  ]ܖ} {  }"#ؐ`4''䀢 2      0`` 8ƽ 0n`4&`<䀢 &`@2`<`8 :`<`, " `< @"`<`8&`D&`H`@&`D&`H`, "N  @"I `4`<@"D `4`<  'ꠔЀ 26  @:`4/ `4`<@ `<`4 v؀ 2   ؐ  'ܒ"@`'J@    `'ܐ? '`0  &`0@(#)v_paragraph.c 10.7 (Berkeley) 3/6/96㿈`, "`4 @"`4`8 &`@`4`@H&`< 2 `8`@@8`4`0 &`0`4 " 2`4`0( ``, @ "?    i``?0a`"?@{ ?= K  .?"6`,ܨ2ڨ(֨ !|J  K *`:  2J` 2K "?K @2?J  `"@@ 2?2 `, "&`< @ &`<&`@&`@`4U`8&`<&`@`@&`DP&`H@L`4@@2!`,h쀢 쀢 = :&`8 `8?@ `,`2`,@r ) @ '"l`0 > @&`0&`< 2?`,  &`@ @"`<`4`8`<`@&`D&`H 㿐`, `4 @"`4`8 ?@`4 `0&`4 &`0&`8`4 y ' 2r `0( ``, @ "`8  ?  R``?0J`"?@~ ?B K  .?";&`<ޤ2ܤ(ؤ !|J  K *`:  2J` 2K "?K @2?J  `"@C 2? @f &`<&`@ `@&`D&`H㿘` @ @`@"! @x  2  ĉ  !| `@`@ٔ`@Ӕ&!| @(#)v_put.c 10.5 (Berkeley) 3/6/96㿘`0@@p`0(* (``0" ` `4`D٦ 2 `D`H&`4&`8 (T 2       (T   ؠ? 㿘`0@@5`0(* (``0" ` `4`Dk  2 `D`H&`4&`8 (T 2   M    (T   ؠ?  `π!;ԇ( $, 2  3  4  5 6 7 8 9 *`(@(#)v_redraw.c 10.6 (Berkeley) 3/6/96㿘 h€ @(#)v_replace.c 10.17 (Berkeley) 6/30/96186|No characters to replaceh `4 Ѐ H Ѐ2 `0 ;Ï= ( ``4`8&`<@@&`@@`4+ `0@O  $ @2 ؔ   ?` 5< *` ,ppX  耢  ܨ  ,<$@$ $$$ @  @2U؀ ð 0ݐ`ٰ     (T!Ѐ'̐̀ x(  t t x " & t t x(T'̐!&(T@Y '@ "`4@ 2`8`4&`@Ԑ`8  q&`<  `8`8@'Д" &' ! "!!*`  * @`8 Ѐ Ѐ J` `  А 'Ԓ`'А= 7Ѐ "%&`@ ! "!!*`  * @`8 &`@ `4  @Ƙ 2)   @2&`@&`@  2?`4&`@  I   =   <@@`4   ` `t@hT >"hT@e`<`@&`D&`H@(#)v_right.c 10.7 (Berkeley) 3/6/96㿐`4   !G  `0(`8`@`&`@`8?@2`@`, " @2`@@; & 􀢀 ?`,`&`@`@"`<`4`8`, "`< @`4&`@`8&`D&`H`<`@&`D&`H 㿐`0((` #&`@`4`@ 2N `, " @ `8`@@`0 &`0`@B&` 24 `<   "( ' 2?`,@'"\@ʒ  `,` &`@`@"`<`4`8`<`@&`D&`H @(#)v_screen.c 10.10 (Berkeley) 4/27/96308|Enter to execute a command, :q to exit187|No other screen to switch to㿘@@  =P@" " 2 "  =W 0   " "䠁@(#)v_scroll.c 10.9 (Berkeley) 4/27/96㿐`0(` `  ' 2  " @'`4     " &`<@; 㿘`0(`<`? @AT   @' 㿘`< @AF   @ 㿘`0(`<`? @A2  @  < @" D ,%" H  0 < 4@ " 02 4 @ 8: 4 ,'   8" D" H 8" D" H㿘`0( ``4 " &`<&`D`@ &`H@`4 㿘$@0 @2`4@0@㿘`0(`4`@`E 2`,@x`4   &`< @"`<`4`8`<`@&`D&`H 㿘`0(`& `< @;   `< `@&`D&`H㿘`0(`& `< @;   `< `@&`D&`H㿘`0( ` @2$`  !$`   @$X* @*` `8* @$`$X:$` @ "$X$X* @ *`   8 $X*` *  8@Đ  ?`<@;]   `< `@&`D&`H㿘`0( ` @2$`  !$`   @$X* @*` `8* @$`$X:$` @ "$X$X* @ *`   8 $X*` *  8@y  ?`<@;  `< `@&`D&`H㿘`0 (`<`@:   `< `@&`D&`H㿘`0 (`<`@:   `< `@&`D&`H@(#)v_search.c 10.18 (Berkeley) 9/19/96㿘@" 㿘@ search+%lu188|Characters after search string, line offset and/or z commandx`0@   @ p` / ?#@ "#8#8*`  * @`8 "" " " @ 2װ  x`8 р 2  L`,&`< P` &`@`@R `< `@&`D&`H`$ `$ $! ! @$!  L PHc܀ 2 ܀ $ `  "l `<d&`<h&`<p&`@`< 2`,`<  #x M {&`D ` @  @Fm`U @L z] M" @  ` @Ӑ *`:  + ^  2;  ?  25   2,  `<@@lf8  ֘ 2  aȐ!2a`<`@&`D&`H`0 > @&`0   @H&`D&`H 㿘 ``"     @u 㿘   @k %s%s%s[[:<:]][[:>:]]㿐 !4     (T!" x'   t x 2$ t1  t x(T'!$(TAA A!0@k` : @@     ` `t@hT >"hT@ې189|No previous search pattern㿐`,   @2  ! "!`" #\ `#\`4`<  `4`<. " `,  AP @E "`< @ @  0`<`@&`D&`H 190|Search wrapped to original position㿈`4`<@`8`@@  A^Q "`4`0 &`0`4`<8 '2`4`8`@@(`4'`8'`<`@&`4&`8&`<&`@`4`8&`D.&`H`4`< '`@ %?&`<  0 2  @2&`@'`46  `8쀢@  `0 &`0?&`@ @(#)v_section.c 10.7 (Berkeley) 3/6/96㿐#L " #D#D* @ *`  8" `, "`0 @"`0`8 &`@`4`@&`< 2 `8`@@8`0`0 &`0`0( ``4'` ̘ X "`J`{" ?`, "  `} ?2``{"0`,6&`<J  .?"&`,բ`2Ӣ` (Ϣ`J  *`J:  2J` 2J "?J@2?2 `, "&`< 2&`<"&`@J  ``4@@f (   c 2 &`< @2&`@`, "`< @" `<`4`8&`D`0 &`H&`H`@&`D&`H 㿐`4 @ o #L " #D#D* @ *`  82`0_ ( ``4  9`"J {  .?".&`<2`(J  *`J:  2J` 2J "?J@2? &` @&`0&`4 &`0&`8`< `@&`D&`H@(#)v_sentence.c 10.7 (Berkeley) 3/6/96x`4'`8'䀢 2 `0( `      2 2 `4@2`,`8䀢@ D H      2 2     ܒ ϢР ? T8̠ *                                                                             q  om  "  d 2b 2_ ` J `4@2`,`8䀢@@̒ ; `,&`<䀢`/&`@`@"+`<`8 2!`@ 2`42`@`4`< &`<  ܀  ܐ @2&`@`0 &`0?&`@`4`8`<`@&`D&`H x`4 `8  `4'`8'䀢 2 `0( `  T 2ְ           ~ z  % 2  ."  ? f ! Q2O ڠ ؐK ` )" ]" "" '`   2 `4 2k `4@1`8@. S`` " ``''䀢     ) ] " '} `,&`<䀢`+&`@`@"'`<`8 !? 2`42`8`4  ܒ&`4  ܒ 2?`0&`8 &`0  ?&`8`< `@&`D&`H@(#)v_status.c 10.9 (Berkeley) 5/15/96㿘`4   @(#)v_txt.c 10.87 (Berkeley) 10/13/96㿈 L&`D P@^&`H 2Y  a  !`$ L$ P$ $$ *`  * @`8 2  $ " $ $ "$$*`  * @`8 #\ #\ #`#d   @  $* @h$$   4 2`D$ @$$`D$ L`H $ P4P   @ D < D@"((aa : a "  ᐄ a *a    (.ᐄ @"@"D"< 㿘 4 L a& <a& Da & @ < 8 <   (l@ @ (  < *` * ?@" a?"a" " ""*`  * @`8 2$a @7 2  a!@a@$aaȰ  4aȁ191|Abbreviation exceeded expansion limit: characters discarded 192|Illegal character; quote to enter㾨d\'H`d`x` $d`x'  @:$ (3$ $$  $ $  @ $ 3M " $$  2& " & $ 8`L$ `P $ d@" ' "  $ ('?$ d@@   d    @ ް   $ d  $ $$ $ $d@d  *@  $  $`$  $ $d    *      $ @/T$ ' 'd@ d " d|d|* @`*`  8`" dx`8 " " dpdp* @`*`  8','T  d2  d@  *@'d d@ /#/#' '4d@ '('( $`L  @&$`P ^ H0@ dؐ( O 4 "d 2 '\'4`4  "@ 'Đ`4'%\%X@&Z%T@&w ?` $H ȓ*` !P  +!<!!<!<!<!<!$d $$d@&:؀  0 @  ? `d@ `  `D ި  *@ 'd2e  d!$ aT "aLaL*` `* @`8 2 aTd d aT aL* @`*`  8J @" d@@% a "aa*` `* @`8 2 a  a a* @`*`  8J @"  "B$ 8  $@;$ 82 @4 '   F}F''d @$. "H*   DZH "c%D,D"* "@@"`"` "` "`"`"`d,"D* @ "  '  2 ``"`( '( '(``?  `   ($  <$ (  7 `M b  D2  @ [?`I!x*` 4-.(4@34@4@%+L4@48%334@/2400.d(  @-  ؐ d@@ G G   $@e c$ 8   T   0@, 20d 2 (  d@@3(d "   "    ?$ $     $ 4 $ 0@-)$   ($ ,d@@( "&   @J    , $ ,75 J  . , '$ ,J   a `a*` `* @`8  a    J     0b (`x&`|& `x@2`|$`x"$`|& & ( d `)&  x@H 2 ` ` t@T >"T@   @-   <& \ 2  ` 2 X "0' \` X      Ô "̐& @  \`X @$ \`X   @ & \ & `& (X& ' ( !       ؓ "& d   'd *    & `&  @,.   `d @:`'`  *@ 'd@"* ('d$ $ (  $@ $ 8#   $  @  $ 8 (d(T   0@I, A09d(  d@@ɔ(d  d  @  ?$ $ d@@`x@  (d "    @q   (" $ d @ d`x         "$   *@  ?$  @+  Ͱ 0  @d 2  @  @d 2  @d  @ K"  ="" 0G`wd $@ qd''   נ "' @   ' '`Xd $@ Rd     *?  $$  ("@   $ ( $  `>d $@8@G `@2  $@d `W$ 8`2  $`x@d `急`@͔# $   *@  (   @ $ ($   2  `x@Жd >  $@(d  @$  $ @ (  @ J?  2   ($ @  $ (   d   ($ #` $ (  *@  @J?  @ # ($ #` $ (   *    J? m l` @ (  @ ?M"   _2'0 '0  d M? ($ #` $ (  *@   ?⌐   _0 0 G#  @J? ? = ڐ?9#  2  `x@'d   $@8  d@`@ O` @$  $  (" @# $ (   ?$ *@  8 #$ #  /#d$@,  \ d@ '(  ^, (   ?j'( d @M b  "     G7d@2d` M"@  7 `_3 2! d2 T   0@,  0d @"   (  d@@(  M "@   `_  d@ ِ``  (?$ `$ (   ` @Đ`"@'!$ $ 8d@0 0 "     '  '      Չ "$ d   'd *    $ `$ ``" `" ``d@*d``!   @)   h "\`! 2 '@  Y '\ 2dT `d@`4  ` @ ? ``! # $`L @ @ t$`P , #  H@# ! d@dƐd*@$dd @2%Ld@   H D  H@> x 㿈'``$ ? ` 0 ?` ,` *M"@  `_? ` ?@  2`_"? ` ?@  `_` ` 2"#\``$2 @>  D'@'@ 2@ #\  қ 4   / 2+       " `"&` *` `(&`(" `(``(@@ @ @ے@`(  &`( `$@"@&`' 㿘` ` J  2` @ `$@"``@ `$@2  >.  ? &㿘&``q`$ m` i@8#&`&`c&` " ##* @ *`  8 ``   2 2 @~W& `??2L@9  4@~B&8`%$@""$@`@H" ```"@&`"&` ,@` ,@` &㿐'P`='  ŘP P5 'P J@ "P P`? 'P@"      ӊ  '  "  @@  @' '  193|Already at the beginning of the insert㿘 2  4@3 Oi`0- ( $  2  *@    $ `$   ?&@ &`"` "@*  @&@  㿐#Ā " ##* @ *`  8#| " #t#t* @ *`  8 `@`J`  @}[$ *  * @ a]``@*`@}A%@}:$ "  ``$` 2` ``$@ `@ J? "   `(&`@  &`( `@`J`  @} $ *  * @ a]h``@*`   @|$@$  &`  /@2 ? ` /@&  㾨&`  `` `L@  2` ` `$``` ` $@  F` " &`   `  @ *,@#\! A 2 A  ,@`(,@`2. @Q@\  I2հ @d  <  @2°  (d@ &@Ò 2 @`  -`@`* : @ @2 *  `    ? ?,@`  ``("&`@&`( `(  ?,@`(``&`( &` +```` @ $@  я` "W &```` @&``&`@@?? `? ?,@``2: @dK 22 <  2+ `( ?``` ` $@  Q` 2&` `` `@` &`&`(` &` /,@ %s %s%*s 㿐 @젒 /  $ `* @@@[    " @ `*`  * @ a]@  2 @8@{6 `"@$@ '*@&$' 8@-@7@#R`XgTT  t   ` `thT >f"hT@ǐcT?@2 @,@z 2`   H;R @7,@@``g`   ` `thT >"hT@T )R`h&@RfpT `@ Α,Rf`xT  * Rf`xT 2Tg ?&T $ &$ 㿐` 'LJ@ "5  @`L@" * *  !]ؒ '(Q```   `` 2&`K `  "`L@@@f```(L&`@`&`(J  `  $'L , ` * *  !X@L 'L @,` `L $* `@#l 㿘@  `& L & L$& P @&$㿘`` @*@` `J   `"``$J  2` ! $#  @: # `(``` "*@`*@```"&`"@&` *?`("` `` @Β` "  ```(  @Ò 㿈@" `(`(`Œ``&`( "``' ` @ *@ ``@!`*@*  * @ a] '  `( ?`&`(J   `@  `*`  * @ a] '"^'" U'``  ( `` " &``" @ `(@` `@E ``(`&`@&`(J `   ??' *@??`&'  * *  !X@@  `??   ? ?*@`' 2`(`"  &```(`   @ "%```    `|` 2&` ``  &``` @ * ``(@`@Ҕ `` * &`㿈 4 "N`8`4 `8&`D&`H@J \2 #p`" J \2 #p " #h#h* @ *`  8 J?@= "`" `4@J? \"`4`8&`D&`HJJ@2 "`4J \"  `4`8&`D&`H p.Ȑ`2$* O&$ 2c   @`4'`8`D'`H H'J / `D #\ȁ? `D #\]? 2`D& L`H& P . !  @ )  . 2"  ?Ȑ# @2$  &$a& !@  @ 2  h€  㿐@[`'``` 9  `@!+  / `@ x@"% 9'` `B 2  " @`@!  "@  @  $*@$$Unmatched %sx`& L` @& P 2u ؔ @)  2m `'`='䀢 2b `) { ( V  `,*!XŒ C     Ւ 9 `ߐ؀@**  ܀@*# & L @3& P 2 "P  "H*`  * @`8  *` *  *  " @` ` I   `@"G"`$@A"?` ""$3 `  " `("(`   "``(` `@ "`  "` `(` `@ "`"` "`(I`"``@"``$@  ?I "` "` " 㿐( / @ x2,  &(8 @`d @@(""@& &(& 194|No more characters to erase㿘W <H@(#)v_ulcase.c 10.7 (Berkeley) 3/6/96㿐`4`0 (`8` "6&`D %  `* @ &  ?&`H@ ?"$&`H &`H@?    2` А&`D 㿐`4  2#  `4`8`0 `<`@@ "`< `< ڐ 㿐     (T!" x'˛  t xˏ 2$ tG  t x(T'!$(T@ @@  MGI@   b"   *`@ ` /  *  2    ` `t@hT >"hT@f@(#)v_undo.c 10.5 (Berkeley) 3/6/96㿘&`H  X`*X  "4㿘  ,"a  X 2`0 *X  "4@4  " "44   `D R`D@@(#)v_util.c 10.11 (Berkeley) 6/30/96195|Movement past the end-of-file㿐`  @@  @Ȕ 0 XH196|Movement past the end-of-line㿐`@  ܘ `?@ @ 0 XŔЁ197|No cursor movement made㿘X h198|Already at the beginning of the file199|Movement past the beginning of the file㿘`@  X X200|Already in the first column㿘X zP     2J 201|Buffers should be specified before the command209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi commandWindow resize interrupted text input mode205|Usage: %s㿘<Y . ee(e@eXepepee X0' Y 0! Y(0 YH0  Y h Y0 Y@(#)v_word.c 10.5 (Berkeley) 3/6/96㿘@  㿘@ 㿀`0( ``4'`8'䀢 2   (  "`,@  '"\ `a` 2ְ ?5 ?%'"laP     2 `,` `@X@0T  l ؠ?h`, d?#M'"lP 2  b@  `_2 t a H ` `  b@  `_ 0@  `_ `,@2!`, "`,P        ?`,  @`4@ `8@`4" `,&`<䀢` &`@`@ 2`,&`@`, " `< @"`<`4`8`@&`D&`H 㿘@  㿘@ 㿀`0( ``4'`8'䀢 2ǰ    Ò 2        2 " w?  n    D u "]`,? W?#M 2  b@  `_2 w W > ` `  b@  `_ 0@  `_   Ò "`,B        ?`,  @`4@ `8@`4 `,&`<䀢` &`@`@"`<`4`8`<`@&`D&`H 㿘@  㿘@ 㿀`0( ``4'`8'䀢 2    Q 2       2 " w?5 ~ n    Dk l ]? W?#M 2  b@  `_2  N > ` `  b@  `_ 0@  `_   i 8        ?`4@ `8@~`4 `,&`<䀢`<&`@&`D &`H@ `8?&`8 @(#)v_xchar.c 10.9 (Berkeley) 10/23/96206|No characters to delete㿐`4 ǘ   9  2 `0 \ה. (`@`? &`@`@?@* `8&`@`8 @2&`H&`H`0" ``4`<W 2 ; 㿘`82`0"' ( `@ " &`8&`8`@ `8?&`@`0"&`H` `4`<' 2   @(#)v_yank.c 10.9 (Berkeley) 5/19/96㿐`0" ``4`<3   2#  t `< `4@ # @ " t`DV  `0  >`H @ &`0 &`H @(#)v_z.c 10.10 (Berkeley) 5/16/96㿐`0(`'    `4'`8&`D&`H`0@"+``"'`$` "$X$X*`  * @`88$``(`$` $X* @ *`  8&``@x 2s ` -" . +"`0G` ^"#`0A`@ 9 @ 3 (@   2N `D @"  # `D < (@ 2: `D @!  22 `D@  `D < @ # 0"`   'S 'R@    `(`\   @    "<4 "D"<"D<((!"! @"@(#)v_zexit.c 10.6 (Berkeley) 4/27/96㿘  X     G        $ "$$@(#)vi.c 10.57 (Berkeley) 10/13/96110|Vi command failed: mapped keys discarded231|Interrupted: mapped keys discarded236|Interrupted0  @ L`0` @Z$`0 "      蜟    *`" *   2 Ȑ @ 2ת Ȁa?" @ 4Ȑ $ @ 2Ǫ `0!`  T? @!4  *`" *    '} D' |  &#$`( @ L  @̒``^#0*` {HD,{\ύ~ `( @"'`0 #X "#P#P*`  * @`8 2 @`0 "`0 @`*` *  !X@! @   "``(`0 @p@$`0 L' P' L`0$`D$`<$`4 P $`H$`@$`8 @`䀢 "`0 (T 2   q   (T 2 `0 ((2 ,`<`? $`< , $ ,`(@€ $+ ˔ @"   @#Д J&  ޠ     Ȑ 4`0@ 2`0  L@m   "`0$ `Ȑ("` `Ȑ >"``0 ! "*`D % "0 " @"$`H0! 0`D@J @$`H @ 4Ȑ`Dò`H +`D@H`D$ L`H$ P`0@ L@  L@ '  "     ^c (T 2     2$ (T "$ T  "T  ^ ^ >$@*@ $$    (  Ȓ  @j4Ȁ 2 $( 7  $$` (T 2&$ " &@ ], h ~ change case to motion[count]~[count]motion234|Only one buffer may be specified208|No command to repeat210|%s may not be used as a motion command211|Already in command modex@ `?ؔ@֖   2& &&&&& $&$耢  쀊  '@ `"0M  s    @  耢 쀊 2'@  0."@&0 耢 쀊 2'@M" `@  `0@D ٰ  0  (&0@m' 耢 쀊 2'@'`"5 `0"   `C  ؔ@J  耢 쀊 2'@  0."@6&0 耢 ~쀊 2'@ `~ * * !X@˒ ޔ w .*& ,D @0("'0& 7&0  `~@ [`~2&( $ "##*`  * @`8 `&( `!T&( 2I0 ``.`*` *  !X@耢   ) `t ! ,@2 `0'#|&( 0 &0@2 0 `  (h&`0&`0".`@) L h@A2" @@b7@@ @  耢 쀊  '@0."&0 [ ] Z2> @b  耢 쀊  '@)2  ~& $ "##*`  * @`8 `& `!\&`,*     z9 ؔ@"  耢 j쀊  '@M." `@  @Ք j   0 @&0 ]耢 G쀊  '@. ` @`` !*` *  !X@ Ŕ6 @ @̖  *耢 쀊  '@.@ @    "  0  ` (d@ @0! @ L    @ Lؐ ?'؀( '0(  @z('('0 7$&0@2'(0` &0 L &4&8 L @ L&< < H c !Bt&@ @2n&@'`(!T@  '#&(0  !  ?ߐ >&0ؐ >@' L''' P'''€ 2Q <ΐ <  c ! Δ < &@`!T&(0 !@!&0&0&,䀢 8 &42&4耢@( &4&8&<&4&8&<&@&D&H( @@\ L&` 214|Windows option value is too large, max is %u㿘  (€  2p  (\ $" ? ` &$" * @ *`  8" $a!`  & 4!X* @ *`  8!X$`  & 8$X* @ *`  8$X& D 4 & <?@  & <& Dc <a 4?& @ & H! @\ϐ  "a < *` * ?@" ! L"@ !"  ! "`$ &$aȰ  4aȐ 4  %d screens backgrounded; use :display to list them㿘 ``* ` ! "@" "!@ $` "` @$`"@$`$ `2`$`"$``ܨ `@ $`"` `@$`"@`&` & `@2` $`" $` d Ж?212|Cursor not in a word㿐 L Ƙ 2b  P  M"     *   d8E "& P@ ݒ  M"@   `_  M"    _   2 *  "a4 'a0Ya4   $a0a0@@a0 *@㿐@ D  S C  $0 Y  _0 $/ d _/ c/ y.@     @& ,*`@235|Number larger than %lux/ !M.`*  ?Ѐ@ @& 2! "   e?  @ 2  "  Ց.`& 㿘 e" 3 24 ? + * @0xxH` 2 ߠ  (d@ @ Ԑ  `  @(#)vs_line.c 10.19 (Berkeley) 9/26/96%7lu 'L'P$@2$ !\ *$ "`  @ 4! &@ *` *  *  *  :  @`@ 'dL`d` tpp a &@ *@ *`@ *`@ *`@ 萟:` l@Yh"` 8"*`  * @`8 2 ` `" "`` ?@v", " "$"$* @ *`  8'\'\'X$@/\"  'X"*`  * @`8 0" @  x @e@Fؔ8 XLh W L`"d@ L@2d !&@ *` *  *  *  : #@ 8P"#@d`_t&`&` .` -.`X@  ~`"$l $ ``*` *  !X@s ``*`  * @ a]UXl@)td &` .`l`l` `'l" "1""*`  * @)`8 !@, ) @@%    .`l&` 'l" " ""*`  * @`8 2 8L 8 " "*`  * @`8hI" Dh<l  ` 'l\` `#Ā " ##* @ *`  8#Ā #*`  * @`8@f[$ ``*`  * @ a]h lP 8$G$Al  ` 'l\` `#Ā " ##* @ *`  8#Ā #*`  * @`8@f$ ``*`  * @ a]v h$? 8h l" $.`l&` ?'l&` .`L`"d@ L@2 d P@   "@d @2$tx x'`h ںl  ` "'l\`2 `#Ā " ##* @ *`  8#Ā #*`  * @`8@e$"  ``*`  * @ a]"  2.`$$.`.` $$.` '`&`hIdG`$ 2 ``=d !L&@ *` *  *  *  : #@$ P$#@" """*`  * @`8 2$d d$@ d `P@ #@d`d`2>@??"7@ ,@$@X ,@??`& ,@$@X `` *` *  !X@@??" ? @?,@``h + 6 ``*`  * @ a]U.``.`Xh`?&`  "5@ ,@x$@ X ? ? "0? @?,@``xl@x@ ,@X$@ tp萟 㿀$@d  !)`p !!N " """*`  * @`8 2@ "@ 2- ` 2  "( a $ *@ *`@ *`@ *`@ :` e@Dؔ 8 X ! ` @(#)vs_msg.c 10.77 (Berkeley) 10/13/96|/-\㿈$  <  hNh!` !\ $!``$!d!t@Lƒ !lhp!pݔ @ 4@ h hXhp!hhl@V @!` [?!\ $!``2!l @ 4 h hl@!lA!p!\ A!` <@L !t" *" * "@*`@ !x*`" @z G@+$!t!d`$!x$!d @ 4 !hh i!da  $!dhX @ 4 !hhh€ 㿘 @ 4@  萟  h€ %s 㿐$  `j xj j OOhp @ 4 h hl@` @}w 8?  hX@}d 8 @( "hXhh€ %.*s. ; 㿈 $@ hT ` hThd €$hT$hT $hT$@`4``` h€  u/ ܀`j h\ j!@`2L h\ L@q#$*@`&$ h `@e0hp`  @J? " 4 2' IX ' 8`?  Pj  Pj@  j @z$P J  _X .$  J  J   J   X$N " & J " "& &  "  J? ."@'"  j@  (T   /   (T hh €'H  x @ck '@X 8@ 8"@ 2\ @ 4/\ 2\ @@  l@@j\ 4Ȓ`T$\ $T\ @@2\Ȁ  $\?T#Ȓ$T 4\  @  @ 4  \T $\`$T (T ~    H (T s`  4 H x \ x?;M@` " ``*`  * @ a] ,$X ``*` *  !X@ޒ??" ?? @?,`??ɪ`,X$H 2l \ l@$X`&4*`tpX.x  &@!!X ` 4!Ȑ!Pl $!X $!P$`  h€  "$t @2 $!\ *@h&$$* @'&$ (T 2#$    2$ (T 2$$" @`?`@@@@ 2= $ " !Ȑ 4!  @"!$ @&$!Ȁ $ &$ h\ ?$# @&$!\  '!\ 4  "@ ' 4'$!\$!X@|$!T $!\$!X$!T p ` hphT  ?$hThd@$@*@&$ L А`l "(\$ 2`l@j  "`lJ  h `"  "` "@@w! @w`l 2 Ȑ 4\   @(  Ȑ 4  @  '\ 4  "@ ' 4 '$\$X`$T@h 㿘  4`' a\ :   @ : ""@( (t@  @ @ 4 ( (@aT @@ @p @ 4  (  4        `@w2(Xa\$aT $a\(l@(€ `2&@ؔ  "   q(d@/(T $(T   q (T $(T :`2&@+=+=+=+=+=+=+=+㿘 8`8   (\ n`x(X (\ %.*s 㿘 @R  )M@u $ @zo$ $   l`2@$" l l$ @ 2@@ $@" "@$  M@vM Hn`@Rp@(#)vs_refresh.c 10.44 (Berkeley) 10/13/96㿘` `8 *  a*@ *` + "`   `  &`  㿘$ @    @"$ &$  "   `"*`  * @`8 2 ` " "`  `"$&2 !Ȁ"  !Ȑ `@<` aȐ 2a瀦`  $  !   @%    '$"  2$`€ $  $$h  $  $$!  L@m   L   @b  $ @$$ D @ "   L!@:& @/ @`2` Q @ M "  < @@y `@+" Ͱ? < m$ < <!@(h  @@ @`2` ' @ # "U  < @@"P  !@d`  a"a  a ? < 7$ < < @ 4 ( (l@ <aa " *@ *`@ *`@ *`@ (:`(l@ < ?$ <a?"a < D@8  L   La*/$a@( "$!2  <  22 @ <`2` 0C A??" "@ y /?? "!2u o <  22 @b  <`2`  ?' ;  ! ??"] "@] ??S "܀   L' ! ܐ' ' <@- <`2` ) L %& ' ! '' <  L 2 @  <`2`   L   L  L @ ʰ $ @$$ " " ""*`  * @`8 2n$  L@@2b$@D P  La )@ :&  < "@2 @8  `(    @"$ @ $$@ Ð   ! @   L!@2*$@ (&$ < $@ 2 @8  `(    @"$ @ $$@  T  ! @$ @` " " ""*`  * @`8  !" "Ȁ 2  L2  P@ ؖ Ѐ Ѐ 2   P Uؔ   P'Ԓ" `     ? 'ؒ `*`  * @ a]~ ` ?*`  * @ a]  ~  ` *`  * @ a] " ~ "@ ["R$` P '-"   L'ؒ `*`  * @ a]~d " "*`  * @`8  8"  8?:$$ " "*`  * @`8  8"  8?:  (p  L! 2  " """*`  * @`8 $Ā   P L@# "`"*`  * @`8 2  " "   ) # "##*`  * @`8: #N *K # " ##*`  * @`8""9$ " """*`  * @`8 2 8  8 " 8 8  ".$ 8:)$ # " ##*`  * @`8 8 $@" .& !!) &  ! (&    @2 $ ?!'̀8[ L@U ̀?2K$ !  !!8 $.  ! (. $ !?!'̐ l̀?" Ā "$ ! $ @  D @ " <@ 8Đ( (l@ @`@ Ā 2  P$ ""$U$ L$ " """*`  * @`8 2` `Ȁ  `Ԑ 4 `2``` 4 `Ȁ  `$@`@>` `(`@w T`(€ `$ >$$?Ȑ#J @4ȁ͈ͨ͘xh219|Replace218|Insert217|Command216|Change215|Append%lu,%lu x @ 4  (   @   "(l  L 2  8  ?` ;2 L`/ *  * @ a]|h@@("   bq* b  @@   `*  * @ a]*`|J:`$@@8  ?8L   bq(Xbl  b(Xb'L `* *  !X@*`|+:` `*  * @ a]*`| :`(X L  (l@ 8#(`?# *`  * @`8  9# # 2@ܐ sܔ L@9* 'ؒ`2 $2 @ ` @ 4 (@@ sa(X ؐ` ؐ(X# #*`  * @`8 2  `# `  X 2?s aP*@ ت$ `- @ 4 (# " ##*`  * @`8 2 0   X   bY(XbTؐ(X@(#)vs_relative.c 10.11 (Berkeley) 5/13/96㿘 " "*`  * @`8   "    8@hO?"  "*`  * @`8 2 &@" "&@&@ 㿘  " *` * @`8 * 2 a  a   @ 8@hǒ@X@ " "!"!㿐'H`  H2  H 2", 2'ư " "$"$* @ *`  8" " ""* @ *`  8 " H"*`  * @`82  "  2K??' ` ` `#Ā " ##* @ *`  8#Ā #*`  * @`8@X&@ ``*`  * @ a]zo  8 ` &  @W$??'B` ` ` `#Ā " ##* @ *`  8#Ā #*`  * @`8@Wΐ&@ ``*`  * @ a]z+  8 ` &  @W$æ`   "5 $'㿐  ~V    ?0  T @ 㿐 ~<  2", " "$"$* @ *`  8" " ""* @ *`  8 8 @g@WTL 8@7 " `2 #Ā " ##* @ *`  8#Ā  #*`  * @`8@W)$@W%$ `*`  * @ a]yʲ@\ 2 8  8&@J  ` #Ā " ##* @ *`  8#Ā #*`  * @`8@V$ `*`  * @ a]yB@@* %?80 @ 8@ *  $@  @V&@2 ?@(#)vs_smap.c 10.25 (Berkeley) 7/12/96㿐 ` `      ` a@8 a@1"  < " <t @m"  L?" L ?& L"  L " L  & L!Ȑ L4!!$! 4! L2$!Ȑ 4!$@2 `2! !\ ( !Ȱ  04!Ȑp0"0@ @ 2 !Ȑ  4!@# "   @m ( 㿀 < ??!*??$ @ &$ iJ`0''' <  2 @ <2@`1~ "'ǰ  ' <  22 @ <2@( 1 <`8. < !"@ !"` !i "   !" !"  ! "`   , a"* * * * :"* @o5*!   $! ( @ $&?&?.  ɰ `@  㿘 !2 " """*`  * @`8     !       < $  %$, ̖ *,˰ `$ "@*` *  *  *  :  @8`0 $ *@ *`@ *`@ *`@   萟:`@  -` * a"* * * * :"* @n*   !{&$?, n "  l` $ a $ *@ *`@ *`@ *`@   萟:`@B P -`@*`   "* * * * :"* @n/*-` &$?, # נ  `-` a* "@ !@H  2    2  !2  㿐 Ȓ@2Ȁ 27 "z#P. pppp됐@ @  @j"" ` 2  @y`   ` a@ 2o  !@(& D{ 2! D !@ϔ 2S @(  Dz 2 D' D  @  R !@'`'`'` '`'`@' 2( "  @Ȁ @z ȴ̀?'''' !## # Ԑ# ؒ # ܔ #  2  @ @Ā  > < @@9 a@O  ! " zs & !`"!"`""" ""  a k2 <Đ ' < & <&@ &`"  4 a@  K ! z/ "@ ;  !8?   !(? !2 2b " `70F-"E 0@"R &@ 8 T@Qq"`"*`  * @`8 2   " "   8@`ِ?Ԓ&`,  !"  !"  yĐ   @h  2  H  &@  &`㿘   @(  2#  4 ? !  *  a*@l!  !@V    a 㿐 4  (l@0(p@ @ 4 ( (@(2(t ` ! $" " ""*`  * @`8   !    !Ȓ `  D @`?@] !@'`'`'` '`'`@G' 2B "+ @Ȁ Ȁ 2" " ""*`  * @`8 Ѐ ȴ̀?'''' !## # Ԑ# ؒ # ܔ C#  2  @F  @Ā / < @@* ! 2 " " ""*`  * @`8  !   `@" f < & <&@ &`"  ; ! " " ""*`  * @`8 ( !  "@͐ 5  !*    !:  !2 2v ""  0Z/"Y 0T !!(Q x% 2K  !?耧8C !' *` *  *  *  : .* /'- `"; &@ 8 T@Oy"`"*`  * @`8 2   " "   8@^?ܒ&` @f  2  g  &@  &`㿘 @ 4  ( (l@ <aa " *@ *`@ *`@ *`@ (:`(l@ < ?& <a?"a < D@8  㿘   @(  2#  4 ? !  *  a*@j ` !@n    a 㿐 4   @  ( (l@0 (p 4 ?( (t@((@2 @ 㿘." """*`  * @`8 2@  @ &`&@ݔ ` @ & &` & 㿘." """*`  * @`8 2@ ` "`@?&`& "@@&`? &&`?㿘  L!@ *: ! 3 1     2  a8$  a" ``@2&@ ` 2 @ < 2 @ P@:&@ a ` 220|Movement past the end-of-screen221|Movement past the beginning-of-screen㿐"+ "r 0 !!"@ *` *  *  *  :  .* vZ 2 @!vN 2- vw 2   (   (    !v&*` *  *  *  : 2 @:`*`a !!"@ *` *  *  *  : 2 @:`*` * .* M!!" *` *  *  *  : /.* "u 25v 2?    ! (    !& *` *  *  *  :  . h~ * &@d 2  I  &@  &`㿘 b "bb*` `* @`8 2@ @ "@@(/&-&@`'?`? F ?@ = `"    1   @(#)vs_split.c 10.31 (Berkeley) 10/13/96222|Screen must be larger than %d lines to split㿐 4    @~s      42  8  ! @?ؐ ` "a ~Y `!`2 L "@`!" `! "` D @  @  8&`80  !"@*` *  *  *  :  0 "%&`4 4"&`4 H&`H H$ 4`4 $ H&@ &` `@2"@$`$ `4 @ " * a**@ *`@g^  4 4 H"@$ 4 &`H&@&``@2"`$` $ 4 @2$ @`4 @2+&`@ <`4" $ < < @ 8$ < D @ 8$ D $` " $X$X* @ *`  8&`< `@ &`D&`<`D`@ 8#&`D"  4  2?$ < $`  $ D$X* @ *`  8$X&`<`4 &`D`  &`<&`D  4  <*` * ?"``4 `<*` * ?" @2  $  $ `@2  &` &` d $ ` &d㿘 `"   L"`  P"` ` 2`     4 4  "4 "   H4"H 4 @"4 `2&@ 2 DB  @@ 4?$ D$ < 4 < ?$ @2 $ *a a*  "?"?"? "?"?"? <  *` * ?@"  0  D    ?  @b$ $$223|There are no background screens224|There's no background screen editing a file named %s㿐  @  ^ @' &@!!Ȑ ~I )@ `$ "` @$ "$ - " " @2 $ " $  @ $ "`  @$ "@ & &  @2 $ "$  225|You may not background your only displayed screen㿐  3  2  |O)  @ & "`  @& "@ $ $  @2 & "&  @a>!  "a$ $ $$㿘 @; &@  `" &  L"`  P"` ` 2`& $  &$"a 8D&8 4@&4 H &H` X* @*`  8&<&D @@(D@&<D @@ @&D4?&D&@&<@2 &a @=J  "a {˔ 7 <*@ *`ጒ "L  "%  @$ "` @$ "@&& @2"`$ &aȰ  2a @@&227|The screen cannot shrink228|The screen cannot grow226|The screen can only shrink to %d rows㿘`    @  " &@ @&  @`@ 3   2 4/` @@*  2  4 2 @#(#H{, D `@  h{  8  4 H"# 4@# H4HD"4@ <"H@ "<"D.`@@*`"@ "䠔`  " < @"# <"@ D # @# D !"@ "!$  #$㿘`     2     @  2   "   @' / 2   @f  2  " 㿘@ Ȕ`X PH@80(     werasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscardrprntflushbrk㿘@@option requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %s㿀b   @@6'蠒 2`h  @6 2] `&` 2 N @@ N u2 N@` " N <2  @|` 2   3@ @ʔ `! @۔@ J !(@ђ@  @* (N ^N @ `? `-   *(@ * ( &` illegal gfmt1 option -- %sillegal gfmt1 option㿘  @c@@c`gfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d 㿘   @p#"`"# c @c  2 !@.נ#@.Ґ@T:%lxcflagiflagispeed%ldlflagoflagospeed㿐'H@  : 'H H  'H'H@f` L @ h = 2,,`@ܔL c i@` 2Ls&  i2 L@` 2Lf& i2L@` 2 L@U& $ l2 L@z` 2LH& o2 L@m`Ȁ 2L;&  o@``Ѐ  @*& ("` "`@LJ@2` @H 2` @? @l@ * @ ` @ HH gHttyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingdeccookedcolumnscolscbreakall㿘@@illegal option -- -%soption requires an argument -- %s㿈L@ -2&` &`@'`H  @4٘ L 2 # 2  `  h@7@ .  "  &  &` @&@  @ 㿘  D @ 㿘   @0&  " @&  $& $ >& $㿘@ 6 F &  * + * - * 0  $"  ߆C" $" 㿘  D @ 㿐   '`` '``@_ & 㿘 @N @- &    ( " "  $@ (  "  "  $@" $ "    "  " "  " 㿘 @ @, & 㿘  @0 @,ڐ  &  ? @c& 㿘@ 6 D &  ""  "  "  `"   $gˁ" $%d %d 㿘 D F@B %d 㿘 !@, ؒ@7TIOCSETD㿐' `@^z  @*aTIOCSTART㿘@^j`n  @aPTIOCSTOP㿘@^Z`o  @ a$8$0$($ $$$$### # ###3###3#2#3#3###@#@#@#@#x#p#h#X#P#H-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5&&&&&&&&&&& & &@&@&&&x&p&h&`&X&P&H&@&8&0&(& &&&%% % -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk+`+X+P+H+8+(+ ++++**********@*@*@*p@*h *X *H *8 *0*(* ****@)@))) ) )C$)C)C$)C))))x)p)h-xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho,,,,,,, , ,,,,,x@,p@,h,`,X,P-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostopost㿘aаaЀ  @Ȑ    ` *@&`   &` X&`    <` <  @    `*@&`  &`=&`   #`#  @    `$*@&`$  &`$"&`   #h`#h  @w    `*@&`  &`&`    tablet disc; slip disc; ppp disc; strip disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-oxtabscflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s Ȓ @ ```"  `" """Ȑ"@ @"@(@(| "@#@@`@#(" @#@ @Y#H! 4  `#P@b@  4  `#X@W@$ 4 `#`@L@  4  `#h@A@  4  `#p@6@  4  `#x@+@  #@!@  4  `#@@ @ 4  `#@ @  4  `#@@" 4 `#@@ 4 #@@4  `#@ߐ@4   `#@Ӑ@4  `#@ǐ@4  `#@@(" 4 `#@@@   4  ` @@! 4  ` @@ @ 4  ` @@  4  ` @@" 4 ` (@u@$ 4 ` 0@j@( 4 ` 8@_@4  4 ` @@R@   P@H@  4  ` X@=@  4  ` `@2@  4  ` h@'@ "  4  ` p@@ @ x   @@  4  ` @@ 2  4  ` @@ @ (2 #4 ` @@ #!""  4  ` # 4  `     @4 ` @Ɛ@4  ` @@4  4  ` @@4   ` @@$ 4 ` @@4 @ ` @@4  `!@~@! @d!"`"%@` @`  d@@c@ 2@@I 0E@F "" 3 d! (!(` ,@"` ,%@@@b@ 2 `  @@` @ ش  !!(@@(㿘!  @#@$ " %s: %s %s %s㿘!   #`@l$ @X @`H @a##@]  $ #@V @$ %d㿘 ?  1  @#0%1    M*` -*@`  ^*@` ? *@4*@ ^*@`@*@`*@1 -aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZH@ v'H '==@@=" < % `@H* @@%֒ax`@H*`@X* +H@+̔?$ e"  f a = g= ,@&}  ' ,@a =@`@=`@H* @Og'H  @}a`@V  @a`h@V `@բ!`" ` H 2 'N''H' GH  6H? 0H *H M"@ `   @ސ @$@$'a@  H`'@<!@3H 'H  Ð   @:  @a   `g@Va쀢 @$!@W usage: stty [-a|-e|-g] [-f file] [options] 㿘M H@0aa@Wn 㿘@ Ffs.%s8@d)' %#@*Д"0? f"$, s F"$$0"$` @= @*`@ &  (#"P "@  . " @. @@b8@8 @W`@3 @W?@%N  b@@<  "@@@  @@ `@@@V%s: is a directory%s/%s8 @% "@K $ <   @[= @$ <  @ /  $@ ,  @ڐ  #  `(€ "@@, 0 usage: ln [-fs] file1 file2 ln [-fs] file ... directory 㿘M H@/ea@Vr 㿘@fRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsBEFf:NRWb:denrs:tvw%srioctl DIOCWLABEL㿐@   !  -+%#@)qh?? 8* J(J(J(J(J(J(IJ(J(J(J(J(J(J(J(HJ(J(J(IJ(J(J(J(I<J(J(J(J(J(J(J(J(J(J(J(J(I`IpIJ(J(J(J(J(J(J(JJ(J(J(IJ(IJ(JI Ā "'@'$  Ā  @ $  Ā "'@'$ ܐ % Ā "$ @$  Ā  @ $  #,`ؐ %`А $ Ā  @ w$ ` s$``̐ n"`@k= @İ&* `@ "Ā  ؀  ܀ Ā  @ %@! # Ȓ` ` @t `  Đ @c?`#(*` K@KKL8LL @c@B @U @ג @S@2 @U @Жn @@@ @T  Ѐ L#@,0#@Z@ S? @$ А`@`@dc  `@Uc@ p 50 䀢 . `m@S ' @?c?  @  ` `! @  А@{@S!@ R @y@Tunknown disk type: %s㿘@z  a@yc@S! @T] `@U DANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.ioctl DIOCSDINFOwriting label to block %qd (0x%qx) lseekwriteioctl DIOCWDINFO㿐    @Ѣ"! @ѝ"P @љ"@і" !W&&6@ `؀`s6 䀢  e`f@RÔ   #  l" ̀   @# ,aE ,4 @  @<   @F 䀢 &@S. 6 #0' `m@R 6@#@RF #8@ 0& 䀢 !' `m@Rd  @Ӑ#  䀢 2  e`g@RR  #@@K 0 %s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk㿘 #   0 0@Ъ"0@Ц"H0 @Т"0@О"0@Ч#reading label from block %qd, offset %qd disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%xioctl DIOCGPDINFOioctl DIOCGDINFO㿘 ؀  ̀    @# , !,4 @   @ܡ< @B`  @6  @R#  `В@Qac 4 @`Ԑ @$c !W@ @  @ *  U @#  #< `" !W%  @2 ? 2   @ *  'ذ  @ %  ܀  e`r@Q   @В`0 e`e@Q   @Ē`H `@Ē& Bootstrap doesn't leave room for disk label㿘`( 2 @"&`(&` @ @R!!Ԁ@ J  @vc*J\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%d:ns#%d:nt#%d:sc#%d:nc#%d:%srm#%d:%sil#%d:%ssk#%d:%scs#%d:%shs#%d:%sts#%d:d%d#%dp%c#%d:o%c#%d:t%c=%s:t%c=unknown%d:b%c#%d:f%c#%d:㿘N``#c @*`N` c @*`#@` cȕ*@ cc@*`(@*c`,@*~``0@*y``8@*t``4@*o``H` @*g#``J`0@*]#``L`@@*S#``N`P@*I#``P``@*?#``T`p@*5 # \"@*+` ` K` `+@ <@@*c`=`@*`@*  `a* ``@) ` "@ @@-  `@F/< `@)`@@)@@`` @&H@En `G*`@R`K   %c: %*u %*u %c: %*.1f%c %*.1f%c %8.8s%8d %5d %5d %5.5s %5d %5d %5d %22.22s # %s # (Cyl. %4d- %dh`. @  Gb*  ?* : ` !X*` ]^ ____H___^_^'  ȍB`('` ȉBD'  ȍB'` ȉBzD'  ȍB`8'` ȉB'Q ' ?ȕB?`(@F-$'` ȉB3' ?ȕB?`(@F'` ȉB' ?ȕB?`(@E'` ȉB' 'ȍB` ȉB ؁  / `ha @(#\ : #\#`#d#h#l`x?@(a  `*@ ``@(  ! @D@(#`#` @DӐ@(`@(` .j@({`f `8`a!@Em @(n@5,`8   ?`&  @& *  *?`&  @&  * &@/! `8  @E??@(?`8@4  ?`&  @ * ** &@  ?`&  @ ) )* &@ ?`&  * & @# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # milliseconds track-to-track seek: %ld # milliseconds drivedata: %d %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffset㿐`Ԑ@'wch` cȕ*@ cpc@'hc @'b`c @'\`@'Xc`X @'Qc`X @'Jc`X @'Cc ?`&  * & @c`(@'/ `,@'*c`0@'%``8@' `(`4@'`@`<@'`P`H@'`h`J@' `x`L@'``N@'``P@&``T@&`@&a``\ &   ' `\@&ޠ ``@&֒a( #\!#`a@!x@&Ś`    `@BMw # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '1024 8192 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, amiga, sun3...) No changes.re-edit the label? [y]:  @А@N` @L #@Ē| #@ʾs@!"@'@Om @%`Ȑ@%`@`L#)L@q R@c ֐ @Lޔ!@ @r ͐@K!`Ȕ @@_"@Aa`? $`@4  $  n n`? $`@ #  %#`  n N@  sh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/sh㿀! '!('''@I!0 !8@LR @LM@Hː  @!HH a`@ݐ' @J @J  @Jޒ 1 @ # # @ 0!p@ @L @!h@HĐ '@H@  ``@\/:  @J  @J  @J 䀠`? 㿘@c(L 2㿘c(@vL "  , @L 2# line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %s㻐'D &`&`791 D@x # N@5cȢ 2,@ "@ : 2 ,)#А#Ȑ$: 6`@Ac耢 1 "@c "h#Ȑ < " @ܒ  *@ '#@ȇ6`@ ` 4.'!L@ *͐@(  '@ 8  '@ @  ' H@S 2L@q&`X@Ԓ``  @gL@c4_@쿐$ \  UL@ P0`p@v ?   @ 6`< 96`#`@`  `@` `@R !@`  @{ '!2 &`(@s`؀  @k '&`,@f`耢  @^ {'&`8@Ya  @Q n'&`0@La  @D a'&`4@?a  @7 T'&`<@2a0  @* G'6`H@$a8  @ 9'6`J@aH  @ +'6`L@aX  @ '6`N@ah  @ '&`P@ax 2 @@  ' @Ux v&`T L` *`: `@ `!6`*` @@븐  '!Ȓ@( &@!@ s@럐  '!@ $3, ^  L: @ " @; $ * @M"@ `  @n' : ' "@ٔ' ,  D"!@M $$@C@?',  @6 $ @+@>'􀤠, !@ƙ @4"@@ƌ @`?sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0partition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %d㿘 ( 2 ,  2 0  2 4 (@Ē   2 H @@Ż   H 2 8 X@Ų  8 2 < ,@=K 0& 8 < 2  8@=C 4& <  x@Ś  @- ( @ő   @ʼn  @- ( @ŀ  `!@y   P+@ a  `!@@f=`@@- 8 !p, @\:``@-x 8 !, @R:`` <@!, @I:``@ < ", @=:` `  @`  @"@, @/:`@@  4), a` "`@"p h`@F!Ȑ@F}!Ȕ!L'`P'T7X'@ ' usage: disklabel [-nv] [-r|-d] [-t] disk%s (read) disklabel [-nv] [-r|-d] -e disk%s (edit) disklabel [-nv] [-r|-d] [-f temp] -E disk%.*s (simple editor) disklabel [-nv] [-r]%s -R disk proto (restore) disklabel [-nv] [-r]%s -w disk dtab [id] (write) disklabel [-nv] [-N|-W] disk%s (protect) `disk' may be of the forms: sd0 or /dev/rsd0%c. `dtab' is an entry from %s, see disktab(5) for more info. /etc/disktab`proto' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)xؐb@ '@E`@F,#M`H@b`bh@b@!@Fm"ؔ?@c @cX@{c@vc@q c`@k@@g`P`@a@Fn  (   @*`2 RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsout of memoryYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically. Initial label editor (enter '?' for help at any prompt)> This option is not valid when run without the -F flag. PAGER/usr/bin/lesswunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?yunable to write labelRecalculated free space.FilenameName of the file to save label into.cannot open %sNothing to undo!Last change undone.Unknown option: %c ('?' for help) 'H'L0@D5! 0 @    @     @  0 @icL@ c,H@((@$@@ *   @iܒc؀ 䀢 2@  8$  7$ l', 4 , $ @{ @ ' z'z 2 7z@f `0@C˔!3Lc!(Ȥ! @&@9<?@m0$@qm 0  ?`& c* &c @l q/0/10@p  @o @*`:``nO!*` x0dx0xp|Dp #@T@C!@C ! @@$@@ G!  @B! 1@B!@B!@ S$@Bߔ!@B۔!$@@Bє!@B͔! @]@Z$@@ !  @B! K@B!@B!,(@P@B!@B! @(@%$@P@Ҕ!  @B!  2 !0M@ْ`H@@0@@ "@ $ L@ @A’ @@O!h !p@Sa "!"X@C @o@T !@’ @Aj 䀢 ! 0L@0@d! +!@Ұ )%#Ia!@  ` *  R  y n2a I  *`@R` y H`Ȕ @A! @h"( 0@ $@o"@ "`bp@Z L @La 2"@O!0@0`@!   @b @9"@A!@A!@A!@ $ "@"@" 䀢 @! 0L@a@! 2H@!`C "@"(@AZ!@AV!@$@! 2@AH!L@@伐"No space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Partition '%c' already exists. Partition must be between 'a' and '%c'. Please re-enter an offset and size for partition %c. 㻘 "M@B`H0 N    , M Hc(@ p0 ` "C ` >M H@ch0ْ` 2     `   a//+)#M'%c#@+ N,  `  ` `H@s`H `H@k pc  6  ,   6  @AQ   . . $& .  6@m&&@ " v&$&@ .   2 ". +       " +  2   2. @t  2I& ϐ@G  @㘒 a&&@ 23&@v 2,& 2@Ԓ 2"&@; 2&@ 2&" & Ē@ @@ ? @Apartition to nameThe letter of the partition to name, a - p.Command aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. 㿘 h`@9 2J M@ `H07*   & M H c@x`0% 2  2 M H@k`0   M* `*`  H@W`0@Ԕ partition to modifyThe letter of the partition to modify, a - p.Warning, need %u sectors but there are only %u free. Setting size to %u. Please re-enter an offset and size㿈"@bX@ 2J M@ђ`H0,` `'``'`'` ' @& M H c@`0    M H`@0@ p           M Hb@ , &" &@ @@ 2P$ J$@ߔ  @L"$ $@   2!@o @֒   2@-  $$ $ $   Ē@ @@? @Ԑpartition to deleteThe letter of the partition to delete, a - p, or '*'.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. 㿘" b8@ 2J M@Њ`H0u*#  n  "`   ``"  & @>   `0Q M  M H c@ה`;`,  `  `  M H@ƒ`*` , "pM@?`H!`` Ā  ,  `   , ``  &,   @> ` , @ @;&@device: %s type: %s disk: %.*s label: %.*s bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld free sectors: %u rpm: %ld %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffset㿐 @̐!@ a\* @@Đ!P!` @࿔ !p @ດ  (@ඐ! ,@ಐ! 0@ஐ! 8@ઐ! 4@ঐ! <@࢐!@" H@"  @"0.,>b#\"H‘@  #Lc>C c㿐@  d  $  Ě @" @  * @  8 @    @ *  @( *`#@]    "&@*`"@@  * *   *&@@9partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk 㿐!Ȓa@ 2Jj M @ M H c@`0o,`  M H`@0b"  @@{@#\  "`"p  #`@ے??. 2)" :   # @ M H@b0(" &@"@ @ &@`2& < "M@`H0&`Đ @ϔ? @㿐@   ` :  @" @8 @ %s: [%s] 㿘*`0")L# `0#@ߒ@0@`0$@i  ,`0 ?`$#* %# @# @<  $L`0?L ", L`0 ?@ː L`0 L`0@#,#L`0 ?1 0%s: [%u] Rounding to nearest cylinder: %u 㻐'X  +L\c8`@!/#h@y@0{@$@h  / ?`$c* %c @̨ް?@; ?L@ O ,@O ?O@dO ?" *OO O~X { y`1 ;I`*   ?* : ` %!H*` x8( ($((@1n*;O+-2' '! $# @&a# "3?J  $# ,? ' B@ '@ ' @ 7@'B' .`:  + -"'`A?? 'HB8' HB PB@7ąB'B'  8@0;X" 8?@03"#x@~ Error, partitions %c and %c overlap: size offset fstype [fsize bsize cpg]Disable which one? (^D to abort) [%c %c] 㻐@ϒ`0}@7C|  @ v+L#?`6i`,`,  @@ (Xl"2 ?l"2 #`a@' a@?       Ő`H`a@ a/$@gG OX` ?"`X* $X@F ( O`  ?`2ܐ`H*  * @@ @6&@ ,``@@6ǰ Changing device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).IDE"%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Numer of sectors per track.tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %u sectors (only %u sectors left) rpmThe rotational speed of the disk in revolutions per minute.interleaveThe physical sector interleave, set when formatting. Almost always 1.`@8e!"`%L+@)!\ *` "ޒbТ I@c(   , @    ,  (#0@۳#P@ʛ , @۪ch 8 #p@ʐ  , ` ?"`* $@ސ  6 #xc   M@j`H0!(@$ @ @ &@ M@[`H`@7!0ْ@Ȕ . ')'%#M # ,#\#`̚ ?〤?@=`H& ,)'%#M   0#\#` ?ˀ?@%`H& 0)'%#M  8 8P#\#` ??@ `H& 8)'%#M   4#\#` ??@`H& 4  %M# <  4@- 4@-#\#` `?w?2 <"@ϒH <`Ā_`Ā "@ H@8a` <" &@`Ā8"`& <)'%#M ! H#\#`* ?A?@ɛ`H6 H)'%#M ! J#\#` ?)? 26 J@ɀ`Hfailed to sort partition table㿘`   ` "  "` 2  `, 2   96@@45*  2` @\’c    ࠀ "  "   "   *`2`@ &  `, 2 `  @ Y쀢 "6@ @9c6@sdrzwdfdFLOPPYxdxyhdCCDVNDsvnd ((08@HPhX``h`0123456789Possible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.@"ap@6^ X@_ " N r"@b2a. "  @X 7  ` ?* 2  y@ ː@ Ȑ!@٪! '!\#!L.`@٠h` 8`cp@Ȇ#``.`L`?"` *  "  J6 @͐ !\#L'!b "@c(  .`@غ ".6 ``(.`#0@_#P@Gc !.`@Uh` 8`#p@;c``.`c` ?"`c* $c@lj Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).㿐)'!#%M   < #\r#`2 <`@H0*@ -+)#%'M  <8 ĖaX`#\#` U#@2 <@ǒH0 "@ " " @]㿐B 2 1& 0 0&  & C&   " 0 ` 0"  @ ,1 Ę( 0@`   ` :"  "  @@""`@  1 0(@" @2p&   <  "@  @"     " "  "  Ą 8  `* @ "@ `@ The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'M' command pipes the entire OpenBSD manual page for disklabel though the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'm' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: p [unit] - print label. M - show entire OpenBSD man page for disklabel. e - edit drive parameters. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. d [part] - delete partition. g [d|b] - Use [d]isk or [b]ios geometry. m [part] - modify existing partition. n [part] - set the mount point for a partition. r - recalculate free space. u - undo last change. s [path] - save label to file. w - write label to disk. q - quit and save changes. x - exit without saving changes. ? [cmnd] - this message or command specific help.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.㿘?* : `+c*`# LLLLLLLLLLLLLLLLLLLLLLLLLL4LL(@g d!a"^ 0[! X#U"R#O L"I#F XC @"="x:#@;#p@8#@5#@2#@/ @, 0@) `@& @# @  @!@!8@!`@!@!@!@ !@"("`@㿘 '@ "@@/*@ @+ $@ @T6@@ ` "`@+$@``㿘 , @ " @ 2@@ 2 @@?   ` /dev/%s%s%s%c %s %s rw 1 %d x @.  ,`@ "`$$  `` ``#h@  N r $p@M@ / " L`r2C ,$p@: ,@.?,x  @\Ⱀ@Sa  % #x!    *  ` *`  a#\#\@`` @馐 Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. 㿐.` "!p!M`#\ `    #` @ H "@ H`  H@a` Ā  H@b@`$` Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors 㿐.` "##M #\    #`?? @`HE %"" `H@n`  Ė@ ,`H@b`($`2   < "@Ԓ`H  "$ " `H@@`@&$$ fragment sizeSize of fs block fragments. Usually 1024 or 512.Zero fragment size implies zero block size㿐.` -)+%M'`"#\#` ??`@H @|H 2$`@"$` block sizeSize of filesystem blocks. Usually 8192 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. 㿐.`   'M, D  M@`H= @! #\#` ?ꀤ?"@G: @BH@y`@5   P@"g  @H@"\,  cpgNumber of filesystem cylinders per group. Usually 16 or 8.㿐.` "")#M%   #\#`< ?? @`H  24 @`H  FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).㿐.`  ` *a*@ #c  , @@ͷ ",`   ,  '#8@Z !,`  M@>`H +)'%M ` cx##\#`ﶚ ?ꀤ?@'H,`  mount pointWhere to mount this filesystem (ie: / /var /usr)noneMount points must start with '/' 㿘`. F B @ > <!!.!#M@"!P   @ߒ`H' @?!P 2 N@  @'&@ /@ @'@ʐ  &@ @P4c!X@`H@ 㿘 2 @@ 2  2@ `?@LCan't stat deviceioctl DIOCGDINFO8@"[?  @c@!  @Oce`r@)ߔ 6&@e`e@)ה 6&@ @c(&[d]isk, [b]ios, or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.dBIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd', 'b', or 'u'. 㿘  #`, 2  ?* : `3!*` 2(U & (,& ,0& 04& 48& 8<L& <`2`(C & (`,& ,`0& 0`4& 4`8& 8`<:& <2(1 & (,& ,0& 04& 48& 8<`'& <(`(@",`,@0`0@4`4@8`8@<`<@  !M@f`H㿘@8Failed open to read on %sFailed open to write on %scan not gzip while appendingFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s`!!T?"?@(?$!T"""""""!h"!X"􀢠s"c8!* 4  "!T -"c @! &"aT  c  @H퀦   "aT @"c&@! "aT  c P "ah#| .@!T+#|   @ɒ`p  "aT @"c @t! "aT  c @Hk "c!T !?# "!@SW  # #@HN !!Tb@ @ 6    c @H=0 < @c @H`@'!T?$!T"!h?@!Ta@'   "!X@!T "aX  @(@ ?2 "!X #  "aX"!X!X`"!h"  ` "a`#\ "#Tv"!k!T*`  ttht`?" 2#\`V"В>#@"#T"cT" !X 8;#T" #\  "@>  "#T("!?"#Tb#T`0@>  > $#T#T  $#T" #T?"a""#T"! "a` %s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. 㿈!T  "#8""""# $!X !##x #?`" * " @ c!#@c@S##ah !Tb@  <    0 4 2@#$ah@&!T# !X  !#@ #@#@!"cx?" "T" y""" "ba\ "a\# g#x #?`" * " @9 "#x#b !cH!#  @E>##@l#p #` #cx#p @ @%@M# ##\cbccp#\#`c8#d#h@ ?#@"#8?c!X !`  %#?T@%? T"!`Unable to truncate archive file㿘aX"!d` 1!T  @&Z      @3!T     c @F?Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s spec㿘!X  @E`?"   T@E`? Failed read on archive volume %dEnd of archive volume %d reached㿘!` 3!X @%/!T  T#"b! "T""@%!T  "b  "!`  c \@Ex0a\ @EaaWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWED㿘!!` !T@$  "!d""6$!`$!`!X D ( > !!!T  @%R  />  b  @(!T %""!` ! # 倢 `E0  #   @Dϒb"!`E    "!`   "ad "b!d   &b a\ @Da0  \ c @Dǔ0" ` @ Ґ   c@cx@DCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.㿐" r?1!` l"?  bb  "b!X " 4F B""7"‐ <&!` '!T a@# 61&!`0 ""!X %"%T  @$v  >   @D T@ d @$a   "a`""!`  @Cbp  ’b@@C?Foward positioning operation on archive failed㿘  >2A `(> !` $9!X 24 !T  @$  " 0@C 4 2 > 4( >0@ b >0!T  @$     c @CŔ?"a`Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.㿐!!` 6!X M  4 ` @C7ax w`(u !T  @#     c @CJ_b!\  @Cb@P  !T  @#c I  c @C(h=@y ?$!`; "#T23`(0 :`@  @Bےb 7@)'!T a@"  # @B ?"a` "a` Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocks?c!`  '?#T@"? @    c @BP? 7 '%T' @"    c @Bzpm?7'T@"  T  c @Bi\??c@!?    c @BXK?!T@!? !T    c @BFP9?7 ')!T' @!ʔ   c @B1p$?`!"!`@ <  @Ab? 7@i'!T@!    c @B?Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again 㳈 c@!x   c @A  @!j    c @A" ?!d H1#@ڐ# A#@@ 1#@ϒ`@ #@Ȓ` !X  }  !\#@@!  !H!\#@@~!pŐ!@@z"? 8! "b?"a` @@c?!@@b%'#!@@Z!@@W" @@T"H@@Q"p@@`, @yb 2 O $?"a`Q`bO b@@5`Y `s`S"b`yb# l#@@"@@" #@@!\@@ ##) !%c@@#8@@#`@@, @(b  O%"?"a`c@?""#x 2@?#pc@c @?ِ#c@ ,@?А#c9 !l @R$!l@K N$$!l @?c could not pipecould not forkar_start_gzip: impossible-c-dccould not exec㿐@K%  @w1`@zI  @w)`"   2  @wN0 @Eq`@}@{0/"    @w9 @w6  @w0 @w-   @EN`@Z@X#D @v  @v`?#p@&@ \#b D Ub  O#  @  F@  A@U )L  x@m '@+P "2@/ 2@*א @, 2@ # B@f " ( c@ @*Cannot chdir to %sCan't fchdir to starting directory?#p@ i!" D b"  \@7F W#Ā @4 N@   x7?# 8 @5- @ '@*А &"4p@@/q 2k@㈀ `#l )`@ߒ $㈀ #l @ @@(@J@#l " @@(@?@ @$;@@*' @+d &L@2+@ `#P (`@ $L #P  L@ @@ (L "@@( @ @@ B@#  c@7 @#@` %x@ "  "@IQ   # @@>G  @ 1 /? @@@@ B@O @2}# :x 7#` ?"`@* "@@ '%x@3  @@ B@'@2X0?< @^# x #` ?"`@* "@@n %x 2 @?#@ B@@   @H# ސ  c @=Ĕ 0" ( c@  x@6n@)Unable to open %s to read㿈!"?  '@1d  @ " , "cĀ` 0@3G @i  '%# x@1 ̀`@.  ?c` '@2 &`@9 @1A      @O  '  c @=G0@* @Ӓ@1` #<  @  㐐@@1}0㐀  @@G  $cx8`"8 @_` 㐀 cx ` ?"`@*"@@ $cx@0t"@@z㐀  cx ` ?"`@* "@@] $cx 耢 2 쀢 (@耢 ` = 9@ 4`" 4@C c@ `# @5Q@Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. ?#p#b@@   b  @<8b0!" D z"  t# "@1 k" @2 b#  c#@b "cx  x@2 -@, 2# @1< &  B@6 0"@2   B@% " ( @0@ #  !#x #@"$#x: # @0 @! " D ?#p@ Cannot access destination directory %sDestination is not a directory %sDestination pathname too long %s?b??"'?#,%?@ M? / /, `-Ȓ,@y"   # @;y 0B<   @;Ba07@/. 3@ .@3 )#Ā @1  @8;7?  8 @5% @ ?'@+ϐ c 2L`l 4L` /@`?"  ˒b @:`0`@ @.,@* -c  l @@ @l @@@@Ґ@.ݐ  @'  ?"?c@(ܒ L `#P !`@ L  #P  @@@ L @@@}# #@` $x8#` "8@@`# \x Y#` ?L"`0O @  ? @J@O`@.ѐ@ @v  ' # @@:n 0@ @@.0@@Ò@# x #` ?"`@* "@@А $x c@ @2@8Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.㿐 ' "3-1b` ? @’ "a?  @` N`  @ @9 X !"`$€ $" `8 ( `Ɣ    @9~` @) @"` "`8@ 0`0;?0 ͒`@9_?0c8  "c8Cannot identify format. Searching...Sorry, unable to determine archive format.㿘!@ " 0 *` *   & 6@ "k?* *@[#"_  "3/! 0@  4 F @ @" b < @8  "! *` *€   `2 ?b  @8ϒȤ ?   @v"""  @8b?Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portable㿘b\""" "\\?  aHΒa ""  Βa@8d?0"#T#"a  V ?  :#p" #\"b"#Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multiple㿘"b`"#\?  c ΐ cP"@8?0I#   ?  :#" #T@""# ?  TCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.㿘#  `\ #T"!"\#T"! "  :@ F :@@ 4 @! :@ D9 &T @d 0"`-"!"@@" ) #T 6  $'%"   : &@$!@ "!"b"#  :#p!##T@b3:   "b  ϒ`@7/?Unable to append when there are archive read errors.Archive read error limit (%d) reached㿘! L"  @7cxD? ! 8? :` ""# c @ B );c  :#!)'%#"G! 􀢠    @6Ғ0p "    ?< @ f D @ B 8*"#"@:`   ` @:  @ dc"c" 㿘#c"@  !" @""!@$c㿘`$" '#%c"@  @@ @?c@&@c`$c 㿘`#'%"@  @@[ @&@ $0$@@Ӕ`$㿘* "#"@`4 <`@t! <`"?@ ! #@<`@ f# $#`" Read fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archive8 H 4 퀤 3@ 0"#"@ : @! H: @  %@  :@ d  $`8퀢    c @5h,>`  !a@ S    c @5O>>? 8@ `  ђa@5> Unable to obtain block size for file %sActual crc does not match expected crc %s( H"   '@   ؀2  'N> c є@5'  <>"#"@ @5 7 :4 #\@8#\ #\ %@ #<  #   ##  $ :@ d `"  H`4    @! 4 퀤` #< ?#< 2    Ғ` @4b  Failed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %s(    '" P2`*  *`  H@   2    @ =  ؀ 2  ' c є@46')3"a@ "@ #\"@<@<` D"` Ҕ c  @4 . H     bؐ@      c @3 8@  Ғc @3   H`4   @;㿘!  0*: ""#c @ B ;c "a !#1"a  r   ># "c?User specified archive volume byte limit reached.㿘 #`@ #`@3% 0)cp#` cp #`2%%` @( % @36b3   d:#p  :#p"!@ ""Z &% %)'/+!!  < p B`1Ԑ@!=bD* @ !`"< $2 "<`27 `"4 $1"<  @] "< $"< @ (@\E    & $&  Ԕ@$`2 1#2& $ @ @@ . # & 㿘"H - >1Ԑ@I bH* @ !`"@ $2 "@`27 `"4 $1"@  @.| "@ $"@ @ǐ (@.D    & $&  Ԕ@͖`2 1#2& $ @ @@< . # & 㿘@ "^?N Y"L  P@*!=bL* @`!@  @I` !@ :?#`$"< `@\ڐ "< $"<``@*p!=@d ("L, "` `@Z> ?` &@@ ,`#@Z1  $@` $`$&@ $@?㿘@ "^?N Y"P  P@*2 bP* @`!@  @` !@ :?#`$"@ `@- "@ $"@``@*  @ ("P, "` `@-V ?` &@@ ,`#@-I  $@` $`$&@ $@?㿘@$TRAILER!!!㿘 @ȕa 2 ? H @ ?㿘   > &  & < @@-$@+@2 @- @)( (@0@   )&  $&   &  &  &  & `  & /  6  H> @$+ ? !?#p@ @ݔ $@ $  " 4?a#t$@a`$@ $``4` ` ,` " 0@Cpio file name length %d is out of rangeCpio file name in header is corrupted㿘, ג`h@/є? Β  J   N    @/`?Cpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt㿘 H  `  4 !l  H H @/aH? H ,   א  ap&,*, N,   גa@/n?070707㿘`K גbx@?   ?㿘 L q x  >` @ `& `  @  `& ` @ ` 6` @ `$& ` @ `(& `$ @ `"6 `* @ `,& `0 @ `8& `0& `@& `A @G H>`; @̔ ` &) < ( 2 &,` &,., P &?f?  W㿘@%zFile is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %sHc@% Ѱ?`x    > ? ` ,& ",    A4   H A @  `  ` A @z  !ǒ @q     @g  ~   @]  t   @S  j $  @I  ` (  @?  V " $ @5  L , * @+  B 8 0 @!  8 ; @  0 L  ߒ  `  `      2 ,Ő, 6 `  ؒa@-ް?0`  ؒa8@-ְ 070701㿘`m ْ`@ŧ   ?070702㿘`m ْa@ŗ   ?㿘 @!"c<㿘#<  n ђ n  x  >` @ Z `& ` @ S ` 6` @ L `$& ` @ E `(& `. @ > `8& `0& `@& `6 @  H>`& @ * `"6 `> @ # `F @  , @& `N @  `V @  ,, @& `f @  `& `^ @  `@&\ 9`n  "  v /< ( 2 &,` &,.,    ` b  :n &?    @ b ` I ?t  |㿘 @#"c<File is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %s(?@#͔ %? ? ` ,&#< !’ @     ! @     @     "+  + x4( % 6  H x   @c ` >@   `  ǒ` x  >, x  >  6 @ R     @ H     @ >   $  @ 4   (  @ *   8 . @   ~ " & @   t   > @   i F  @  ` ,  N @   U V  @ L ^ @   D n    n  $    `  %`     $ 2" ,,  , $  ̐ 6 `  ڒ`@+?0`  ڒa@+ ` Ǔ( :`(0 *  82`(0  ?   ?㿘ے    xc  `Z>`8``*  & ```*  & ` `*` 6 ` `$`*  & ` `(` *  & ` "` *` 6 ``,`*  & `H`*  & `* `*`@  & ``*   >3`+ @`+``*     >`Y``8``*  & ```*  & ` `*` 6 ``$` *  & ` `(` *  & ` "` *` 6 ``,`*  & `H`*  & `* `*`@  & ``*   >3`+ @`+``*     >``*  ` 8`0&  @F&&’ >`  ߐ 7 < ( 2 &, H` &,., `H x   ` b  :ϐ &?    @ b `  ?  &File is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sx?c@!7 d?  ?  ,& Q  i x4f c) Hx    @ b  ` >*2@:(`* 2` : (`* 2` : (``*   5-@- ` * (` `   / q`  b xN,  >(` V,*(`  ,*: (` , * (` ` ,@   q x  >(`(`(`(` q(@ (` : (` (`` ` *   2 (` (`` ` *    2 (` `(`*`   $ 2 (` (` ` ` *  ( 2 (`  (` ` ` *  " 2 (`  ` (` *`   x, : (` (`` ` *  h8N (`V (` `: (`` `*  (`*` `*   @ N< (` *   B(`ے   ֒       `  &c     % 2# ,,  , $   6 `  ܒc8@(ð?0 `  ܒc`@( Unable to create %s㿘 `  . *@ҕ4 6+ @ !?- + $ (&@׻4 6c   @Ɛ  ޔH@(?Unable to close file descriptor on %s㿘 B@D  c ޔ@@( #   $ (@) # ``  36 #  @l "  #   `8 0 @ Unable to link to %s from %sA hard link to the directory %s is not allowed8, @H    c ޔ@(/ ?<   @k  ޒc@'?㿘    `  @R  Unable to copy %s, file would overwrite itself8 @ #̀   @2  @   ߒ`@'  Unable to link file %s to itselfUnable to remove %sCould not link to %s from %s8@Ē >% #̀ 2P @@`@  ߒa@'s??<   @1 %   @̀ % *   c ߔ@'!?ߔЖ@'y?#@1Ӓ c   ` `@}    %s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)8   d , $   ( c? 3*  ,@2``&$    *`@1H2` ,@1J2`  c`, @0   ߒc@& ?`  # @Đ   $#   @ 6 ߔ@&ɖ?#     $ (@   $ (@X    w# `#`  36 #c  @   2L#@\#؀ C @  )c@Շ   c ߔ@&o*`@n2`  c@hac   6      "  #     @"  #   `8 0 @  Unable to remove directory %sCould not unlink %s8@) !#̀ 2&?<  @0# 6 `   c  (@     c H@%?8L /?  /@h / 1,@ (@ݒ! ,#?# @t@  6,@Β 2 , c@a$@( ,͠ Unable to obtain file stats %sAccess/modification time set failed on: %s8!$""%&3b # @Ԗ  b $"#  & c  @%q@/b   c @@%dpaxUnable to set file uid/gid of %s㿘@0: 6  #@!#P  #   #  @\ 2 ?  c X@%2?㿘@/ 6  #@#P  #   #  @\~ 2 ?  c X@% ?Could not set permissions on %s㿘@/o   c @$File seek on %sFailed write to file %s㿘I\'  2 '&@4"& $& N    L "  2'<`  @      @   0@$?2&Failed seek on file %s㿘??@    c  b@ٔ    c 0@$p㿘@ @?&@#   `8 0  File changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s?c8   @i X 8-?$@  :@ D @  `@ @ H 2  @ `  @#Ғc;??c @     c @#'? 8 @ `  @#c?  @    c @#ɔ? & Unable to allocate memory for file name buffer㿘 cX`"  "#h c "c#H c @"c#8 @,퀢 "c @#]a?@  ?#  @? 6 Invalid file name arguementUnable to allocate memory for filename㿘  N   c@c   c(@#"?0@ؐ?`$$N /". $$ $ c8 $ c< " "c<"c8"#< 㿘#@` "`#  "c#Ѐ    #D`#4@$F WARNING! These file names were not selected:%s 㿘# @#8 )'M%  4   2 `H @"  H@܈ 2 Can't fchdir to starting directoryCan't chdir to %s㿘!#4 "!@"s$#4!1# #8`#@#,L@0/ !#@4 2.*-# "&#@ &#@-?#@` @-i#  #@ c @"x?@- c  #@@"?@$##c@!{  "c4 File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s㿐c ~"c ?1 L  @ @"(#4  &#Di ? 4? K* @ddd dd@@dd# #D <@`@  #D h #D` @!͒c#D @!0 #D`@!P#D @!ߔp  <@ x<@,l #D$l<<@< < <  < (< (0< 08< 8@< @H< HP< PX< X @< @@X (@R @K!M#D@!H#D@* 0 @!=#D@4!8#D c`0$@@@  0@ 8@B@ #!`H@  $@<@$@l @ߔ,  @ #D #  @!d-*, $l  $@!#D``@֔,$@@*  #D` $@%s %b %e %Y%b %e %H:%M%s%2u %-*s %-*s %4lu,%4lu %9qu %s %s == %s => %s 8# c@͔ 0k `@ό#2  ` ;!@@##Ȑ` @ @@ "/`  ` cؔ ` #\#`@ښ  ?   ` `@ڎc`0@ڈ``@ڂ   ``2`@p, 0?`& * & @D@%s%s %s @#2 `8  ;a@ ## 8@q @@ "/ @"@ )   J@ @*  ` " *  **   J 0  *J$ 4 Є *`(8*`(8 Ʉ*`(8  0 J*`8`7 (А   J/ @  #  8W0*2    0 0*2      0* :* ?   @ @ H@ 0`@*H@4@K@?Є  3`+ +`* : ?І: ?+ +`* :  ??,+ 3`+`* : ?:  @B`@*@0H@(87+ 3`+`І :@B`@H@/@  㿘 ( 2 ` 8W0 8W.* 2`@2  00.* 2`@2   `  0.:. ? %s: unknown option %c %s: %c argument missing 㿘  "c,`4`I?" J -= c$ *c$ "`@J#$ @\4 @`. :  " " '? @  :2J M H c :2. =@@ M Hc@@ئ  ?`"@*`@ "#,. > ustartarsv4crcsv4cpiocpiobcpiopax㿘@@Vp /퀢 "c @"c!#@! #@0@!8 @0!H$#@Vab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedP ;/  !7@ҏ?w?`8M#*` ,,@ ,<XHPll`,@)``'c\ ,@ܒb @K"#@`"#``,"#"#` "#`@"#`"#a,@b 0,L 7 +'%* :  "* &%c$&$ $ %c $㌐ L@b8@ L  HdFh@, ?@"#:@"#5@"# 0@@-@! 0, "'@^ H "b@ bP, M - 0@A"h@HH@ H"M@`H0T"#|""cD@k,:`` `   ,@b@#` a  b@ "@xԢ@"#lϢ@@,@" ?"a@, "a @b0 @{,  @"#h@"#X @"#X@@@(, @@ , @"#H@"#L@"#P@B@  h""L#"csې") @ B "bqȐ  @  @@@   @  "b ! @ "b" @@`@@@ " !"b"`G"*` @@=`@8  @* @  @@ @ $ @0'= @ @Ac@?. "#=`@  @*   @@ @ $ @"!b:cef:hmopruts:vwxzBC:HLOPXZ014578write_opt=nodircompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8The -O/-o options are only valid when writing an archive-CTAPE㿘  "#!-% '#7 5/?Ր?Ѐ J* @@ @,<@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@D@@@@@@@ @ ,P Xlx@@,` %\ ,@ob @]\* %\ $"!,J@ - ,J` , $c $c"#@F#Ѐ { @9w "#r"# o$@, k@(gd$c _"c\"#$X"#&|"S%D,O"#L"#hJ&XG"#D"#H&|#?%D#;$c 7$c 3$c /$c 0+$c @'$c= @`&*  @" M HL#"c"?  @ "?  !P "b! "b @Œ`P@"   '@  #!@@` 2 @`@  $# `#@`  @@ 逦 0."## " @[  6@@z@ !@@ 2 @`@  ` `@ 6@@_@ 2@"!`!# "J @Q $#J #$#/%s8"'@Ȥ@&L ,@[`?  #  @a!  @)?<    @H ?` /,`ΐ abcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6rUnable to open file '%s' for readUnknown -H format: %scpio: Known -H formats are:H'D "#"#"#"#""#?""# + 75'  -M;9 0D@+耢??ʀ Dؑ* a0@tttttttttt (t<ttttttttttttttttttttDP`tlttxtttttt"# x%b"#"#@%""#"# %"!%b %""#%"L#"c"#"#&|"{&D x%"t"c\@>,o"c\,@`   ,@/`@@  @c*@RD,J@ -,J` ,F&#D&# 0, "'@ H 8%b `@, @ X@QHHb@ʢ`` H"@EH@?D"#X&|#&D%b= @b* `G@ *` <@ : @` 6@@@ 2@0,@ 2  @c@@b"cȀ `@@ @"!!L#@d  @@*` #@%s: Invalid combination of options: -%c㿘 MHa @M% @SC  6?L@ H@@0MH`?"`H * "H@ 㿘@W@(   (These format options are not supported %s = %s 㿘 (  @2c!M1  H@`@#00@ Invalid option nameUnable to allocate space for option listInvalid options format㿘  N   c@Z  c@?06c c@@K+?)'L $@ , 2,@@ =  @ 〤`, "@"`"` ` ( ,% (" $, 㿐@  # a ]`[XJ k m b 1J w+J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,` '@" 'J`x``*  @Õ @   usage: pax [-cdnvz] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvzDYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvzHLPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-o options] ... [-U user] ...[-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-diklntuvDHLPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory 㿘#!M H@#8@ޒ%X@ْ#cx@Ԓ#@В#@̒#@Ȓ#@Ē (@@ P@ `@ @ @ @@#a@!0@!@@!h@!@@!@@ usage: tar -{txru}[cevfbmopswzBHLPXZ014578] [tapefile] [blocksize] [replstr] [-C directory] file1 file2... 㿘#p!M H@c#@_@ usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list 㿘 !M H@ h@ @ @!0@@z Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s㻘  N`  a@  b^@  2, b @??0i`@݆ @w$ bX@,@T?, N@Ԑ 2 *@#;@| b+$@ $`J + %*`:  P"` g G" `0  p"`0` $` $`@#`@S ,@?0J  bH $`bL " "bL"bH""L Empty pattern stringUnable to allocate memory for pattern string㿘  N   `@  2$ `@?0$ @b$ $ $ b@ $ bD " "bD"b@""D WARNING! These patterns were not matched:%s 㿘"@ )'M%  2 `H @t!آ H@E  2 Pattern select out of memoryPattern list inconsistant㿘"@    #    Z$  U #Ѐ 3 `2 *@  )`2*@@   $ @'b ` /*@3$  ` /*@$ @$ ?J / * $ $ &"@ "@        @X" & @b?㿘 b@ &# 0#@ 5?3    "   J  /2 @   @"     2  #@`? #@ &  V &?& 㿘&N ?  [  *"N9N@-N@6*N@` #Ѐ 2`/1?&. N@ ߲`(? N *"   N@Δ `N@ ?``@ 2?*:  `?J !`? 2  82J! -(J  ] 4  @$  (8 "  (]   Removing leading / from absolute path names in the archive㿘# #N  /N   . . @ @?&c   "c @c# *N, /& ? N, ,  . ., @, @,?&,c   "c @Ēc"H  @E  )     , ,@5 #Ā @i     , ,@ , ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s 㳐!c+)'%@#@b @"P@x@, &@" @b0@А,@"0O  .@ܐ"$  O  @ѐ" ?#@ɒ @ ,&* ? 㿘 @ ? ?  , ,@ ? File name %s/%s, too long㿘@N /@ ?#l @a?@ &@ @+@ ??@ * . @+@ ?.  Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s  "H?cP @PAP X@ֺ 1\@@     @,`@  !X@f  dV a@AX  \"  @L@   ː  Đ ? L@  @,  `,L@  $ a@P% OP OP  M Hb @Ӕ OP Hb8@˖POP  P,&@., 㿘J L E  & \"*L / 94 *?Ѐ/ . @*:  \2 ,@L`\ `&2,@ ,@`@ @` @` `" @'4 N@?@*L$@.Can't open current working directory.㿘@u!@ 퀢  "c  c @0@r (@ ""`"*` ڸcԣ  #Cpu time limit reached, cleaning up.Signal caught, cleaning up.㿘 "#x퀦 "# c c8@$@ # @@ LC_TIMEUnable to set up signal maskUnable to set up signal handlerh @ɒ   @? @ﾒ   @? @ﳒ   @? @晴 2 @?@Ɛ#"c#     @ $cؐ @ '#T'ؐ cȔ@H'܀   Ȁ    @= Z ؠ@6   Ȁ    @+ H ؠ@$   Ȁ    @ 6 ؠ@   Ȁ    @ $ ؠ@   Ȁ    @  'ؐ ؒ@  @     c @t?㿘#X @ 2 #\ @! 2  #P " @G   Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memory㿘 "V?N $!#X 2 N!=@Ƚ  $#X :cN # \N  #" @7 2  c@ٔ.?  @ @:@d!=#X, @ " 2@  2" c@?0#X,   "" 㿘 $!=@9cX* @`"  @ 2` `2@ Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memory㿘 "V?N $!#\ 2 N!=@'  $#\ :aN # \N  #" @  2  b(@C.?  @d @ A@Β!=#\, @ " 2@_  2" bP@?0#\,   "" 㿘 (!=@ԣc\* @`"  @ 2` `2@ Empty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]㿘 N `H@EX / "N,@`N % А (,2 J2J* .  2`` ``@ v J 2 @꧐  ` ` L@ 2$  *$ L@ & @*:  M"  c C  ` m     $   $ `L@@ <S `L@  @@A $ $N @ 6  ` $ (L $@  6   a@ @n$   $  @  a @ @\?cP $ "cP"#T  cT " "cTaH@ ?P`D8@` "& &" ` @6` &*` `*  `%   @  ` @   ` ` `2` `?㿘@x@D . "$@, @D 2j?L?Г* @*`L В@`=$@]?@2?`8W?"l*` `40444N?Г* @*`N А@ D$` d$` N?Г* @*`N А@ $`?$` N?Г* @*`N В@`$`  N?Г* @*`N В@`$` N?Г* @*`N В@`;$`@{h&@?? Cannot allocate memory for hard link table㿘1# 2 )@Ӓ  &#  @ c?Hard link table out of memory㿘#`l   " a  )@v,@ 1@   2   @    2  , o,&,*,     &  ? $  $@@@ ' @   @|  $ $  $  "$ #,  $  " @ @ `0?㿘#`4 " /  * ( & )@* @ @   2   @    2   "@@謐㿘c   㜑,@ ""@@`@蕐`2㜁Cannot allocate memory for file time table/tmp/paxXXXXXXXXXXUnable to create temporary file: %s㿘1# 1' !G@͒  &# @ c?@{U#@t "c@@O    c @ @D?Failed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memory㳐!#   1G@#-@ <') +2%     @    @ # @ `b?㴒@+I @^    2   8 @ F$ D @祐  5%  @  <  @  8-$ #$  $ #"  c @ s   c @ k   c @ c ? @ 1a ?@獐?Cannot allocate memory for interactive rename table㿘1# 2 "@ے  &#  @ c?No interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory㿘3c  @ ݒ`I @"c, @` @@Ґ ```2@``@Ő - @`@z &`  `@@  @z  &@@z  &`#,   &` " @@@ ``@ ?㿘!# @@̔"#* @ @ 2   &&@. 2Cannot allocate memory for device mapping table㿘1# 2 !=@$  &#  @ Rbh?㿘 @  ? Device map table out of memory㿘# (@Ȓ!=,`  `   2 ` @V  && #,` & "  @ c  Unable to fix truncated inode/device field when storing %sArchive may create improper hard links when extracted㿘 #  @ 2   "  *   ", 2! M "X  z  G 1`#@ > "" "$ 1#  &#] # @%S      #  @嵐  #""  "$  $  $ `@e @a`@ Cannot allocate space for directory access time table㿘1# 2 !=@  &#  @>b?㿘c   ,`@ " `  ⼖   2`a<Directory access time reset table ran out of memory㿘# 4@Π!=,`  2     2  @,   @xJ  $$ $ $ $ #,` $ " @> @ْc㿘#`%@f!=* @ @ 2      2  ? "@ & &@@ ?Unable to create temporary file for directory times: %s㿘!#? @w#@  $# a@@?@@ Unable to store mode and times for directory: %sUnable to store mode and times for created directory: %sx# .  @絖  ? !b0`'7 '3c'@'؀  c@ǔ  c( "c(bh@/Unable to set mode and times for created directoriespc Y#( @G #??@k  >#@櫔 8ؖ   @]# 0#@杒Ѐ )ؖ   @N# !# 쀢 " # g #(`@ #!@#?#(@$# @cx㿐`@  @ 6``  *   @`' *  @@) 㿘 $е $ J$J ?`   " @ 2(* ** *( (0(2      0( :( ? 㿘   2.( (( (. . 0.* 2`@2   `  0.:. ?  !   ustar㿘a$?N !`@    喔 Ӓ"? ?write_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.㿘!#%G "( @   @a    @a( aX a "?    a@q?0$0㿘" ?` & `" 6`& ,&* `d  ` /6`l   `$& `t  `(& `|    H>`  `8& `0& `@&  x  > >N``1 2`2`5"-.,   &, `䶔,&,*, (  & 6, `䦔,&,*,     & 6., &, 16., &,L@ /  & " 6`   6   &`   H `x 6   " @ b a >   >L@ /2 ,@?& Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %s㾐 ?` <"̓*`    ,   H d   #0 )԰ `  ˒ax`  Ēa`  a`  a, d b,     c b0  㼔 c,`c x   >,` @Д d? /,@ ? 2  1,`, 㝔 c,a l   n",` @䯔 d Hl   `  \bP " @ b a > `d T C $`l J 9 (`t @ / 8` 6  %!` +  l! &?  ͳ ? ` `    `  bp@t 㿘 ?4  ?㿘Ь ?  ?㿘a$?N !`@'  2?   D"? ?㿘 ޒ"/?  & " 6 &&NaY   aYǔ+ /, `,⼔"@&* `d ˔ ` /6 `| Ô   H>` ⺔ `8& `0& `@& .aHa)`( 6.a(`t ⤔ &.a(a `$r 6., `l ▔ &., &, x  > > ,&N``7!<*` 00@  &`  y  & " 6   6  J /2g &c*N` 4   &`     &`   6 aI   aQ  `,, ?& N` 2   &`   (  & " 6`    6 , `Δ,&,*,   & H`x  " @ b a >   ` >   6  Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %s㽠   `  7`0  2 , c `X),  @)  `x x  > ,YI  /, Y @c = c,`c ?` b"*` Ddd    5,`` @B d:aI   4 3,`` @4 d , aI   aQ      6,`` @ daI   1 2,``,  c,aaI @ aQ @  `| –  4a   0 7,`` @ daI @ aQ @ `|  H x  "@c a >ɘ  `  l`a` a`  `d {  S $`l q  I (`t g  ? 8` ]  25έ a  j  a) b !` B  ʃ! &?   ?       `  `@ `c`  H J/  J/J" `4 ` /dev/ttywrFatal error, cannot open %s㿘"@~  @Qb!  $ <@Ib  "`@@5 <@#Ā   b@3?㿘'H'L'P'T'X3`< H@i@Ր`<㿘`  @@  2. ?@ 2* %s: 㿘'L'P'T'X L "c#  !#x  M@3`H$#x!M Hc@`@% @# <%s>㿘'P'T'X P "c#  !#x  M@`H$#xM Hc@`@` !@ Ȕ@ @㿘@ɔicmpunknown protocol icmpsocketDI:LRS:c:dfh:i:l:np:qrs:T:t:vw:bad number of packets to transmit: %s%sbad interface address: %sbad timing interval: %sbad preload value: %sbad packet size: %spacket size too large: %sbad tos value: %sbad ttl value: %sttl value too large: %sbad maxwait value: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptPING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrom(@î  ' // @@!  @a@  "a4 @6+a@ S @% @ O!@6?9; 7 @?? 3 * a@"%%%%#4%%#%%%%%$#4%%%%%%%%%%%%%%%""%"%%#%%$%$\%$l$$$%T%%%, @”  "a< ,@(b! $$!! @$!@  L@  @b(#! @pc$!,@} !@, 2` ,@b0 @/ `, `, `,!"w$!, @{ '  ,@bP! g$!.a`/ a"a`@  ,@h  @̒b( @Z P ,@bh! F$!!,@ $!?! :$!! 6$!! 2$!, @6 '` ,@b?#@" ,@b ! ,@$! ,@b ! ,@ $! / ,@tb!!$!, @ & ,@dc@ = @&*  @@ !!  @@Q  ,!  ,@}9 "!0@N 2 `  c@8,`` @V@@, /"!0#a  ! @ c0 쀢 "aX@ڃ' a @4cX    @-`@ @.?c ab%"< 8 #.a` "a`aH @  ,aH ,  !4@"` ! @4yc`!! @ !4?c @՘ !  !4?c @ʘ !< 8 .a` "a`$!! d $ d @ch#  !4@ `4 `<* @*@@ "`, 4 4 ,  , $ $ !  < 8   @rc/Ȑ '/ɐ /!4  @r ( 6.@nÐ#@u .!` !4  @_  . @3`.!` !4  @M  . @3ޒ` .!` !4  @;    @3̒`@ '%4#?c! @I 6 @3``@?4c @  6? @3`pc!4@    !'a0@U @  !0 @  @ub  @qa̐  @mb@2! !@f!4 2 * @/   @3`cX#!  @'' @ܭ  !4 0+@+@ $@@  ' !4@   # "@m ' @-@  @% !<`!8 @@@~ 㿘 @D#   @a!<`!  !8    @!`"    @Ғb@ "# 㿘! # @6 $# ping: sendtoping: wrote %s %d chars, ret=%d 㿈% !.!h,@,`4`! 4`.!#!`@{4`:   *@ * , !X @p ''*`*` *` *` *` *` *`*` @ad 4`!`4`@4` !4 ! @ߚ  @`6  @m#" "a0@~W!   `@mpacket too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xx@͒   * `@!!!  @SY'@X0&@ .a耢 8aX `P"8 / `/ `/ `/ `/ `/ `/ `/''" '" `''А"@@'*"@ *`" *  *  : @B: (:!! !  @(:!.`@Lh: L :@ `  D8@"D?"8 * ,  ! j   `@w| !  @R'@}K @}G !X !  #@(!  #@ @}.  @})!  쀤F@  3 + @ "! @}  5)  a`@}aXa` @} 쀤  %   쀤 ߒ` !!  *  @&@ ! @!h@|ޒ@8 `+L- "      C "   @|!        *    *    *   @|!@~ @|? '|c` ?"`c* %c@j֐ Ѡ     "p؀' 'c@A '!  ' @|e! ?$@R %#@ߔ % @|S!Ȩ     *    *    *   @|>!@ @|6%  'c` ?"`c* %c@jo Ҡ @|! @|!  @|! @ ? `8 ! L`?"` * "@jE L@# ` 3f``2: +ff: ? : : 3f* 2 #--- %s ping statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's printing up packets!%d%% packet lossround-trip min/avg/max = %d.%03d/%d.%03d/%d.%03d ms 㿐L`?"`` * "@iҐ L@͇# %!0@{{"%@{v"!!8@{q"!D`@{j"!8 "@{`"L*` *  *  !@b# @{RL`?"` * "@i !8`J!X F!D@: @! # -!@8  #@  #@  #@ #! @  #@#\@z㿘 @ V !8@b`?Echo Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Desination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d 㿐`#h*` CG8G8CELE\G8G8FF$FHFXFFFFGGG(@y"@0 `^#*` D,D<DLD\DlDDDDDDDEEE$E4@yh"P0@yd"p0@y`"0@y\"0 `"@yR#0@yN#0@yJ#00@yF#H0@yB#X0@y>#p0{@y:#0w@y6#0s@y2#0o@y. 0k@y* 80g@y& X0c` p@y  0]  "  "   " @y   @y  @y   @x  @x!  !!@@Ni'.@x!P0K@x!`  @x!0B@x!0>   "  @xՐ!0@xҐ!0 "   "("h@x@ 0@x"0@x"0@x"0@x"0@x"0  ##(@xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x㿐 #X `@xp*`  # 22@xf #8 ? 2` @x]*    @xW#Т! #@M'@xM @M'@xF  ! #@x= L`?"` * "@fv %s (%s)㿐!  ' @ ֔  !! #b(@M'!@1 #a8@Mw'!@1 TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) 㿘h  *    !  "( *`@ *@wŔ patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x (N@ M ⌐  D @"J 2 #\#`#d#h#l#p#t#x#|###c@3Ġ ? #"8 @6  @ ` @.  ( ! @wK#8 @ #@wCc`@&@w<#H< @2 2 2`((   .`? usage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-w maxwait] host 㿘M H@_ah@l 㿘@benstuvusage: cat [-benstuv] [-] [file ...] stdout㿘@W-. @$b8"%. +.#.).'.@@?:? 81M* ODOOOPOOOOOOOOO\OOOOOdOlOxO$%$b%b$%"$b$L#@eL ̐$bM H@bH@ = @.a* `@." ." ."  ." ." @L@L@# ". @*bbp@" stdin-r%s㿘L. x"a3/-+.    @Ӓ` @vD 2 @QH%b   $ @"@ 2%6d 㿘  %L ? & @  &? ` 9 (.."  2 `?"` * $@d7 Ӣ." .!  "  ah@:` @2  ."` $?"`` $* $@c $` +.." ` ^?"`` ^* $@cސ ^` I?"`` I Iz*" e .` M?"`` M* $@c Mj` -?"`` -* $@c -T M"   /` ^?"`` ^* $@c ^6  ? @`? "`` *:    * `? "`` , :    * $@cN"  @ .!@P  .  " ?6 L# @ @(bp㿘L#R .`x"+)'.  @h`  @ 6 @Oݐ  $  T`$ @T`"@% 2buffer8!.!L`R#@Z ".a @(`d*$."!@` $! @(c %.+.)a@м  @М@ 6 @(|"p@ .!@O . "b 㿘@,$Id: chown.c,v 1.10 1997/09/20 12:44:29 deraadt Exp $HLPRfhthe -R and -h options may not be specified together.%s: %s%sfts_read㿘@  @҃`/!+.  8).J . o`?"b@ࠀ?E? )>* ZpZpZpZpZpZpZpZpZpZ4ZpZpZpZ@ZpZpZpZLZpZXZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZ`ZpZh Ȣ  Š    %b%"( @= @*`& @@ ."    @#`2 `.? .?""$.." "b @@{ : 2 *@@{ . *@z @@`@t@`@Y   @' #+).'.@> O  4? 1* \ \\\0\\\X\\\X\\|\|." @a 0  @r_ `@Nn  @rU `@Nd0ˀ "  @v$  .0 @$ ."(   @NT 0#  @':`@Ы%s: invalid group name㿐N  @Q " @֔  `@'J . a@k.""$%s: invalid user name㿐N  @ " @  `@&J . a@?."" usage: %s [-R [-H | -L | -P]] [-f] %s file ... [owner][:group]group㿘M H"x."` 8"" @ @* 㿘@instinstance-mediaoptmediaoptmedia-link2link2-link1link1-link0link0EtherIIsnap802.3802.2tr802.2nsellengthsnpaoffsetphaserangeipdstbroadcastmetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownupisoipxnsatalkinet-a-A-ma-am-mA-Am-mextra address not accepted'%s' requires argumentencapsulation routingSIOCDIFADDRSIOCAIFADDRH@ @$?`@@` 2@F @`Ȁ 2@ =@`Ѐ @@`؀ 2@ .-"#p@` @@`耢 2@ ."#p@t` .. "cp?  `@ ."#?`.#@@z' ? `!H.!H  "c@O@ .  .# .*#""䀤  $ @  @;@ .#.c@y  @- @ @  @ J?')##.耢  @@ "  2@ 2 .#x " $    @ `4  "? @`  @a€?`€@c  $c? `@"䀢   .<"45 .6"4@ 1.."܀ +А!."@ @͡ ."܀ !."@ @͔  @͐ ."  @}q " 6 .@L!0..@ "P."4 .c@yP ."@:  # 1.# @K!H"܀ .c@y2 ."@ @Kߐ!X@> 㿘!"?.@)" @} . "b?$"$"socketSIOCGIFFLAGSSIOCGIFMETRIC㿘"!." 60 @$c0a@ 0@K#8?aV ."@"0 6 @K#H."#t."#t mallocSIOCGIFCONF%s: no such interface p !".b @$\c0/ #0''@^ ' @$Na$@̔  @$D` ,  z//. `  @  c.#@x~   #% $ $ $  $ $ $ $'''''''b'쀢 >@ `8 @f  3.`#,% $ $ $  $ $ $ `$`@ `!H` !H` ? ,@` @  ` @ɱ` M H`(.@@* 㿘. ""x.#@ "x.""4.:#2` €㿘.#` € 㿘.#` € 㿘@ .""4."bܐ "܁㿘.#x .# .`6"#.#`` ` @`.`"#. ""4"".""4Note: trailers are no longer sent, but always received 㿘@oB 㿘.cx "cx.#` € SIOCSIFFLAGS㿘."0a.@u  @#$c8.c@w{ `T ."b0 "b0 a.."2."@V2  @#aSIOCSIFMETRIC㿘!.#.c@wS @n$ ." a@9 @I!SGIOCGIFMEDIA%s: no link type?p.# !.А @1 (.c@w* ."0 a6@   # . @"bP."#|.#|  b`.@ SIOCSIFMEDIA㿘.#  #.c.c.!.#|  .8$#|+ @v$#|0a5#|."@"  @"c8only one `media' command may be issuedmay not issue `media' after `mediaopt' commands㿘.#   @c%. @`| `@4`,`$|only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'㿘Y.#   @`". @`#|@ ."bonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'㿘'.#   @Wax". @Qa#|@v ."b8only one `instance' command may be issuedmust specify `media' before `instance'invalid media instance: %s㿘.#   @b@'. @bp|?c @mC ` b@*` $|FDDItokenTokenRingetherEthernetCDDIMMFMulti-modeSMFSingle-mode16UTPUTP/16Mbit4UTPUTP/4Mbit16STPDB9/16Mbit4STPDB9/4Mbit10FLFL10baseFL10STPSTP10baseSTP1000FX1000baseFX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTnonemanualautoautoselectdasdual-attachALLRAllRoutesSRCRTSourceRoutingETREarlyTokenReleaseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplex " @2 "p<`" `@ 2  2 `"؁unknown %s media subtype: %s㿘"<@D? !#` @strdup,unknown %s media option: %s㿘 @Yc @ pc'%)@Mز Ē@?2  #@ @E㿘   ` 2  @k    ?%s %s%smedia %smediaopt instance %d㿘 @!D!@l!! !(Q@l#` 3? #!0%!`@`2!  "  @ 2 ` !8(@k`#ؒ(@kא@ @  ٲ`6 `@kɐ!H%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %dSIOCGIFMEDIA media: status: activeno carrierinsertedno ringunknown supported media: p".@kuc".b2@.#t`@kg#PL`?"` * "@Y А @ȶ (.c@s %.#0 a6@ǘ Ӏ @*  2' @A`a6@LJ 6 @6c`@k.#p   @>L`?"`` * "@Y_ L`?"`` (* "@YL ( ޔ L`?"`` )* "@Y5 )L`?"` * "@Y& 耊 6@jԐ# @" ` # #耊 " # #耊 "##@jL`?"` * "@X .#p ( -+) @ 2@jȤ @jc d @j#`@  $ @j .#  @ 0!H`!H.# ? ,`@    inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %s㿀x )."  #. # + @2c0c%.@r ``'! '  ''@?'@j@rq 0a%"@[ 6 # 1 @E  @` .."#\."0 10a".c#c.$ ?"$ @5$ 6!. # 12  @< !.@D !.#.c@r/  '! @?= @iŐ.#\ @i ."0 40a#.c#c.$ ?"$ @$ 6!. # 1  @ !.@D !.#.c@q    L'! @? ؒ@iL`?"` * "@WƐ SIOCGIFADDR AppleTalk %d.%d range %d-%d phase %d--> %d.%d broadcast %d.%d㿈 #.b  . # + @Wc0# @Ư .c@q b0a!@Œ . # 1 /2  c  @ƕ .@DF#.#.c@q   @ƅ       !@i ."0 &."0a"@_ 6!. # 1  @f !.@D !.#.c@qY  " ! @h 0."0  .#Ѐ !  @h @L`?"` * "@W   ns %s 㿈  #.b  . # + @ƒc0# @ .c@q b0a!@ . # 1 /2  h  @ .@C#.#.c@p ` 7 7 7 !!7 "7 @7@h."0 2."0a"@Ȕ !. # 12  @ϔ !.@C !.#.c@p”   7 7 7 ! 7  7 @j7@hML`?"` * "@V  ipx %s SNAPframe %s Xk #.b  . # +А @%c0# @} .c@pv b0a!@` . # 1 /2    @c .@C#.#.c@pV ` / / / / / / / / / !"/  / @h/@gՐ."0 >."0a"@ !. # 12  @" !.@BӐ !.#.c@p   / / / / / / / / / ! /  / @'/@g '#' '#'Đ '#'̐ '"!' !7'#'''` " ` @"``` 2@``"@gc!L`?"` * "@U SIOCGIFADDR_ISO iso %s SIOCGIFNETMASK_ISO netmask %s SIOCGIFDSTADDR_ISOhw #.b   # + @1c0 @Ċ 0.c@o b0 a!@m 6 # 1 /2 # kؒ @p @B! Ȑ.c@od ݐ!#@` @f."0 a%@D  # 1# @K  .@A  .!#@B Ȓ@fܐ."0 #."0 a"@"Ȁ  # 12#ؒ @) @Aڐ ؐ.c@o ! @ @fL`?"` * "@T %s: bad value㿘` \.` .@ .``@b @   @ 0@ "  @ &`#cH@ה%s=%o%s=%x㿘  N $$ .`$ . @f[2sL`?"`` <* "@T * "@T3 >AppleTalk does not use netmasks%u.%u%s: illegal address㿐.bP ,``*bP $@+bH$bh@  ` ?#@  (` $bp@4` ,`%hu-%hu%s: illegal net range: %u-%u㿐 {77$c@@X   @ . $cH@#2 2 12%s: illegal phase㿘$@zc . *c$@yc  . *c%`@織 atalk %d.%d range %d-%d phase %d AppleTalk address is not in range㿘#. c c ,c  2  4 4     % c@e*        %@瀒`c6  6  6 Attempt to set XNS netmask will be ineffectual 㿈`l.`@  ,  ,#@@ 4 4 4 4 4 `4 %@d!Attempt to set IPX netmask will be ineffectual 㿈`|.`@  ,  ,#@@ , , , , , , , , , , , , "ڀ`4 %@d"8㿘 .` @ @& `  ,, , , 㿘@d$."cPnegative NSEL length is absurdsetting NSEL length valid only for iso㿘@d  "b %@ђc.# " R   %@Œcȁ * 㿘!    usage: ifconfig interface %s [ [af] [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [media media_type] [mediaopt media_option] [ metric n ] [ arp | -arp ] [ -802.2 | -802.3 | -802.2tr | -snap | -EtherII ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig [-a | -A | -am | -Am] [ af ] ifconfig -m interface [af] 㿘M H&&`@U@b 㿘@㿘 @@xq`@㿘`@@xk @㿘`< < ` 4   ? $`$  ?㿘`< < ` 4?    $`$ ? 㿘`< < ` 4   ? `  ?㿘`< < ` 4?    ` ? 㿘`< < (`( 4   ? ,`,  ?|㿘`< < (`( 4?    ,`, ? i㿘`< <00@4 2  <44@( < `<00@4? 44@?>㿘`< <00@4?2  <44@( <?`<00@4  44@ uappnd,uchgnodumpopaquesappndarchschg㿘.*# #'@alb'"  `@ac'@a_b '"  `.@aV#.#'@aQb('"  `.@aH#.#'@aCb0'" `.@a9#.#'@a4b8'"@ `.@a*#.#'@a%b@'" `.@a#.#'@abH'"`.`# ,archiveddumpsappendschangesimmutableuappenduchangeuimmutable㿐`2&@2&)@'%'(@` % &L" n2 L  o2    ?* : `(!*` d,,,,,,,,,,,,\,,,,'b@@  2``(`@ݔ 2 `&`@&@`?(`@Ô  2ɰ ` &`@ &@'b0@  2 ` }&`{@ v&@'b8@  2``(` @  2`^Y&`W@R&@'bH@p  ``(`(@d  (`0@] 2c `4/&`-@(&@'b@E  2``(`@@9  2`  &` @ &@'b @"  ``(`H@  (`P@ 2 ` &`ߐ@ &@  COLUMNS1ACFLRSTWacdfgiklmnopqrstux㿈 @ )@!@" @`"a`h@V /`"!/ " /" / "`@#  / "`%/ '/-/+/)/5/3/1//)@ԔH??π G* )(((((((((((((((x(((T(((((`(((((l(((((((((((t(<(L(($H(( $%  %`$% $%%`%`/" % $%$% $%$$%% $%`$%`/" $$&&`&`&/}" z`x& ` /t" /" p& /m" /j" /$"`e /b" /_" /\" /Y" W%/T" /Q"  N%/K" @gH= @/`ض&* `@/ // //  // /!Ā "`/ ؀  // // "`/ Ȁ 2`/ ؀  /  /@%`/` &!: "`/ )!Ā /  &F/ /C >"x';!|/ ̀ /&3#/ "/'+ &("!Ā /  &/ / "`' / ̀ /& #X/ ' /&""`l/ /- / /#L/ ؀ /- !/ 0!/. Ȁ"`h a@/@ Ё %s: %s: %s: directory causes a cycle%s: %sfts_read㿘/ Ā  ,#@ 2 @< @5 @r / c/  '/`  @ )/@ѐ K `4 ":+  "N`@06 40퀢 . pV`2 / p +`@^ x  +`@^ $p@@+/ ǀŐ@֔ 0 @9`@0@]`+`@9`@% #  +@ђ`%u-%lu%qu'D @>'H/  't/ ؀ / "' 't' ''''|'x  HҮ'p'l4`` D@]+`@9@ $ /" Ѐ`2 L@`// /$ . // / $  ܀ @&@&8t` <`8 2``< (``<` 8'`  8'`08 `02`<`4(`<`0`</`؀`i/  +pb`  l@ +lb`@ 0 ` @˘ `@Ē @ex 4'x@^| 4'|/ +`D$b@O@ 4'    @Ð    @ $@J $ @J`< @@@/ '/  $ @J$274KH''t`0''̠ #+bȔ@'@'ܐ '|@'@' @@' +@}@x''/ h@/ / ؀  "pH@x㿘 4"0 @`4 )   "  ?"R 2 2/ 2   2?/l€@㿘@%㿘 #L "   @c` ?"`c* $c@Ko   2 total %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd %sxR 2 "/ ؀ // " !- !h`?@O @\--+<)L "/ < -`@\Ґ!x/ / :  :``8@ B @  @\`@ $`  , -!#\ @\#`/ -  @\!` @" `@2   `- `@\!/  -!- ( `0@\"@ / (`0@\/ ̀ /` "` `(@'-!@\p@/  /  `  2`@``(  #@B#` ?"`#* %#@J 2i 㿘 #b@ !/ x@I*` 2 @7L 05$ x$b @/ x` "`."``2` /    /   / 2 /  ! - 0n@@@@ 2 R 2  / ؀ // @!-!h`?@: @[Ґ @A9/-L *  x,@7   L#`?`$``@ * %@I & ` ?"`* %@Iߐ `@Ŧ 㿘/  <-`@[!x/ / !-:  :``8@ B @Z! @[i-!@[d@/`` /  <`  @`㿘'D@ED #Lc L?`&  @  c* $c @I  $ / #L c L?`&  @  c* $c @I`  $ VL D;a@X  #Lc L?`&  @  c* $c @I;  $ 1LL`?"`` * "@I"  #Lc L?`&  @  c* $c @I   $ L`?"`` * "@H total %llu 㿘/    /   / 2/ !,C0q@@R`2`/ ؀ // "!/ #@`?@ǐ    @Z\ =L+L "4c`  ?"`c* %c@H     L#`?`$``@ c* %c@Hr  2 L`?"` * "@HZ 㿘/  /  /   / 2 @PL%L` "G` >` ,?"``* $@H% ,  `&!@ @` ?"`* $@H  ` ?"``* $@G    ``2` L`?"` * "@G 㿘<(@-L @@ I0L0@-8@8 I0D`?"``M /F /`?"``@ |9 |`?"``3 @, @L`?"``% = =L`?"`` % %L`?"`` * ** "@Gq  %s/%s ls: %s: %s -> %s㷘V 2  $-@{ @ $1 X@{ @@/#?2, # #M`H!1@W!`@Z01!p@XM `J ?b H  +@usage: ls [-1ACFLRSTWacdfiklmnopqrstux] [file ...] 㿘M H1@)b@6 㿘@k$OpenBSD: sysctl.c,v 1.39 1999/04/11 19:41:41 niklas Exp $vfsddbusermachdephwdebugnetfsvmkernsysvshmsysvsemsysvmsgfsyncnosuidcoredumprandomusermountsominconnsomaxconnosversiontimexntptimerawpartitionmaxpartitionsdomainnameboottimesaved_idsjob_controlngroupsposix1versionprofilingfileprocvnodeclockratehostidhostnamesecurelevelargmaxmaxfilesmaxprocmaxvnodesversionosrevisionosreleaseostypepsstringsloadavgvmmeterposixkeysipencapnatmisdnpipinet6ipxrtipcntcoipxtplink_layerrouteappletalkhylinklatdec_dlidecnetibm_snaccittdatakitemcaisoxerox_nschaospupimplinkinetunixdiskstatsdisknamespagesizeusermemphysmembyteorderncpumodelmachinetzname_maxstream_maxposix2_upeposix2_sw_devposix2_localedefposix2_fort_runposix2_fort_devposix2_char_termposix2_c_devposix2_c_bindposix2_versionre_dup_maxline_maxexpr_nest_maxcoll_weights_maxbc_string_maxbc_scale_maxbc_dim_maxbc_base_maxcs_pathled_blinkconsolepanictab_stop_widthmax_linemax_widthradixAanw㿘@|+3)/ '/%0#/@6`? a"$( n A"%!00 w"$a40$8@z= @*` @/!0 /!(  @J @w3"b. `@  . @ 2 @@R@@' `@ 2@@r 㻘@ "@_O#/@8 .,`  #/@, @`"`@Ca0@` &@must specify -w to set variablestop%s: class is not implementedsecond%s: kernel is not compiled for profiling%s = %s offrunninguse pstat to view %s informationuse ps to view %s informationuse xntpdc to view %s information%s = %.2f %.2f %.2f can't find ps strings%p use vmstat or systat to view %s informationuse netstat to view %s informationvfs print%s has %d mounted instance%s s%d illegal top level value: %dname %s in %s is unknown%qd%s: value is not available%s: specification is incomplete%s: type is unknown to this programtick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s = %s%ld 0x%x %u %u %u %u %u %u %u %u %u %u %u %u %u %u %u %u %s%s: = %s%hd, -> %s: %d -> %s: %s -> %qd %s: %qd -> %s: unknown structure returned%s: unknown type returned'h 'l@^3#/'@^ =/!4 3@#b@^ =*,  Mb   2 'l@'h3b@⤠? '@ , @"@ @"3" " 03b@|? ''t@,   ` 7'p5 0*` X?`&5 *` մxՌxռՠ' '| | @ ?0`!8 33"@U+3@C"0!8  3# 3#03#8n `3{#@`{3v#h`v3q#ҤФΤ  @Ē 0!8 3#@T3##\ @T0P)` 't xt @ ?0`@!8 33"@TΒ3@#04!8 x3#@T’x3@T#0'&3!# ' @p`'t  l`p m`l g l0a8ht@#\\ `@/pQ't4  ' H't@=p@'t ' 't ('| Ж|  '@'  ` # -4@C  @00耢 0!8 L#4 P4 p4 x @0#4@`04  `4 @/<0h p   $'|@Sl'dd'l  l4`ȠX@ݔ'l 'h$'| h|@ tl@?`l # "4  @0 - 4Y 4V T!U@/0Q0!8 2 3#@Sݒ   4 @SՐ!80>!8  T!4!x@='T4@SĐ!0- 0!8   !8   !3@w# @S04@S!0)0!8 3#@S     #\ #` #d #h $#l (#p ,#t 0#x 4#| 84# <!@S|#0倌 v!8 h 4!4!4!ؐ @Sh " 4!'4%4, 2 >2`*` @ .@  * x, @SM2 * 2 #, h /0!8 l4!L@B$cl " 4!'4%4, 2 >2`*` @ .@  * x, @S2 * 2 #, L`?"` * r"@AQ 0np?`e7!*` hx\h  0!8 3#@R !8 l4!@Rޒl4@Rِ 0Bh  0!8 3#@R͒@04!8 4"@R”@l0)h  0!8 243#@R4!8 l4" @Rl4@  @R"0 4"04"P@-kernel does contain bad dynamic port tables, cannot mix +/- with full listinvalid port, range is %d to %d㿐@Z +  @@Z - a @'/ @ ?2`\ 73"@RR7@j#0| u 7@ c n/J@ i + -" @ 7@ԙc @@QȐ`~* 2 !.  7c"@ԉ#:  + *`2 >2* @ .@ &@ 2 >2`*` @ .*&@  67/  @g @ +/57;7 @ 5 "/J@ /@Q ~* 2 !*` c"@G#2 >2*  .@@&  ސ/ & @'㿀"( &0a@"( ''0! $  /!8'%'  @[ ?$$  0"!vfsinitX" [ '' ' '  @8 K@X* !/ E$!,  @* ' ('0@ /!- /8/!8'  @   -@@&H@T!,0@O!,,`"   @" `@&'0"!/!,b"`P"`Tsetuidthird㿘 >c?9`1@)#" ?&#*`   'ahespudpegptcpip4ggpigmpicmpipencdebugmaxqueueporthilastporthifirstportlastportfirstdirected-broadcastsourceroutettlredirectforwardingbmcastechomaskreplallowmssdfltsackidentsendspacerecvspacebaddynamicslowhzkeepintvlkeepidlekeepinittimerfc1323checksumenable%s: no variables defined for this protocolfourth㿘@ a8?9`@-`3 &!*`  @ 9#(@+?@ |?9cX@g  & *`  '?spx㿘@ ^c8?9`@H-` &#*`  @ 9#(@+B?@ 9?9cX@$  & *`  '?.%s: incomplete specification%s level name %s in %s is invalid㿘  :@7ax 2:!@+? 6. @`"@d~  &:!@*?usage: %s %s %s %s sysctl [-n] variable ...sysctl [-n] -w variable=value ...sysctl [-n] -asysctl [-n] -A㿘M H:::::b"@b@ 㿘@sumo:12illegal argument to -o option%sstdin㿐@u :@Вcp 8:@dcx <= 8<#!<#T+:! ):#=@[c? ? o#,@c# #,`8<#:@cc := <#@*T#@Cސ ):#= @+:* @@  `@z #@*D   c@*6 Ā@@ @usage: cksum [-o 1 | 2] [file ...] 㿘M H;@ia@v  ;n C&vkkMGP&"/+Ka5 d1͆< 8OLpHEAR_[԰VRVuj6n+c gZy@}]p{zt^f͘#W`9'<݋Rd+[XF﷩`6h}/-03l ]2mp'ݰVqKI6Lδ "u=:(Fy>C͚}-4pw0Gm=K9V'#C.=* rOx ͻK} x|VqiuԍkoRlbf^FZ^[W}S`fM0cIZ-D @Ɨd 'NK`#%▒+/l6/A ]h@D+f{*uP6&;>k;qv2PUMƼ_}>1ֆոy4:Zi mY`ۀdO7z2~ɋs\wKO VKF68BG+\{Xf=U@QC]S%;!&),(^G6MB2P?v,;Zk&ˑ HVнMR#/VKm`lp+ =eh 'ޥdo#j͡`볽>~ɴ}:̣y{6`Ɵ}q[uF2 -tq0]YK.TPɶ@NEJOG +C{}!C`rFOv[h lGJa0e-$KZV^pm0=5^ [7Q3R>?:Ѐ$Ѝ V:-)Tũ&yh;+֭PlM/kv|`v#d'sĉ yྀ:gК՞}b> q 2+ߢ6hfmu{ڵ6]@?c ? ;!a : $@ @ ???? @4  * `,  2` * *`@$`  &;! `4`4  * @`!,  2` * @*`@#!< &@a : "a%lu %lu %s 㿘<#@@M "<<#H@M<@M#P㿘<#@@M2 "<<#H@M<@M~#P㿘<#@@Mu2 "<<#H@Mn<@Mk#P?c ?@)@?#@   2 4   &@& ?c ? @h    ?# 4  4  &@&  㿘@tsetJ, MIJ@"%  ( PJ @ * PJ@ 2  J` M I*PJ @M I*PJ@"tset: 㿘'H'L'P'T'X!M H=c@H@}=@c@ 㻘=cc`' `7/@K#@;Q@ write to stderr㻘 @x= %=@$   @?Ґ̐@Ґ㿘M H`? "`` *:   H * # H@: Terminal type? [%s] Terminal type? 㿘L# @%M=@c@ '0耦 H>`@0>@`@ !@TP 2  =@yc@ @TQ 2*L耢 2 H@820K(n ,X `%KKK23040011520057600384001920096004800240018001200600300200150134.513411075500unknown baud rate %s㿘N B  >!܀`! 2   2`2 >#Hϒ malloc><@=!:illegal -m option format: %s㿘 @8]@7 0>Ȑ#0cP $"cP0"#L0cL""cL$ $ >@Ic  $ j$ @2$  ?!@?ߑ* :  9* @ : $  4 $     $ IJ`N@ : #> ` :@S9 >.@`P$ `$ , : $    "$ >##$ 㿘0#P @?"#   " @_Z 22 (* D0lX `P  `?`P @`?`P   @ `P  `?`P @@  "  2 TERMunknownTERMCAPTERMCAP=tset: unknown terminal type %s tset: can't initialize terminal type %s (error %d) 㿐 2??@# @  "?@ /  @x "? #}?@ѐ# "-NJ /( b "#N'? @@^  ``" ",` `` "@N  `N ? !MN    !M%?#? @  H@j c@e 㿘 0b@  "  `,    ,   `,    ,   `,    ,   `,    ,   `,   ,    ,  ,   ?  $ ?Ҕ $   $   $ @Ѱ㿘1 #`J  " ` ܀ "  @ 2 #  J㿘0"  ! &0a a,  , 0"  !  0a  a `*0"  !Ā  aĔ  a `*0 "  ""  "` J@   J` ?"" H*0 0  㿘@J0c@`$! # !耢  >@X # !쀢  >@X # a `̀ "*c * MH`?"``H * "H@7 M@ϐ H@# 㿘 # b M ` IMH`?"``H * "H@6 # c  !> @a X0cH M)A'M "@7{H  "@M`X#H "MH`?"``H * "H@6  %s %s isset todelete. backspace. control-%c (^%c). %c. 㿘0"@ 0#@`:M HB B (B 0@~  M HB@~`80$#  ܀`  @ J`  M HB@~`H0 M @ HB`X@~ 0 HB`p@~{-q-e^H-i^C-k^U㿘>J@ -29 J` 2J@B.! -2/   "J`J -2' J` e i k2 J` 2 J  i"B k eB B  !!!@4&  2usage: %s [-IQrs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] 㿘M HBb@~@   ,H^  H?   ,Hstandard errorreseta:d:e:Ii:k:m:np:qQSrsarpanetdialupplugboard%s Terminal type is %s. EraseKillInterrupt%s No termcap entry for %s, only terminfo.SHELLcshset noglob histchars=; setenv TERM %s; setenv TERMCAP set noglob histchars=; setenv TERM %s; unset noglob histchars; TERM=%s; TERMCAP=export TERMCAP TERM; TERM=%s; export TERMCAP; '; 㻐@l!0 "@ޒ 6B#"0"c  c"` "` "`  "` "` "` "` $"`  ("`$@qx"`( "`P@@J /  @Bc 0 "c@ C"! 7)#B@wΔ?v? 4o*  D D D D D D D D D D  D D D D D D D $ D , D D D D D D D D D D D D D x D D   D D D  D  D  d D  p 4 < #,B&##,B #* : & * : %!* : $a#, #,B#    @= @&*  @@@@o &/?  `h 10` !0RR&#H@$#D#H #D #D  #H    ``g 7@v700"0c@h ,   @* #@PB#@F`M HBc@|eC   C   C   O  C (@E@C 0'AC@\ X "C@?C@Z```  CO C hC C Ƞ C!@EO L`?"`` '* "@3 '@wC!@L@4c@E ()%'&*+#   $ "!$"#%&!     tsr2  u0kbok p r3iv4jzj`% w.-/f l43n5m+, 601279:O=SW;<@?ABCDEFGH    IJKLVMNTPcQRU>8Z[\]^_`abcd1vwxPJOIQKRMHdLg*)hstuiN!\~]ye"}qAB&()C*Xe|~+,z{|DEFG@lmnoZ-S[6hg/x.'7y8TUVpWXqY9Yf{}#$:;<=>^?_5 !"#$%&'(a%#&(*  )$ '+!"$ "% !  #&tsr0123b ku  v4jzw56789:;{!"} <#=>$?%&'()@*ABC|~D+EF,G-./f0123+,456789:;<=>?@ABCDEFGH    IJKLMNOPcQRSTUVWXYZ[\]^_`abcdefHIJKLMdgN*)hijkOlmnoPpQqrRstiuvwxyez{|}~Slmnohg/TUx-.VpyWqXYZ[\]^_` !"#$%&'(a() !"#$%    '&*+  $"#%&  !hgn ijk    fl+,copqdpez{|}~mq/.rrytuvwx0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abs&5 k  j%)*./ 024361ABDEFGHIJKCN9;?TPM<>QRU@V87=XLOSY:WZ[]^_`abcd\' fe!"g*)hwstxvuz{|~}ylmno+#-( !"#$%&'(,$- i㿘@H @Y "0 ` "J   0% 0"JR`"ԓ*`  #` R`#*`  !t KR` *`  #L  SVr1SVR1UltrixHPAIXBSD, , :\ :%s: sorting by term structure order %s: sorting by terminfo name order %s: sorting by C variable order %s: sorting by termcap name order %s: width = %d, tversion = %d, outform = %d 㿘"!0*#p0 7"#lN@Oc N@Oc N@Oc 0 ""cXN@Oܒc( 0 "cXN@OҒc0 0 "cXN@OȒc8 00 "cX0"#X0`U"#\O!`.`  =t = >D >D =t0l x"c0m""c0n#"c0#N#@N#H"@0N/#P0l""c0n "c0s#l"c0#N#@N#H"@0N#P0 #`"c0 !t"c0 #L"c0N#X"c0N#`"c0"#` 0O$7 0JHMa HN@q$chA Ma HN@qc0D#"c0E 8"c0E* Ԁ Ma HN@qc0F#L"c0F#"c0G Ma HN@pc0H#"c0H#"c0I \"c M Ha0#X0c\O@pՒ` 0   0 0H ?20 *`P?0*`? 0X`P( A A A8 A A "3`% P `$M  0J "`   0B$A  0>````6 4  "`   0*  0'`$%  0"$!  0`&  0 J   0 0 JK *`H 㿘 0"#xP"h0#@0cx0|@ ` !0#t "|@ $#t@$#t0#t!0#x@&#x$#x㿘0!0#d0#"h $#d㿘@0@#0cd !Ȑ 0#0cd"cd%%%c without %%?%%; without %%?㿘 @N@q  *:  \"  e ;"C` ? % W`R  t `L , H F `"D ,?@,   %, , ,N ?  @x)2'NNP@G#!N ,?@,   %,  ,, P@F#,  N ,@%s@%s#%dim=ei=%s=!!! %s WILL NOT CONVERT !!!..%s=%s%s=%s%s=meml=%smemu=%slqkxjmwuvtnbox1=x'H ?܄  H?(0"#P 4'H 0# 0#x/00"#d?#0#` 0#,@0c,`  ^*  "0\    L O  L T \ 2 H?"@%Q `Q@7 a04ϐ +00#d  /0?#0#` 0#,@0c,`  *  "4\    L O  L T \ 2  H?" ,`R@Qa@&Ɣ0 Qb@&`4{ &00#d "c.`@X@`@`2`@ /0M!|?#0#` 0#,@0c ,@ *  "צ\    L O \L T\ 2Ħ\ F  Ѐ ,` "  |@2   2 Q"',` @2   2 Q"'`Ȁ " f,`"  @L9 2  "  a쀢 " f,`"  @L)   "! H?u/ ,`  `?܄$ ?܆  ,`@`\Qa@&0R ,  @\,`V @ \ ?Qb( 26Qb8Qb@@%   `?@1QbH@%ϔ0J#p \ 2 @q@  @5 ,`@e `@t 0?܆(0#X !@  &l ?#Q@%bPX  &pLQ?#@%bXJB " > "H?8 6 ?#@QJ"``"` L@?"H   .@L ``.@?#@ Q?#bp ' bp`?0c\7 @`?@5?50x0#tJ  J "x0#tJ :0J 0J  0J \00cx?"cx0#t0#x*@0#h0"#d. 20@#tolder termcapterminfo# (untranslatable capabilities removed to fit entry within %d bytes) # (sgr removed to fit entry within %d bytes) # (terminfo-only capabilities suppressed to fit entry within %d bytes) warning: %s entry is %d bytes long # WARNING: this entry, %d bytes long, may core-dump %s libraries! 㿘0#\?  #T 8 @+!T H  &E.` BT X@5 5T  @5"  #T В30cX @5&cX #M`H!T@ !@l'T!@@5&cX"" 0#tL@$c%s%suse=tc=̐ ?#T.``# T#(T#0 @$5?#0L#t@$xc0#x comparing booleans. comparing numbers. comparing strings. 㿘T#L@$Zc )0'0%0#0#` 】, @c\+ @ J O  J T c\ 2     +#`T#L@$*c )0'0%0#0#` ㄑ, @c\+ @ J O  J T c\ 2     &#`T#L@#c )0'0%0#0#` ㈑, @c\+ @ J O  J T c\ 2    !#` 㿘  ? " @= *  @4d `"  2 D !? " @= *  @4P `"  2 F f(? 2  `Ȁ? " "f( "  耢? " 쀢`2  ? " ", "! ?2 B !   `", )U@I"X`?, )  8? " @< *  @4 `"  2 H "? @< *  @3 ` 2 J㾘 "HV`T J@ J@ *J`    ``J@ 2J@= @! bH  bH J@ +@   bHJ 2bH  K "  "H*  "H *@  ,`  "H*  "H* TERMCAPTERMPATHHOME%s/%s.termcap /usr/share/misc/termcap@9x 23OV@d! VL /!V@[" V@T" "@ !# VbV@"\  Vb 2@_$$@`O 'J  :2* J*`:  " :2JJ  J  $@`@ ԔJ  $@L  /" 't@Ẑ 6't+?'ttx@ tt@_Q$@絒 : ?L 2,? t? ?@E? ?termcap names not colon terminated| %s%s:\E\040\041\054\042\047\140㿐'D@;i : 'W@# W W 'W*%W 'D@J LN D@1t耢 D@2`?"`` :* "@!6 :%MW"!LW@` N    N N倢 E* @ _ ` ` ` ` _ ` `( ` ` ` ` `< ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `d ` `d ` `PW@2{!W@2x!FNW@2s!ANW@2n!aȀ 2@X@,!@X@F4a؀ 2?X@+!? !X@J@ - +J` 2@@- @@F! "ɲ`@@+۲`? 4@@- "X@-@א X@!!: $ PJ 2XX@" $ PJ 2XX"$ PX@ې"8 "cJ 2?X" "cİ?  @@`?@6 : "`$@  @ @*0@  @#@͐  @ @(!@ @;@:g  耢 /@ X"0@1m @r @: 1: t @i @ t @b @;`8:xx?x?8@T 8#8"#@j @ @v @? @@2@9 㿘@9).㿘@  @  @Cannot allocate memory㿘@g  Y"@1  @ JJ "  " 㿘 0#"#: "`(@ : $ " @@v@0M@  @/dev/ttyh"8!"4? Z @\#  $"4 $"4 "4@?0"c̒c"`"`"` "`"`"`"`"` "`$@Z"`(bX"j #`n"Y `2"P `I x/耢`KI s/耢`"L `E j/耢`Ea,F c/ !@"O g"C d< T/耢i`<"@; K/%"@"< #@3 >/8!@1p"@0 3/ .2 P+  ( &  # !                       2`P //:" X8"#:" |̒ ~'Ԑ  ?''0## ' ' ' ' ' ' ' ' $' (''"4 @Ȁ?""8WARNING: terminal cannot %s㿐8#Ѐ  " Z'#@/ΒLINESliCOLUMNSco㿐!"4? Z @[  $"4 $"4"4`h@  [`:" ,@ɐ 8 "[@.:@ސ @:"`,:`,  "`,"4`h@x  [`8"#@ H "[@.8@ P8"c8c  P"ckrklkukdkPkNkh@7kDh '[!@!1!l@@0` ,` ,`@@#`@ ,'[!@ !1!l@@@ , ,@@@ ,'[!@s !1!l@z@@ ,!0#ܐ@n@  , '[!@U !1!l@\@Ґ@ ,!0#ܐ@P@Ɛ @ , '[!@6  !0#ܐ@=@ @ , '[!@#  !0#ܐ@*@ @ , '[!@  !1!l@@@ ,'[!@  !1!l@@z@ ,'[!@ 21 //Ҧ1!l@@b@ ,@ ,@@ߒ@U@ ,@//: `[@/@F@ ,@:`| `|/ `@/@4@,@0#@a@vTERMunknowndumb:hc:hcamxndadbsgpcksketitececlear to end of linecdclear to end of screenclclear screen cmsoseusuemdmembvbbsbchohome cursor|^llmove cursor to lower left of screen alsrscroll backwards㷐\@"p \"x@ 4 \\"" ?/\@"@.\@ڐ":"`4\@Ր":"`L\@А":"``\@ː"8"c\@"8 "c"cc8"#:" d:" @8"#:" \8"#8`"#8"#1"'\"@2`"" @ *#\"@Ւ2 "cD\""cD\"@ʒ2 "cH\""cH: 2" cL\"@2"cL\"@2"cP2cL 22\""cL2cP \\""cP\"@2 "#`\J@ 2 \\L"2\""c\#@28#쀢 "c \J  \\0#2\""c\#0@f2 "#`\J@ 2 \\#82\#H"c\#P@O2 "# `"\J@  92\b"# 9"  "`\#X@62"c \\""c\#`@(2"c \\""c \#h@2"c$ \2#"c$\#p@ 2"c( \2# "c(\#x@2"c,  \2#"c,2# 2 "#0#@2 "c0\""c0\#@ߒ2"c4  \2#"c42# 2 "#8#@͒2 "c8\""c8\#@’2"c< 2\\""c<\@z# 2\#@2 "c@J \\#"c@\#@􀤠`2\"2# J@  \"В @ @@  @'\\@t2"c\#@s􀤠`2\"2# J@  \":`, @w@g@ܐ @'\]@F2"c] @E􀤠`]\"] @9􀤠 :\": ` 2 "#]\@2"c2#J :" 2T T㿘!2$#T:_`,@#T㿘N  N@ 2N "N@  ݐ6㿘: D 2#:!#L!t`,@ٔ2#D`,@Ԕ "b0㿘: D %0 2#:!#H!t`,@澔2#P`,@湔$0㿘2# @比t㿘2:#`,@楔t㿘2# @朔t㿘2#  @ @搔t㿘:  @@* 㿘2# eJ*eJ*"J ksd  | u |  |  |  |  |  xLESSBINFMTLESSCHARSETLESSCHARDEF㿘e@!e@!t e@~!  J@  0 2h  2h %cESC^%c㿘   2#`ebp 2#`e@bbx12 2 @ܐ 2#`eb#`bx@M12#`33h" (h3 3 㿘3@ h㿘13 3 h@P & J!3 @  "@$ . N 2 3`@  E @3 N *: @$e@ N@`3`@  $ @"   3 3h@Jh   㿘13 J d `@$2& @}3@" 㿘33 h@ (3J 23   J? | 䀢J?3 h@  J? h 䀢8J? 㿘3`J    J 0  J   J   㿘33 h@ !3`$`J@ "@$ N  3䀢` 㿘3J h   3  *"`?㿘13 J "  `@#& @3 @"㿘33 h@"J@Ұ3"@"MN    㿘!"  08 " ` @" "  3g 3 h"N  %3`*`sJ@@$@#?`  $`N 3  *㿘#b ,%3@vh 'b" # @7h b2 #bb ` 3J hb$ $`$ `""`b"`㿘" @? "@"@  `g"<*`  P d @ @ x *""<""3"bJ   J  3 J  3`J z   J p ""33 h@  J?  3 䀢8J?33 h@(  J? "N  䀢8J?F ""A3"bJ    J 0 "", ""'""".""""S""3 "`""А  @ "" 㿘3 h@~ uJ!3 X@v @8#?@$ @l "@7$ @f3 * !3 , ?: !3 * b$  J?`'?'813*L@H㰤 @@ $ !3 N 0@! L 3`$     㿘 L*`:   L   㿘3`J     J 3 J  J3 3 h@ J 3 3 h?   N? ? 8N?㿘'3쀢 @{m$ 3#3``" @{` !3  " $` @)" @@ *@ $*@?㿘   1i  3@t 3@ 㿘!"  2!33 쀢`2  3" $"3@? Ӓ 3"` ͐$ 33@ 3  |  @3 3 "b; ""8 㿘3`耢 "`@<      㿘3@ m h㿘@ Ԑ@~3@"3 h㿘@ 㿘3""!lC3l @ @*!/?㿘3!p 3  "al!3!p!i#(!p i#0!p @i#8!p "ii#@#H"!done|done㿘3al`*j \*`   d d d  d d d d  d d d d d d d d d d d d d d d d d d D d d d d d d d d d |3!t@ 0SL@ +"` "`!" "L@@zL@ @$"W<$"3a|!3L!x@d4,!xL@3tL` 0,L`3tL@ 0%@Y0"L@ ! !"̀ @y@ $""̀ j @]j 3J!@Βj @ @ 㿐3!l`/j"*`  < < < < X < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < ?Ѐ w@b  ds 3"at3a"!l : Xd8#䀦`3J!x  + -Y + -3 !33 "a|3 "a|!| *ax@  3!|j@`Q 3Jax + -0*ax@  / -/// / 9   *  @ !0 0 @! 3ap "ap   $ 3 !l?݀   v  [Press 'h' for instructions.] [Press space to continue, 'q' to quit.]㿘"Ȁ`3!@Z@ v 8cx? cx`? 8  @ :8xx@ :8#p !:  @,$ $ :  8#  @ " % !8#  *k@!.$#@#: @ :0@8# k@!less version %s㿐 #'k#@㿘Ȁ`3!@"J"Ȁ @ 3!l   g   0 @)ungetcc overflow㿘!"Ȁ "3!$""3!l@ l h@  "* $"ȁ㿘@{? L?Pattern not found㿘3!p a"`@ @ 03ap  >"ap#3ap@% $ap  @  @  ` `l!(@R  @ O :%s helpExamine: -Cannot edit standard inputCannot edit file processed with LESSOPEN(N-th) No %snext fileNo %sprevious fileNo such file_+mark: goto mark: |mark: Brackets: 㿈3 "ap+3%3-: !p1: ,8 2  : "]%al$t3T` *!x@&: ( ?T T al "/  al "/`  '/'@=쀢`  ``cm *`  `  X 0 @ $  , d H p ( $ , \ <  lbP ]Tt`9" t @ $tt @  0,t`9" t @$tt @ 0 0t $$t<tt $$tAtt $$tt, t $$tt0 @ }:" 8T` "#!:  @   T  :" t`8"#8#ؒ @  0t`8"#8#ؒ @ ݔ 0D x@@ t $$tzt@ ot &$tt d d$tl@ t0gt @ $d_t &$tt8 @ ͑:0R@ 'l"XJv t %!p$td@ t`%!p$t\ t !pt %!p`$$tP)tǐ 0^!p  ?  ? t% !p  ?  ? %!pt %!p`$$t,t :%!p@ : 0  l@"`@  0&b lbh08@ U"l@0>bx 2lX" t lQ"8#@ @@7"  0t $$t@.t : 8# t t $jl"А 'l"t $$t@"t t l"j 'l"@0t $$t@t l#@ 0 /lbx 3"!| lc| :`X 8#䀤j`@~ 0 lcf 0b i_c80 lc Y :`X 8#䀤 ~ |@h0x lc(A {:`X l8#䀤h f d@v0` %lc8) c:`X T8#䀤P   .@0 F3*!b %i c80Vlc@ 0Pal M lcP 0C8# 8$"#㿘"@+!L @? C@U㿘  @P  @"`"` "@$?Warning: some commands disabled㿘 dݔ o#@ג Warning: some edit commands disabled㿘 hŔ p @ @ 4J@K)`J@ g`"#!" 2 J@J`g2J@ fJ@`J@?`J@2`?`@ И  d㿘  d   d 2 㿘 d㿘 hH"H"(@㿘@J J ?i 㿐@N E26?N n22?N d2.? ' J `e'`x`c0 0Đ@ P'@s?  㿘@Eb I @i 4@O    @v ?  @sz@u)?@u@u< "N@sg? N  M N  +N  Gky .lessCannot use lesskey file "%s"㿐q@$ x   q' @@s1x: X8D #䀤 >  $,@,@ ,@ܰ  ` ` 6 d` "  d ` ` d`  d ܀ ?L@ ?0 㿘H@v4&@@  & N@ ".@ `@*N@㿘`@v@ @*N@  N@ "` @ `@ J"?8J?  ?J?㿈#b "@@耢?b쀢?b@A@W#`t  @/"3@@rr`t$`t""㿘 "@0 @-%s"%s" may be a binary file. See it anyway? 㿈!"" "   " @'@  K r@,̒`0  p A'@ 'r 8@@r쀤`@@r@cm @CВ '@':   @Đ  @h r' @@쀢 y Y @taπ` ""!$"" t3@"a8"@cx8 "ct",`: $ @ " !"@`? : $ $"@@ @;  :  r' 8@ 㿈  ǒ `@   耤`@.@qt! "@"    Ր 㿘""@  㿘""@ 㿘"@? " ` 㿘"@? " ` 㿘 @ "  @ːMissing filename ("less -\?" for help)㿘@j  p " rs!X@n s r 0㿘?@@Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"㿐 w@B @s: "( "' Os!@u?`0Ts# *`  @ @ t @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ t @ @ @ @ @ @ @ @ @ @ @ 8@!"b$@B7 !$"$  @se ?"$@r"$?$"$А s"0 "$ s'"p@%s/%s㿘 % L@ !@s@s @L   t`@ٖ@A @p& @rHOME㿘t@p!0В " LESSHELP/usr/share/misc/more.help㿘t@p!h t!xD㿘L@ # @'%*`:  # %2  0  '3@`@s0`L@  @ ) L@  @'%*`:  # %2,@o`@@s  `L@  @,%s*㿘@r  tc@H@@*: @o @oX# !  @r ?   @q @   @   㿘  @r] ??? 㿘 d䪒 ? $@-/  $` $@&,,,䍒 @@o-@r,۠ ,SHELL%s -c "%s"r㿘@rq`@rl" @rf e @u@o! N "@rQ@rN M ua(@@nu@ϒa8@necho %s㿘u"0 z@-N @nĐ0@nLESSOPEN-㿐 ?u@oE"!ub@)K ". L |    `T  @p֐ @ O&&@ϐ /@N@ 2LESSCLOSE㿘"u@u@n#Ѐ L@8@@ :@g)  % < @ @q 㡒 @#`x@ @q 㒒 @`@8@h  㿘:  Xb㿘:  : T @? ? 8@ 8c "c㿘8c @U"c...skipping... 㿘 : ,?4 : <  : ,? 2J?3:` : ,?S`@   ¶ 0@? @ @/ "?@ƶ @:    ? 2?v@"?,O:3:98`  0@< ?    @G ?10:@\2&? ?` `   耢  ` `  '#` @?`:  8"# : T 8c "c "@z" @ G?㿘 @4  : ,?8 8? "#@G ?@`2 ?@=?`@5@ ?㿘: 8#  o  I* 0E@? ?96` : , @@ -:   @.   @x      @n? ?  a8c  "c 㿘@R  ? `@F?@?N:  :: #,?Cannot find help file-%s -m -H -+E -+s '-PmHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done ' %sEnd of help㿘 x @ 0@oi#:@oe`8 d x``8@@l@ x!(@g @k   " 2 㿘`2@ @&& @" `&@ &  `А "`Ё㿘 "` "@Ғ?`А?"`Ё㿘  (& ??> & ʒ㿘 !"@'$"Ӑ@k @k 2  2 㿘 2ސ  Н㿘  "  @& 2  㿘  "   @: `:  :@ :` "   " 㿘?8t#Ԁ   ؐ+`  ; @ F @] ^@@?N  3: 3:!8`T B ?B?  @ #  ?   }B? ԰@}8# `3:r   ?`T @??0 T 㿘 8x`v#Ԁ  ؑ*` :  @ f 0  @F?b W8# '#:,*MK  #:#:C  ?`T 07#:04`B 0 `T *( ?`T "  @-:@/8?T @6??0&D " B?  @  㜀 2 @Đ D0̀@@Cannot seek to end of file㿘J z!@_ 0E ? :2 ,: ,  0 ,  @Cannot seek to beginning of fileCannot seek to line number %d㿐@ ?   8#@T4' 2 'L8@z"P z"x@㿈@G@@sDetermining length of fileDon't know length of file㿘 ? z#x@!  ? z#@ϒ 0@89>   d@5O 4 8@ 8D?8#  @㿘  ?  @ Cannot seek to that file position㿘@@ &@?     $ 0@        {!@\ 0@Ґ  @ΐ?  B: >`, '%:?@   , "! ?2ހ?@+8"#8"#8"#p  : ,%?09`,?! c ?4  , ,  ?@8"#p@ : , ?^4 4 4 4 4 4(%6d㿘: h D@q14|`X!9! @!@k 4a   "a3!a + "a:`H 9 "`H9 !4 3!14 !,!,@ `!$!`H @Q&! !4!4"!  :    0   0  @:\88  :    0   0  d888㿘 &? ! 4!`  3!J ``4!`3!J 㿘4!3"!9 J aJ@ 4"@"㿘`B @7 2 8c` 4a8@@@ 4M 74᐀c`F `9 J 43!N 4[ ᐒ ?.4a4!`3!J   29`2 9X 4a ?"a94 * 3!* 4a "a㿘34Na` 4!   @ ".a   : p 4*!4:! @㿘!4! (9$! !4!. J :`@ _  _     U8 K  ! $! $ : p "     0{88x . q k44! j  e$!:`H !4 "`H14   M!`H!@P}$!  I Đ 68# ȐŐb|@iڐ4a@@8#@@4' N "!4*`: ֒ !  $!N  Œ 4 a "a 㿘4J!`` 4  44!   84!8#@: 4  : L 98# 99`4 *@ 3!*  "94 * 3!* ~ 4 8"@耠~`~h H3H"@94  ᠝㿘?  ?9??0 #` { ,,{ nB?,9 &㿘  ` F?  !:??0   ,<w  ??,=`B 2&4؄: 4  4 4 6 4  ᰔ  88  4 @b:㿘4!P4! 44 @84в @"6 " "@"`:`"`&`&Ð 6 #4!` !@ 4 2" 8" 26  " "@Calculating line numbers㿘!@   "`㿘!6    d$ @ $ 6` ` ?$ 㿘: h ?   42 `! !4! 4 @8 z@ @ 6"` 4!" b@ f47 5n 2[ 6"  :T 2K ?"F @" 432@/0,< 2) 6"  :T 2 ? S@" ې㿘`4  0d!!"     R @ 4!"     $@ "@    3 5 %:  T $? 0     %:" T ????0m㿘@  Z? ? ?): ,? @  ?  ,?@"?! /dev/ttySHELL%s -c "%s"sh㿘N -  @ #h@ @ |#p" m@ D @ @ @eې #x@5%  @ @c#@ L@ N؎@f@f ؕ c@ߖ  N 2#r@5@c$@e @Ð@e@x ش 8 "cpŐ ؃ @W 㿘@ϐ 7?@   ?  @ ؐ? .   4 ??   0@Cannot seek to start positionwCannot create pipe㿘  "@vb "@  |? @#h@@#pݓ?@j' @  @d  `E 4I @E &??  ?` $  @ . :    * $@Ӏ# #? ?` $  @ . :    * $@ ߀?@v @d1 @ Đ  8 "cp@n ??6@8耠687??:!(Invalid mark letter㿘? . * 13#(? !h@i  . * 15 Cannot seek to end of fileMark not set㿘 '"17 . $0, ^)6 (  > b& 1" ( '!!6j (:> ,"& $ (!6^ (> "& $ (!   ?  ?"@   㿘`?㿈  @ @> "> &㿈@ 4耢?7쀢? a ; "; #a 㿈 (7a 2?2 ?2 "  "a 8#:"??"@" 'Mark not in current file㿘T  b  @ ??Input is not a pipeLog file is already in useNo log fileLog file "%s"㿐 &  0.0+*"", !  "$ !0 X""b,z<"$ !P b,!`'@F㿘 "b(’Line number is required after -l㿐 ' l@h`2 "x@ 0 "`|Cannot use lesskey file "%s"㿐   '#@㿘  0*(" @h: t`" @ ? 8 #  ݐ 0#  FTags file "%s"㿐    ""#0շp "c# 0'@/㿘   "  %s㿐 )8  "N@0,+N@ M"8 m = 8# 88# `#` "`#@` P &: l*`  '@i㿘   !: x$ x㿘   @ 㿘   V H Use "h" for help㿘: 0    "h@+ 0T Z@rڟ "b# 94:,There is no %s flag ("less -\?" for help)㿐 'D!7!@" J@€ $!@7"!@ #DJ 'D? 0Y*  P ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( P ( ( ( P ( ( ( ( ( (  (  ( (          DJ@ +`?`hD`d'D D"`J +x'D"b D@P'DD z?'D@ 2  @d'#(@Ԉ    "`   `, # D&     `?"N   @ @+`? J@ c @s'DD@  "@ D €DJ UDThere is no %s flagCannot change the %s flagCannot query the %s flagCan't use "-+" or "--" for a string flagCan't use "--" for a numeric flag㿐'H@b @'"p ` @@ِ' " `! @ΐ'"@0    HJ "  ` @ Z "l``  "&   ``> 5Z`"P` "` Q`" `M` `?G"` `?B"@"9` "N@:`" N@6`` @`@ @``?` ("@4'`#"Ȁ"` H`` @` `  "`"@"@j 04`  €H`  @ `  "`    ` * @ '`@?` 8 "cp` @  ` -%s㿘17!8!"Ȕ@X㿘@j    S@ 㿘@^  ` 2`7@@ String is required after %s㿐͐'#x@㿘7!@J㿘N 2  N`$2 . N Number is required after %s㿐ҼL -   ?А  &"?' 8@Ҭ    * . @*`: @АА ( $&`2 Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminalTab stops every %d spacesTab stops: Display ~ for lines after end-of-fileDisplay nothing for lines after end-of-filePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modetags file: tag: Chop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters as ^XDisplay control characters directlyNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Log file: log file: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileBe helpful in promptsBe less helpful in promptsRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffers%d buffersBuffers: Search skips displayed screenSearch includes displayed screenH ` ` "J@ HGJ   "  ( P  J񀠀  㿘'D'H'L7@i!H 8@!8 $#DH@]RL$# ?"#@ ?㿘7!H@i 㿐@%s: %s㿘 # @@^C@^@ ? aؔ@?#c㿘! !X!X`    d@&    0   $ 2            ` @6   0  0 ̞ܞմ㿘% `7!p@"    @\A8 "cp$`㿘! !`8!p@ 88c̀ !`m"c!`* $!`㿘N *`: N 㿈6 `2 @C 0, @S ` -, 耤 $?L?㿘N ,*`:  % `N d  s2N@L`   *`: L`  N@ `@N 㿘:  #b`" 8#b`o 0' !h8# @ 9  q ߐ   ?ԋ8#8 "cp/㿘Կ R!8 "ć㿘!" Ԧo@ "` 0 V8# 8 "cp?:??   :, ,:,08 * :, ,  ::, ᠅(8:,  *: 8:,   ??(:@㿈: ,8!p@%! ! "!:@g@X!!:??? , # $a ,8"!p耢?쀢?a*  :? 4!?: :, 6? 42 ( ?㿘: , @ 4  * 2     :, @ `"``" @ ??: :, $ :,6?㿘 h!!8$# !b#$  ^"0$  Z" "b8tH "t""tH"t%qd㿘8"t@쟒a%d㿘8"ta@쒔㿘8"t8r"8t ?( t㿘 ?!? ?#:`,?  ? `,?E -㿘?. > `6#L*`  5( 5h 5h 5h 5h 5h 5h 5h 5h 5h 4 5h 5h 5h 5h 5h 5h 5h 5h 5h 5h 5h 5h 5h 5h 5h 5h 5h 5h 5h 5h 4( 4D 5h 5h 4T 4` 5h 5h 5h 5h 5h 4 4 4 5h 4 5h 5h 5( 5h 5h 5h 5h 5P8"t8!x L@ 9 8E#"@c::: h: h 4"? 4+  0(8&#Ȱ c? 4 ` պ ?2    |"@  㿘?`6!*`  7 8t 8t 6 8t 8t 8t 8t 8t 8t 6 8t 8t 8t 8t 8t 8t 8t 8t 8t 8t 8t 8t 8t 8t 8t 8t 8t 8t 8t 8t 8t 6x 8t 8t 8t 6 8t 8t 6 8t 8t 6 7T 8t 8t 7d 8t 8t 7 8 8t 8t 8t 8D ?vƞ: P0og"r"Ȟ a|F B T`R   K?0I& ' ?620 !  qt8t8!x@tJ  "tt" oy  J:" ?." \ J2 02 0?㿘N l"   p b" 0UT ?* : `2J!d*`  :P :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :p :D :p :p :p :p :p :p :p :\ :p :p :8 :p :p :p :p :p :p :0&@?&@? &@? &@8#&@&@?㿐88!x"btN  1P" :# ? %" .". bt \bt *@`!$bt N w 2 N N ?c} N ɀ :8"#18"t8!x@`  *@"t@&18!x㿘 " 㿘8: lc* @88c8"@ "@ J@& @ MI   b`(" @J@2 @( @*`J@ @*J M   J   @ 㿘!8 "x6 $"x9 :j,$"x`, ?%8 ې ?,Ґ  @  " ,?, ?8""xNo previous regular expression㿘 8"h- 0x  `?"xInvalid pattern㿘  @?  1 @T"  ?# "&#@U&# 㿘! # "$#@I$#㿈 # @`2`` 8>``>` "` ` 4 >`2`` 8>``>```@4 `` @8@S0&@#㿐    6     >     2 J@  2J@> J@ ``C 'J`B ڀ J` Ԑ`'J`B ̀ 㿀'PD'T A'PT   P 8@ F T:` 8@ F O:`T(N  :PT P: p ` 1 @"-'`2@㿘8" 8#8""㿈耢?쀢? ? @p 㿘88cԀ`""x㿘    0"ѫ?\ѢP8#   ?(8#   㿈`/: @: T ? 4 2+< Ԕ 2? 2? :  h\??<W h  @, $ 8=8"` p   p@ "3  2  ` `":  :`:8#Ԁ  \\`2;@ Nothing to search㿈`N@ + !8R"h#Ԁ  $ #Ԁ  88bx 8"bx81""x58܀`ǔ g 8Q? ""܀ 8""8#8""!8#Ԁ   8""x#Ԁ א?? ? `( xS #???#\#`  8#Ԁ   0 88#Ԁ    㿈?588" ݶ?$ ? 8@8""?# @??  ؕ*  : B?k? 8?28??8"@  "28  (8 ؕ*  : B  ?"?8"@"28 8 ؑ*` :  ذ  0 ؕ*  :@ f0"" ?J ؕ:        ؒ :8 b@? @ $8 8  #\#` 8@ ? @4 8 88:"8:"㿘 @RגbH:T8c `"T㿘 @Rƒb:T8c `"T㿘 @Rb:T8c `"T㿘   @RbH @Rb  b@R  @R   @RLine numbers turned off㿘: T R "" T @R}  xO   @Rr  @Ro @R@R  @Rgb K8 "cp !8#%:,#8,  "cp,8 2  : "؀ ˃` :h "`8 "cp"h# tagsrNo tags fileNo such tag in tags file㿐 #@1a }!@Si8"):+8'8 @N j@ } L@  %c`% t$d]'J@ % t J  J  'J   * >''J ǐ w`*$d$dJ@`'J@ ^`'%c`J  J  \' * 'J@ J $"*@00 @-! :" tTag not found㿐8#d  T 07#h ??01  /:-:+8T x 2 h" c`c`@R@ ˒ T/dev/tty㿘 @!  8 "ch "ch㿐#8?ch ? ?Oĝ O "/ ch㿘@ W W W W W W W W W W W Wx Wp Wh WX WP WH  W8@ W0 W  W W W W  V@nfsv2porttcpsoftnqnfsresvportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforceunionrdonlysuidexecdevautorwrogroupquotauserquota23a:bcdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sconflicting version optionsnqnfs only available with v3port=illegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %snfs%s: Filesystem not supported by kernelnqnfs 1/mount_nfs:nfssvc err %m@)!: #"aH'x't c@P X'! # +!-!@$耢??΀`F"H*`  [ [d a a a a a a a a a a a a a a a a \$ a a a a \ a a \ a a a Z a _4 a _ ` a a a a a a a a a a a [ \ \ \t a a a a \ a a ]4 a a ]H a _ _ _ _ a a `L ` 8 "$< @u`< "  @u`% 8 =$ |c,@x |J@`6$ 8 c,@uڒ`8 P`( %`(  {$ |c,@\ |J@`4$ @ c,@u`P 4 (c$ |c,@D |J@`4$ ( c,@u`h   @K$ |c,@, |J@`4$ < c,@u`  @ 2$ aXxc,@tt``( %`(`t  $ t t ($ t t  @$ t   8 "$< @u[`t@ < "  @uO`% 8 =$ t @@  $ t`!" 0d  8 "  @u6`$<!$ t(t  $ t@!$  "`,t@c,@e`@L 54't 8 "  @u`$<!$ |c,@ |J@`: c,@t`"!H|c,@ |J@`4  c,@t`$ $ $   $ $ ! "`,|c,@g |J@`4  c,@tɒa$ , q$ |c,@R |J@`4  c,@ta($  \$ |c,@= |J@`4  c,@ta@$ 0 G$ !D" 0@yA= @&*  @@n@`@ @O !Xx@y   # - a`@tr@ %6! ( @$  ? @a@Or @x@Ne @Nc @Na @y!! @Φ !'% #@xڒ   Q @͆a!@OM no : or @ speccan't resolve hostname for address %scan't resolve address for host %sNFS PortmapCannot MNT PRC%sMNT RPCbad MNT RPCnqnfs 2can't access %s: %sp?'!: @ Z, Z@Ԓ @  @Β : @̎"-  *:`@͒ `$ @)  2! "@א 2 "@l   @M! 8     :"!H `  =&` :!H: :H #`5:%!`  - ! 4 o 5 `   ab@ܔ, 2 5 ( 2aH@^#{aH '! 0 '`  abܘ @ ab'@'  ( 2TaH@2# OaH@%v$ ''`$  %%  '' #\ # (! < s@sc8M`H@'%c0( 2aH@ec@@˻0 aH `@  @%aHaH? "%aH(  ?@$(  ? @cP@N @w$@L @L @L @xC!( $(@͖ <aH B : ` ! (  @M "#  !@b#X@q : 2 &` &`&`  &`: &`D㿘'HH@$㿐 @0"K @ "`E    >  &` `@? 6@` "1 `  ?+@1` &@ !@ @ `@"` `2    P`  P&@ usage: mount_nfs %s %s %s %s [-23bcdiKklMPqsT] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-L leaseterm] [-m realm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node㿘M HaP"@&b@M& ,-o %s: option not supported㿘@܏  @ @x}c0 ?L n L  o  @ʒ = 2*@͐ "  2 !  @2   "*@ " h 2Š  c8@q @IG㿘@RMemory exhausted㿘@% @9А /usr/src/gnu/usr.bin/grep/dfa.cn != 0㿘@H   h@tɔ @9 㿘@I'`  u@t @9 2 (  @(2 *  @ ("@ 2 (  @(*"@ *"@ (" 8"  *@ * 㿘;aآ  ; !@.  $!  !;`` `* "`! *`!"@;!`".  ;  ; ; `  M `@ ` M ``  M `@ `  M `@ `  M `D@ `  M `@ `  M `@ `  M `@ `  M `H@ `  M `@ `  M ` @ :cntrl:]:graph:]:print:]:alnum:]:punct:]:space:]:xdigit:]:digit:]:lower:]:upper:]:alpha:]㿘@K ;a@ ;a@&`? Unfinished \ escapeunfinished repeat countmalformed repeat countUnbalanced [x  ';);/;5;9;%;7;#8;M#h! `h!  %!?`r2$ *`  z vH { {\ x x8 { wD wD wD wD wD wD wD wD wD wl w w w | | u v w | x z; ڔ @7# Ք ;܀ e!?!! ;[!;܀T!`4`! J` !J@ \2J` )>! @ ! J  !J@ \J` |)!܀(f c!J `;!Z@W;'!!P!&􀢠K! &􀢠F!&􀢠A!&܀d<;2` 7;`!! 0;!+;܀ ! ! #;ߐ! ܀d;2` ;`Ӑ! ! ;͐! ܀" 2   ;& $`,?@6ِ! @?`%!쀎 '$b  !?$  !쀤`?@6! @?`%!쀎 $b   *` * ?Ѐ ,@6#P ,!  !쀤`?@6! @?`%!쀎 $b   *` * ?&&@ } \@6y#P  !쀤`ð?@6p! @?`%!$ }@6d#P'!B! ܀$2;2   2z; '!4! ܀$2r;2o;(k '!'! ܑ2   b; '!!&;a! "aܑ2   Q;;`H;"'!!&o>;܀ @  ܀  '!L';آ `2 `b `@ ` "`aآ``` W21'!{-'! ;l !쀥`.?@5ې!  %!쀦 ^$`!쀥`?@5ʐ!  @?@%!$ [@ \܀ < \ @7 \,\@ "+  @ "`آ``$ ,@HS@!@@@HN%!"@`$`?@5! @?`%!$,@ ϡ, \܀   !쀥`İ?@5q! @?`%!$ !쀥`"?@5a!  %!쀤-=$`!쀥`"?@5P!  %!쀤`]$?%!($`\܀ !쀥`"?@55! @?`%!$ !쀥`"x?@5%! @?`%!+$);!䀢 ! b   I * R  2 b    G"* R b ؐ ]0 [".'!x܀! X$'!;!䀢 ,'! )b   #X:b  I G",  R +d! &  @D?㿘;`` `* "`!  *`!"` ;!ؘ?  *`"`""+   h T T T T T T T x x x T D D D;b  ?;!` "`;b  "b ;!;" @4"Unbalanced (㿘!;" !!! ! ! !!!!!;"0$"@ "!@49" $"!㿘;! ,  ?! !  ! !  ?  ? $ 㿘  #;aؒ *` V a؁㿘;b> G /;-;+;"! 5 ؀`"@5! b  /!b 6';ƒ$!  ';!!  0 %";b> "㿘;b!!  "  ! "!!  㿘;b!  ^$" ! !"! No syntax specifiedUnbalanced )㿘;"!;"!;"!;"!;?"a; "a;;! "a@3Z"@,!;$" ;"b "?" @3K"X : !   !  &   *"@@"`&# ` 6`@*:`*`6@* 2   #h #l`"`@*#`#d@h l `;h`&@#㿘 ! `@<@7/`@(` ` .    `.    ! .    ``.` `& ! `@&`@6 /`@.&& ! ``@& @ (`.&& ! `@&   6*@"*"* "@ &㿘 @ `@ 6  (@   @ ( 67 , $@2*``2%K` 2!K` 2 6` $@ @2 `@2` ` Қ` , (@&. * $ ,@   $*@ A*`$ $.  $* "@`%*  $@"` $@` $*  $*  $*  $*  $" ` 6p (@  * @ V!  @ 24 $@ 2% $ 2 $ $ 2 $  $" $ $@ ` *` $  2`@  * @ "2 ` $  *  $  * ` ( $ (㿀`*  `  , $@` ,   n#,  ` *@ $` !"] !4Z '  ''@ '@ `'* @ E? $@ ` * @> *    , 8      '`0*`  6?*` ,  '''`0*`  *`?  &@@5` & 4 * ' * ' *  ' ̓*` '*  '*` '  ȓ*`@ *  @  Б-`% `@&-`  ݑ* ' Ē  @ 0& 0'Ĩ?  ? * b@ P x | |  '@`&'`   ''` 8@ 0*`y @* @ *` * %  * @6 @ 0** *`@ 0*`" @  0*` `β`  ! Ě $ ''` @*  8@ 0*`/ @* @ *` * %  * @6 @ 0** E*`@ 0*`" @  0*` @β` "   %ܑ* @'ܨ? ?@` $@@`*  , "@?"`@`* $@ @ $?  %@ `? $@  "$ $%``ܨ  Ę? 'ܐ a `?$ & ' &ܒ #&#  #@ 0-`" Ī` `@'  @6+' -`@ !!$  0-` 0  6 0*` 0"@ 0@ `@& '? @ܐ@'`` '?@`ϒ 쀤 `2  `0 2 `@  & ,& (*` J* & $ @>c@>a@>_@>]@>[@>Y@>W?c'D'L:a  "a#M!: 2  b @ ` " F!    :>a?#ؠSD`$(`* @   6M` ?#@?ct@ @D?* @ - @ c%@@ `' @` * @  ?# @ !D?cؒ@* ?@  `~ ?#t`$J ``  ? ?c@ ?#t`$J  `@`? :!,``` @"?ct`$@@J  `` ? :!,```*@" ?#t`$J  `` :!,``` @" `  ?#ؒ@``,`@ "``D @s?@.?c@` * @  a "Y  ?#@,   @`#@     "D ?#@ , *   * #    `?#@B?c@=`` * ." {   ?#@*" "#  `@ @D?@ .@ `͑* ."@ @  "?@ c@"@ "`D`$) * @  D`* ?c$ `* ?c$ `4 Z `$`` 2  0 2  2   2   `$?c     `    ?c  ߖ  M" (L  L @ 2 "@   ""@"@  `  ? #L?"? 6 ?#?cl@ @? ?#p!?cp@@?ch@ @&  @63`4 `0* @  , ?c ?* @#@ ?$@ `c$`0* @  , -  `@Ӥ`4  `$`@ ,` ?#?`c@ ?$@ `#w$`$``@,` ?ch@@ @   `2  `0 2 `@  :! ?#l?cp@@,`  ```` @  ` 2  ` 2 `@   `       (M?cl@@  ,` ?#p@: " @` `L! ` `  L*` @`4 L*`!   ?``Ք?cl@@  ?cl@ @?ch@@ ?ch@ @  ?- @;= &- ?#@;5?#@;1㿘`<#$!`L`8 @6&`<`@,` "`H@; `@ "`8@;`H"`8`@&`@&`<`<`L &`<. "@`$* @J`  ``. ` . `$* @J`  ``2`L . `. `L.   " . `$* @J`  ``@. `. `$* @J`  ``2`L . `. `L.   " . `$* @J`  ``@. 0`. `$* @J`  ``2`L0 ``L.   " u$> `8 &-` *&`8  ``Dq*`&`D `8&`@`Hj*``8&`H`Le*``8&`L`P`*``8  &`P`@, " `H" `8 &`@``Ϥ`P(. "@ ?$(`$* @ ` "`@`H" 㿘 & 8& <  & D & @ 8  8& H*` 8& L*`& P 㿘;aĀ   "aĔ  ( M"  :!Ē  "2 "@   ""@"@`8   @:!Đ ., @` * @,`@`  * @, @`   " , H  L *`@ `2$* @J`  )'@''@ Ű    ?  '  ~@?  ,`P@㿘 & w && & r & & & & & & 4& 8& Tout of memory㿘#;a䀢 @@9V  @*# $aMIJ  `@  `*`@ ` *  @9Q@& &&&&; "at l@㿘@91@9/  (   $ @9$  (`@9 $   0, @ " @9  & 0@9  0 8  @,   H " 8@8 8 & @@8 D@8 H@8 P T   @8 @8 2 㿘` @<1   @<' @8 @@8ߒ` `@˜㿘 ْ㿘@< N`@%  N  㿘 @8㿘  @8&  㿘 "J Ȑ 2.@A    1  ,@ `  @8S &$@ 2@@8`*`  ,&" @8<0 㿘  `": @8   2$@3 -N *`@u:`   N *`J :  N  4 N@]   "  ~  N 㿘 `2@ @;Ff `@ 2@㿘  `. @7  2&' >#   @ "@ Ȓ' `@ 2 2@㿘   **@*㿘#(`  @7p* `;Ȓ"@"`"`  "` ``` ( @7P $@@7M $`@7J $`@7G @ 7$` `3` /`- *@**@"`ߢ``  ` -@! "v !!!?s0 !!  ! ?0܀?0?ܤ ? @Ƥ *? "`JJ@J  *@:b@:_`@    `$@"J?@ J   $@  $@ * * @ F@6$?*@ "  @:@@:`@  @V " 0} {? $ p?J@ " `J " ސ a` \@9$@6 O J " ` ` D$` J *` 8$ J "  ` J@ "  !$ "*& $! ??**@*??* *`* $  `@9 "`@6 $@9@6 $ @`T$ &`T` @{@y`w`` t ``@6 %s: %s: %s %s: %s 㿘`#M`H!;b$@!@f ;M Ha;$@\; "b,㿘ߒ@9` memory exhausted㿘@5  "H 㿘 @5ے@5` "HӒ 㿘;b &; "b;@ߠ"4c $@$$;"4;* "b8@5n !; $"0"H "0;"b@;"bD;""<㿘!;"  ;@ $"@6;b4;b4*"b4;*"b8@5A   ;"H ;"0""0;"D;"4"@@";?? ""@? @?*`%;0 "$0@5C$0!;"4;b8;"<@ @7|" 0"4; "4; "D;h ;H bp"bp*H; h%s%c%d%c%lu%cwriting output㿘;"P !H;b(.@:;"T ;Ӑ!P;p.:`@"p;""h;"X  !X.:;b@;d& @  &@!L#@dĖ @ # Ԑ!`;""l㿘;l ;;"@"lbt   bl "t&@P$"t  bl -;bt bl--㿘;"H  ;;"t ;ΐ;"H A;"l;;"@;"\ @6;@ ( `@ (`L 2`@ @ ;"\ ;;"` ;" ;"l@@ # @ @& N -@ @ %; @&@  H 24 :@   &;"H ;% :; "b;"`;""t㿐 ';%;&@  @ L@N @L    b \;"L  N㿘>;"d;"bl;""p;""t -;); '; Y "@;"( c 0el %h$lD"@ L"  DL? D? 8L?D " ;bt` ;"\ "@l   J 2   l2$lD"@"@ bd" "@;"T %bdV 0`;"@%;DN";bt`Dusage: %s [-[[AB] ]] [-[CEFGVchilnqsvwx]] [-[ef]] [] 㿘M H;$@Œ`@6Ґ 㿘!"@ " #;%; @ 2    $b$  2 0123456789A:B:CEFGVX:bce:f:hiLlnoqsvwxyegrepyou may specify only one of -E, -F, or -Gposix-egrepfgrepgrep%s matcher already specified-rdefault(standard input)%s:%d (standard input) 㿈'D@y@!;  $"$@A / "$@< / $"$ '''<"a89;7;1!  5;D@@Ѐ Ij* " @ @ @ @ @ @ @  ( P @ ` Ƞ @ @ @ @ $ @ @ @ @ @ @ @ @ @ @ D @ @ @ @ @ @ @ @ @ l x @ Ɉ @  @ @ 0 @ < H @ T @ \ @ @ h t ˀ "\*` *  ?`'"\*` *  ?&`@!&`@!'"\ DD &`'"\8  @a ! g !Pv%88  @ߒ!` ! W !`f%88  @ϒah ! G !hV%8M Hap!@8ND8 !x3 !C%8;@""X&H <'@5_!>`` -!@ת )D!@쓒a !@aL# ! c  , (, ` - $@n L2  , L# @DJ? "۪  '<"!D&HҲ?&Hϲ ;""T;""P&H ';""L<"!H<"!@`<!D@  *`@`"@4Ґ <a8 ;"$"a8#a8  ;! 2;@2 b€!!D#  !; "bP!aD V  ';!+* @@a * @@  ` 쀣 /` # *+@ '`* @$($(1 ;"P (@!!@ ` `(@ap`@3zD  $;;!"b(  !@ ` 2;@!;",  @4Z 㿘';%;$ ,  j ?#`*` @3T#!a* * " @3I*aℐ " * @3?a"@$$℁POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿐!! !"a ";"";"";""xN - +; "b|;""| @0Đ# ;""|""|;"x ";J ;"| .!!;";"@  !!;> !;"!!@ ;""!ᐐ "ᐔ *@J@ -J` ;""!!!'* @@ꊒc( !!! ;";"@ $! ; ;;;b ;!!";""!"!!! *;";"@2#!?@J@ -;J` ;"| !t?"!#!o 'J  -`? @;"bx!!* @J@ -!;J` -`"x ;"xL@ @`="`L@  @ `);"x@$@ 2"x@2$@2 ' `!!  !aM*`@  H@@ c0!;@2"x ?"x!@$"x "j!"L@ + `!J"a!! *`?J` - @M H@ cP !;MJ@ H@ c!;@2c"x"x ?@$"x %!;@ !"*`@!"!!  M*`@ H@@ ac!;@2A"x"x@$"xN : ? :!;@25"x"x @$"x'`  "@ `!!* @J  - ;"xJ@ +!;!! !!* @J` -2 J@M;bx H@@ c ;M;bx H@@ c; "bx!a ? `"a!;"x @`$"x. :`@ܒ"xJ`!a "a`:2J!! M H` @@ !"!9 ? :25. J :J !!("! !!a" "a!@`!! M H`@@@ !"!N :  ? :"*`@!"!;""x. > 㿘  ޚ 㿘U%H D  \@X!  " & ,@    &  ( & (    *  & "@"@4& & 0 & " 0"  0"  0"  0"  0"  0" #& 4?& 8&%<&%D@ memory exhausted8@ 0Ȩ%D`@ @@` `'Ȁ '  ,`$ :% % ``  2 2  " 6 @5     &  ( & (    *  & "@"@4&   (& $$   " 6 @    &  ( & (    *  & "@"@4&  & $ 1"0" "  "  "  " `  "` ,`" , ,   "" `,` J   2 ` ? `  *`  J "`c,`   ` ?*` *  ,` 2T `  *` *  K,`J` ? ;* `*    1*  $"'*  ``*   `$"`*` `$"`$"L  ?*` L : `?* , *   ""  @  ,*  %@ , & ,` 4@&& 4` 8@4& 8 㿘   @ "` &@㿘 ' `" `"` @" :2 "` "``2` " 㿘   @*.㿘`2@  " `   `  @" :  2 @ 㿘     * &@㺐 4     7*@ $ 7  ,*? 6* , 2` 0%D 2\ 0   4" 6 @   &  ( & (    *  & "@"@4&  0 &%< 4? & `%< *@ `  4 %< 7 @ " +  4 &%< 4 &%@6%D% 4$ `  `  4x? ``2   `n?`h?`A@  ; * &$&@` " @ @O@  `?? " @O@ `"&@&`2 J   2 #\`"#\ 6?#\#`@ ? " ?$ ? ??㿐#\#`  @@'D'H'L'T'X!`! ' ' ''Ժ`` g' ''  J/```c ?#`'А`c ?#`'̐`c ?#`'Ȑ`c ?#`'Đ`c ?#`'`c ?#`'`c ?#``c ?#`'`c # Ђ` /'̀ +Ȁ`(Ā %#`  ` "?X`LTX? 7?0#;#=#. İ  @! @!@ "@ `T` LH L'H'T'LLH@T'@''L"L  X@HL"؀2 "Z\ 9L   H@L@@ܒ `?`@  ܀` ''. @! @ !`"\H (ܰ \Б. @!̰ @ !\`D 2` 2ܑ2` " ` 8 @\  @\@ّ* \@ `@ԑ*`\  B! `?D`* @ `\\` :@! @*`\@ ``@*`\   ! ` ?\@ X`"`܀LH$$"@H L?̔  \@86\?L\``" $"@  `H @"@L"L#@ \ `  H@"L"# ư \@ܖ?\  . "@"  \X$L&"H"`#̐ `*`  + 0 1 2 2 3 4p 8P 9 :8 : G @ @ < : ? > @ B8 C D D8 G HD F F D| EL `L ԤI @?LL ڦ?@-`@  "@`D` @ Ԁ "L I D` Ԁ " L I @ @-`@  "@`O  `? Ԁ`" @ `* @ 2`  `: 2  h@a-`@  "@`' * 2  2 @' 0* * * @ *  2    @ ! Б*  @ *  *` * a  *  2    @ ! ̑*  @ @*` * ? ` * 2  " ` !! * 2   2ؐ ' ` '䀢` `  ` J` @* `'`'䀦 '  2w ` 2s ` @2n*` 2` *@ Е*@ ! @ @& !   `' `J * `'%`"*`   $)!*`   "@['쀢* h#`@)*'耤 * '"@@ @+``Ѐ@̑*@ "' *"'*  "'*`"`'*`"`'*" `'* `"#' Б*@?L @   H@  L @  H*@ L@ `? ̑*@ܩ*@ @@ %%$4Ԁ` @+'@' ¢@ͦL HDT 2LD`2  D  D 2  `2LN ` D` NL HCT >L * %`"*`   %3!*`   b@N'쀢* h#`@*'耤 * '"@@ @+``Ѐ@̑* "'@ *"'*  "'*"@'*"@'*`" '* "@'L * '؀  ؐ`' ` ؀@  @ 2 % ` `a %`"*`   $3!*`   b@ '쀢[* h#`@*'耤 O* '"@@ @+``Ѐ@̑*@ "' *"'*  "'*"@'*"@'*`" '* "@R'L * ؐ ?  ؔؐ* ؀6  `D  /` 2.`  '        `? `*  @ 2`  `:  `?2 ,  /,''* '*`  *?'* @*!?'* @"?'* @ "L * Ȥ%`"*`   $1!*`   "@ '쀢q* h#`@*'耤 e* '"@@ @+``Ѐ@̑*@ "' *"'*  "'*`"`'*`"`'* "`'* `"'%`"*`   '1!*`   "@ '쀢* h#`@N*'耤 * '?"@@ @+``Ѐ@̑*@ "' *"'*  "'*`"`'*`"`'* "`'* `"'L *  ?,> ,, ,L * ?,> ,L * ' L* *@> *`L`HT`Ȓ@;"N@2LO?J `?;"N2LO?J `?@L`HT`Ւ@;"N@2LO?J `?;"N2LO?J `?@s؀;"N2LO?J@ 2L`H[T`Wؒ@;"N@2LO?J GL HT|xT u@;"N@2LO?J g;"N2LO?J@ RP;"N2LO?J@ 2<@4-`@  "@`);"N2LO?J@ @-`@  "@`Ħ@`h'*  2'* '* '*  ?'* @* ?'* @! ?'* @ @ ؀:(H    H H ' J *  @' @ H   ^؀([Z ?㿐 U' @ A C`' `J * ` A' ? @?*  8'  `' `J * `' ? J? ?*` @*   ' '`& @/*  "   㿐'  @*   'J  * @ '  㿐@'  `^'Ӑ ̓*`  N< N$ N$ N$ N$ M@ N$ N N< N< N< N< M N$ N$ N$ N$ N$ N$ N$ M N$ N, N$ N$ N< N< N< N< R, 2`0** &%*J  *`  ' #'`' `J* `'' ?J`*  ' * 2      ' $@ @J`J  2  㿘*@ * @@ "!\̒!b`* @No previous regular expression㿘  !;;# 2* 1'"# #@n Ȁ  $# $`@g! $`1 x!;# @@ @$ !\葖!b`* @㿘@ɐ;#   : 2 㿘"@"&& & "& @.! & ;  MI     `*   + & @ ?!   @*@&  *@ 6 `*` @x& 2 " h@j  2``@ ' ' ' ' ' `' ' *  * @*@ 7  * * ''.@'@쀢 '`&   Ț     * & & @@6 Success㿘 !@Q"`.  Ԡ"@  @*?@r㿘 "&@&&   & @&  *@ `& @w & gfgrepfgrepgegrepposix-egrepegrepggrepgrepdefault㿘} memory exhausted㿘<!D  ;#MI b    *   ( <!D ;# < "a,Ր @F 㿘<  T E T<'<)< "0!, $0@b. "! 2<!<'< 2,@G " 2<!,  ^\(\(^\|[^0-9A-Za-z_]\)\(\)\([^0-9A-Za-z_]\|$\)\)$㿘P+<!D@+< "<Ւ < %<H <!@ B@`2բ bP)<,@!@   bX,@bX `,` `,` `,`H Ւb`@ @@@H @Ւbx@  !@   ,@ @*` *` *`@Đ@ @^((^|[^0-9A-Za-z_])()([^0-9A-Za-z_]|$))$㿘<!8@c  !*!.ѐ#<!D#ː!<!D!ź<r "<O < Ԑ%<H <!@ >@ `2բ bP)<,@!@   0,@ 0 ,` ,`H ֒`8@ @^@@H @֒`P@ !@   `h,@`h `@* `*@B@_ 㿀7<<! ?#5<-M<!, ($ ܖ谒  @[$ " ?8N?<a0  @ഒ  }䀢 ,@@ ഔ  q䰒 , @0$ " ?8N?䀢 n$@ $ ]@`<a@`"<!H V@`Q@<!H G@`@J? ?@  _8@ N@  _+ @ @$`@`$ C$`@"@``@ P` @@'㿘!<@@  N@ !,`@*N@!,,&@ @ @*`@ <!,  㿈 d'< %M,$ 谒 Y<!@  N? 2?  A N 27 ; <!H 5-* J  @  2 `_"   J  @  2`_,Ⱆז ,   @@%&@    &N? ?8N?㿘@㿘@? @Œc `@h@!LN ' /@#` /?"``#* $#@ /#` ?"`#* $#@ @ 2Nհ N 2 ?N /"? .@ /"`? :N`@  @p@m @"@ư ".@/@ usage: basename string [suffix] 㿘M H@ka@x 㿘@aFfh:t:vonly one -t option may be specified.nfs㿘@d @8X5خ"-< +<)<# '<@ʔ?V? 0O*  cx c c c c c c c c c c c c c c c c c c c c c c c c c c cp c c c c c c c c c c c c c c c c c c c c c  %X%adc, %!`"  @3b@c,$\@u= @*` @   <@c<!`  "  @"@ "@@  @\@ 2 `@ @/㿐@)  2 @eA  %ْ,` Z@Ţ L "@b < " @, L 2 %s%s: not currently mounted%s: not a directory or special device%s: unmount from %s Cannot MNT PRCBad MNT RPCx@5 ِ!p@ܟ  h@֔ 21h @Δ )h!!x< @  @h h!x@ ِ @h  hِ!x!@ @ ؒb@@   <@ @  ,@A  @,@ڒ :   ,@@ :,@ <!\ ِ!@}<!X 2g !<!d@6Ԑ hِ!p@ 0Yؒb@@ؔ  2S O!d@2L , @   /7  @ ''?'\'`'dab `@\ @|!( @$ 'x'|'`'d ۔ #\@  ِ@^a   `@  @ getmntinfo㿐@(G   @!7 @64 ``@Č `  @ p`< L2`@v L 2`  @ Z`< @Ҡ! 㿘"  <!P`?@+    <!P@ empty type list㿘  N  n @1c( ] 㿘M H@ߒc@ a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrap㿈@γ/!h+E# )E 'E%E@?5? .*  c,%b8%"<$$@c,""c@c,""cxɐ!= @& #Enb8 @`* @E"a E"b, E'""D ' ' ' E @r ? @\Ȓ`(  `0@,  " 8 @$b8E! E!@ HE",@ XE"D@ hE"8@ x1E"8@-`@ "8E""<@$`8 "8@`  E "b<@*ߒ`E",@袒 !E@ "D @. E "D@\n`!@ @ِ @ΐE! 2"@"D @*`Ȓ @   "D@\K` "@3  b@\>`@.@R耢  @\1`@ nlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x 8#"cP@ !@   cP  "   !`@ 0@d  @ @S !x@0gȔ  D@) 4, D, 4` @< 2* @ *  @ؒ  !@0F@: Ȁ̀!@{03@АE"<    @!,# >?@?# @! a ?@ ?# @ ?M@`2H?@ ?# @! 2 6@@! 1? ?c @ ̀@2 #@ @ ̀@? ?c @! @"  @ @! @# #?? ?@ ?# @! 2 4@@! "/? ?c @ ̀@2 !@ @ ̀@"? ?c @! @   @ @! @2 ?@ ?# @! ?a? ?c @! @ ?+" @ @! @?!" " ? ?c @! @  @ @! @##? "? ?c @! @  " @ @! @" " "cP`E "4E`  ` "0E "a! !ؒ  "@H@#@5 E E!  "@"(@E"< "@"X"` @"p@ E"@"#X@"@!&  & &@E"< `  %s: devread: lseek%s: devread: read㿘. >@Җ  @"b@Yܔ@  b @YҔstatfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect block8@=  `@Y}@ϒ %" b@Ys DE!""@"##E"  b0* "@b0E"@'E b@'ᜀ "@Jb0 E)E%c"4ᜑ* , `"@5 b0 cE! @("0Ԑc@   c@   c@'u@W  c8@Y@  ax@Y@n!=! #H@ 0  @'McX @L @   @,@   @ @9 x `#x 0+@  d , @ xEa*  0" 0 :`@ B @8 E"@ E b@' "0+E"a #@( (3E+䀤b4 d*@,`ᜀ`"b@ ` `  쀤+Ea @w"@a #@nX 0# t@  E-E'䀤4 d*@,`a`"@O `  t@ 뀤E! @=" b@& 㿘@kroute: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] keywords: get, add, change, delete, show, flush, monitor. 㿘 !MM H@ha(!M H@baH@^a@k route: %s: %s 㿘M H c @Lb b @E!@Р"(@=@J nqdtv/dev/nullsocket㿘@E / /#8+G )G'G%G#H@ԧ⠀?)? "*  %b%!$$$` Ր= @&* @@H@*"`HGa` "" @1 G  @Ӕ G"`G ܀ 6@z"@ L@ ?`(F *`  4 4 4 p , d HH" @ H" @ϒ  @ 0 @K @ must be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) route: write to routing socket: %s got only %d for rlen %-20.20s done xH    "# ِ!G @)N i e`@J@ -`@ K`?`&Z#4*`    0 G ,"adG ("adG $"adG  "adG "adG "adG "ad # #M`H!@X"H@Œ"p@W0O@ ' ''' ''  ܖ @ 6S!܀ "G@ 2G!ؐ  @Қ 6:!ܬG ؀  @"G!d @"0@`V Q)G+b ؀ @@ `,>G!d`H `M 27H 22 ,`G $`@@@ G!  ` ؀ @ ` `L@E@@ʐ @;@Đb@"@@  @ EH `#8 .` Q(H ?0  *@ ` *@`*@`` * *E"Hdefaultiso %s(%d) %s㿐#`L F"`L 8@4! F@’ . @L  F* 8  2  #E*c8#  c8*` *` *` *` *` *`|*`?`k *`  ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (   '  # G" ` @2ޔ  @@d .  F@`8 ",@`E#8@v'@h (, @H&@"@Ր !E#8#@Vc!@Ҕ1E!E#8# /c!@Ö1E#8af %d: %s㿐 ?`n "*`   D D D  D D D D D D D D D D D D D D  G%#" 2!  0?    ??   2:@` 2``2 @  2  F!8'@u@ (, @&@5"@N !F!8#@Ϣc!@K1F!F!8# bp!@<1F!8㿐 `"J *`  d T D t G!l G!p G!t G!x G!|  G!  G! @G! GGb `"G! GGah "ahGa 2"a@$0%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway %s %s %shostnet: gateway %s (%s) not in tableentry in userouting table overflow: %s 㿐"0 (H '  "# !@N gG @& ?  'G%# /H `@J@ -G@ `? ,* @ | H $ ` ( (  @ H T 8 t   $d $4 $d $4  $d *$4 $d ,$4  $d$4 % wdG"!G""G`Ԑ "``@ @@abh?2`@ ` ?2`@ `~ ?2`@ `u ?2`@ `l ?2`@ِ ` @@G@b?2`@ː ` @@9 Ga R"a찆?2`@ `@jG?@ B?!    @7  0@8 ?G! @@0b8  "@bH@`% % G! 2%@"x@}"% @ @? 4`G Ԁ 2 G!쀢 2 ``H "` 3 'G%G&c N@! c 3 2Nd 2NM@ 􀢠"N`  `"` @ &c N gG@ ! `/# """А @M@  "@  G!d  G!!|"@  @" `" `7`"0 "0 "##@@#0 G  '  ? ( ?* ??* ? *  ? ???"`G"`(*`J` ` H  *@Internal Errorroute: %s: bad value pGad 2G "ad# "`4Ga?F"a#*  h GG ag! ,GG ag!,G!H TGG ag!8 ,GG ag ,6#`# `7c@, 2G "*,   0>  0; G! #!2 ,!d?`!*`  D t 0 #Ga @S ,  # V,a4  V Ga4  "a#@@ 4444 4 @h4 ް  #Ga @! ,  ,a# b b ,  , ,  Ga,  "a#@@Z ,,,,,, , , , ,  ,〢@&,  @@   2   ,@J@ ""@,@ђ| @   @vrp ,,@i "&@ /   @@,@? ` @ 2,@@? 2$G!쀢  $'@Ԁ  8 @q? G Ԁ @   "  % @,r '& ,  @{  M Hcp@W@d G G: G?(*(G (ᔁ *.**.0x%xany*0x%02x%02x%02x%02x%02x%02x.0x%x0x%x.%s%sH 7 7 7 7 * 7 777* #+  # #,`2 21F1B""8@2b0;# V@\  #" P@R  "   b #\   `@ #`,`2 @b1F/1F"8!2@;Ё*.0x%XH%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sx / / / / / / / / / / / `/////?#7 @   # # 2#21F1Q"#j@`0J# b@Ҕ  #*" \@Ȕ   "#G `   `#\   `@#`L` 0  :  K 0  G @l`1F* 1F#j!2G@`actual retrieval of interface tablex ' ''' ''  ܖ @I 6!܀ &@b 2!ؐ  @0 6"ܢ @*@ggot message of size %d 㷘G H "@א 'G%ܒ@(@S@g܁uwriting to routing socketroute: read from routing socket: %s 㿘G"T "#  @"L a c  g  G8 `    *` Ga*8 "aG"* "  G!G* `"" !G" ahah`" $`" (` " ,`" 0`" 4`" 8`" <` " @" D`$ Ga" H" @! G ! ?   Ga @_G ؀ @@`G! G ! ?   Ga@CG ؀ @@v`G! G ! ?   Ga@'G ؀ @@Z`G! H T ?   H`T@ G ؀ @@>`G! G !8 ?   Ga8@G ؀ @@"`G! G ?   G`@ӔG ؀ @@`G"$@G`؀`2"@PH 28 #G`ܒ@O  @ +?) 3G1Hܒ@U"L  ``@` @܀  # #M`H!@ Д@m @ Gᔄᔐ (ᔒ?J 8?GWG .p(ᔄ"( nj nj nj nj njGG 4GGᔄ @G@*@G Gᔄ ?  @ *G "(RTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %d, seq %d, errno %d, flags:㿘G ؀ D `#@ސ!0;  h*` @Ր!  "  2  @ɐ!L## @X @ T0 @!L## @ @ 0   @"L## @ݔ@x route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: 㿘 G! !#X@A M H@͢a0M Hcp@͘   !M H#@c @͋0 - L  % "  " `     2 ` 2 ?` @` ڀ `` `,` !W#@ #Gb !#J$b@Ӑ$b    !;#@Đ"  @@ L## @ 0@`8 $  4   L@ $  8 L@ $  < L@ @#@! $ `@ L@ D#@! $ ` L@| $  , L@t $  ( L@l 0 " $@  0"@& 0 $  0   L@YG ؀ " @'0?H@L #Lc# @} ?`$ c * $c @ locks: inits: 㿘@)!#Lc!#  $@Y@! @R @  L sockaddrs: %s㿘`A@ !#Lc#@: ?`$ c * $c @@ #"a@a  ? @ L`?"` * "@ L@А#㿘 @\D>@ 6  , < ?`&  @  * & @ !  ?`&  @  * & @ے 4  8  ?`&  @ > >* &@㿘#"` "@ "    %s: link %s; %s: iso %s; %s: inet %s; %s: xns %s; %s: ipx %s; 㿀 ?`c*`!  Ռ t t t լ t t t t t t t t t t t \ t t t t !@ ? !@x 9 ! @j'1 7 7 7 !7  7 @7 / / / / / / / / / !/  / @m/@ْL@ڐ#㿘 @@.@ `#HА *`: ?А *`: ? *`: ?ɀ`2    ,  l x d ׈ ״ ל ל*  ,`  ***".@$OpenBSD: show.c,v 1.8 1999/02/24 22:56:02 angelos Exp $UGHRD M@dmCXLS1@2route-sysctl-estimateout of space sysctl of routing tableRouting tables x  ' ''' '' ܖ@6@ @@  "@ 2@+ X@   @̚ 6@ h@ @@ ` @ @. @%-*.*s %-*.*s %-6.6s DestinationGatewayFlags㿐!#\!#`!  ؘ @ %-6.6s 㿘 L G`Ȁ`"`@``@T`2 @0)   $ @є    ,  @ b@@L L`?"` * "@ %-31s %-5s %-31s %-5s %-5s %-26s Source address/netmaskPortDestination address/netmaskProtoSA(Address/SPI/Proto)㿐##\#Xc㠘 @ncInternetXNSIPXISOX.25IPsecAppleTalk %s: Protocol Family %d: 㿘?`9 *`  , ݀ ݀ ݀ 8 P ݀ ݀ \ ݀ ݀ ݀ ݀ ݀ t ݀ ݀ ݀ ݀ ݀ ݀ D ݀ ݀ ݀ ݀ ݀ ݀ h ( 8 @  H  P X ` ` p x@ link#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s   Jx  "5 G E      2 ` @waX ` ! ` `  J@)'!Ȕ@@`  ``;x@두7 `1!+Ґ'# z a@9 @'#@@-`@ @a@%`@ xG!@y0" "@p0" @ip R  Ж :*R@"` `*`R@ 􀢀 *@LЁ/%-31s %-5u %-31s %-5u %-5u %s/%08x/%-lu pؐ  L `@ t@g'Ԓ@ @t#`@ ` @g'Ԕ @w   @@Ē @g'Ԓ@g @Q@` ` @go'Ԕ @V  @!  @g^'  @xresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1osinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoipxinetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpireencapdstdeletecloningchangeblackholeadd㿘 @Ҕ * .` *.@N p r h#  p p h r .`2 ` .` N p"N r"N hN , f N ``N , . :2  @Đ6`.`А 〤 ,N  N = ` 6`N`*`,͐@3``6`N  V` "6`N  V` ```* N`,@N  V`  `$6` J\2 J /7$    *@J  ЄЄ* (8 ЄЄ **8Ѐ4*@ *@㿘@0/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %s㿘 !!S @@ђc###`#!3`@Ò#  cS @;#)Q  #S cS@ƭQ9"#D#` #`@ "  2` 2  S `@ƑcQ?"cD  J @ 7  @ 2   S@|  X""Q"#tinternal error: unknown type %d.㿘Q cd Q#t8\! #`""cd##` #" 2  !@j02\J`耢 `@  @  QQ"#tQ"#dtype㿘$` #x"`@ 㿘$` #"`6 㿘$` #P"`, We only support %s mode, sorry. 㿘S \cx@Q?"cDWe only support %s format, sorry. 㿘S Sc@۔(Q?"cDWe only support %s structure, sorry. 㿘S W`(@ĔQ?"cDlocal-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPE㿘'D'H   'D` &`D  DH@:H D  DDH@:= D  HH@S @z` Q  @;  HQ?D"cD`H`""`HJ a S      \!4 H@ H"`  S! H@m H"`H  @  @!H @@local-filesusage: %s local-files Continue withmput%s: not found`'D 'HDH@9  H@S @bQ?`"cD H`\"X @"'W@"XS !X%M'I#WH @:  >N "$" H@;  HX" -J  J  @  "J  /@  ഓ*`@ `* **  2 \!4 S@ S! S@ S    ؀  b    @ M" HS" Hb #c @:$b " $"$b D %X-\+S#WȠ \!@ J DH@@:@ D4 H@ a S@f S    H  b  @  zDS" uDb #c @:L$b  $e$b  @ ,,H @ HȀ  H@h# L I`D >H@:" 94 "@ aa S@ S    @  b  @  2 S" b #c @9$b  $$b 2@DM @. X""r+w㿘 @(w㿘(   @!!8@ usage: %s remote-file [ local-file ] local: %sRETR㻘'D'H  'D` &`D  DH@8 D  DDH@8 D  HH@S @Aa Q  @9Ő  HQ?"cD =`X" 8 `J  M"J  @  "J # H  /*  MI b@   *`@ `* **  2 H"`  \!4 H@ n H"`  S! H@  H"`#H @&  (H @g~!(@(: H @9ɒ     H`!`@ @"|(  : @"@/㿘@= S ?`" * " @zp S@% X" S" #\!W`#\"  a0$" @8$a0 $" $a0W"X@Z $a0X""W"X@S remote-filesusage: %s remote-files mget㻐'D 'HDH@7耢  H@S @FaQ?"cD H`\"X @"'W@"X3X%M#I!!8!WHS`@7R fN b&b H@8Q HX" N`   `   `*   +@J`+\!4 S@ o S! @   "   @! b HS" H#b"  @8$" b &b$" @K X""onoff Connected %sto %s. and logged inNot connected. Connected for proxy commands to %s. No proxy connection. Gate ftp: %s, server %s, port %d. (none)Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT cmds: %s. Macros: %s 㿘S  ?S   " Q`@ SS @yz S X@' S   Qc`S @a0S @yb!0@' XS"`$HXbJ` !p\ฒ@ǖ Q+S#h!` !x@a\SS (W`@bQ#d!`!\!8W" \!@@S !`ޠ!S @W"!`Ϡ" @~X"!`Š"HW"(@o\!4  `bhQ\@c S`@xߐ"S!  YS bW@P\S @xː"\)S!(! "W"\`@6\!! }#@,#Sb  @x#b Q'S ( @` (Q"#Dusage: %s [ on | off ] %s %s. 㿘  `? & `@ے`   & S`@ϒ` S & @@ߒcP? S!`"#h@ДBell mode㿘\8PQ"cDPacket tracing㿘SQ"cDusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark). 㿐  \!( `?7"!(S @&``@^` "'\`@W` 2`\"!(@ #@J  \S ``@VQ?!"cD" \ "a(3\1Sa(! !@Ca( \` @:a0 @w!Ha(Q"#DVerbose mode㿘Qd"Q"cDUse of PORT cmds㿘\Q"cDProgress bar㿘WHQ"cDInteractive mode㿘W Q"cDusage: %s [ on | off | gateserver [ port ] ] %s: bad gateport value. Disabling gate-ftp mode - no gate-ftp server defined. 㿐 S @5cЀ  X" `??"" `@` 3  `@`  X*""!H`@& ?#@J  \S ``@Q?>"cD2 !H `@x , X""X "b!X" X" "SJ  XS @i` $"XS"`HXbJ` !p\ฒ@P X"Q"#DGlobbing㿘\@=XQ"cDPreserve modification times㿘W)Q"cDusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). 㿐  S @@bQN?+\`@` 2`\ $"a @ג` 2`\"! @q SJ  S `@ےcQ%?\! `?"! \! QcX cX ?"cX#\Sa !` #0a @a Q 4  "cDremote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %s㿘'D  'HDH@2@ HD  H@S @}`Q?%"cDH @( ``Q#D!`Q#d "HS @u H @!(`\ "a,usage: %s local-directory Local directory now %s getcwd: %s㻘  ## &`  S @@3b0Q`@3` Q?("cD@|`  `@a͐!Q?"cD@4$  S bP@Q`@a"hQ"#D`@usage: %s remote-file DELE %s㿘'D  'HDH@1 HD  H@S @cQ?"cDH @#mdelete㿐'D 'HDH@1耢  H@S @aQ?I"cD H`\"X @?"'W@"X3X!WH @1Ӕ -N b&b H@2Ғ H#@Eb HS" H#`("  @2$" b &b$" @ X""from-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s㿘'D  'HDH@1  HD  DH@1Ȁ D  HH@S @=aQ? "cD @! H @!-usage: %s remote-directory local-file dirLISTNLSToutput to local-file:㿘   &`   "&`  S @@bQ@@&c ##`b@ " `@2r` 2`Q?2"cDb@  `J |@2]` `@2# Q? "cD8` `@ S@V `@A@<usage: %s remote-files local-file mls㿀'D  'HDH@0O耢 HD HDH@0C  DH@S @`!QH*  ?b'"?'@ HJ |H@1 @1# HQ?\"cD@`' H`\"X @"'W@ "XXb 8  #WD?1  a w/耠##. H   @" 2 S" ""b  H$b @@1T# " $"$b " ΰ @ X䀢@""@ސ SHELL/bin/shsh-c%sTry again later㻐 @~  @z @; T @   @l  @i @#x #@8 / " -/ #@/@c  +/\!  !S @s5 @" @H   \D@7 @7 #@_HQ?"cD@ᤐ  @% @ @?Q@_1#Q"#D"#Dusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. H'D'H  DH@/D?  H@S @DaQ?U"cDH @!Ѐ 7 D 4 H@!HD"`'DH @ې!耢 # D 4!S @r!@ճ  OL@ @?,HD"`  'DH"` @` S @r"0` SD 2 ?H @"S?"`PWDPWD command not recognized, trying XPWD. XPWD㿘#Qd @"d QQ#D!2 QS`@rG#@v Q"#dLocal directory %s getcwd㻘@0$  S `@Q@^R Q"#Ddirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %s㿘'D  'HDH@.0 HD  H@S @maQ?"cDH @!0 Q#D!Q#d "HS @q֐!8H @!hRMD %sRMD command not recognized, trying XRMD. XRMD %s㿘'D  'HDH@- HD  H@S @%aQ?"cDH @А"P Q#D!Q#d "HS @q"XH @"command line to sendusage: %s line-to-send 㿘'D 'HDH@-p DH@S @cQ?"cDDH@."arguments to SITE commandSITE㿘'D 'HDH@-z DH@S @cQ?"cDDH@ @㻘@#`/ @߆ #,   .  $@ @ /@o/#@8 @ modefile-nameusage: %s mode file-name SITE CHMOD %s %s㿘'D  'HDH@- HD  DH@- D  HH@S @DaQ?"cD  @!ЁSITE UMASKSITE UMASK %s㿘Qcd "cd""@`Q"#dSITE IDLESITE IDLE %s㿘Qcd "cd##@`Q"#dHELPHELP %s㿘Qcd "cd#p#x@`Q"#d㿘!S   @@     @@ QUIT㿘#S`  @ !\!< "$!<@$!<$`(?S "|S""usage: %s [password] Account:㿘  S  @@`Q? "cD2 `@ @P"㿘@2 S S@ S  Q "c\Q"#\@ W"0@k commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. 㿐'D 'HDH @,   HH@S  @MaNQH@$m ? '!S  @o!@ Qg"#D2 J !S  @o!@ 0Q  W!S  @o!@ҽ $Q@"0 2Q  @ܦa@= J S  Z!S @o @ҟ @+  @܎Q?)"cDZ# @a  `@Ӡ"@ŔDH? €`S  Q "c\Q"#\@  @cCase mapping㿘X Ė8Q"cDCarriage Return stripping㿘W (xQ"cDNtrans off. 㿘  !Q!\S $!4 @o! !4Q"#D#\4 ` "4Q@"D , \ *! !\! `@{ ,  H\ @   `4J`K@`J)Q\    `JJ2 @   @+ J`2  +  Jߖ +H!Nmap off. mapoutusage: %s [mapin mapout] 㿘'D  'H!SS $! @n"!QF"#D  DDH @*є D  SH@S  @bQ?-"cD "!Q"#D\!D@ޒ S``  L " \"!D@ϒ ,Y##\aD@ LL " W"@֔#nmap: unbalanced brackets. Y#    " ?UK P ОJ I $ \2,JJ*(: J 0$#JKJ@"!J?ϓ+`   @  K  J*`: +` K  +`#K@2 K 2 J 2K   IK +`" I!*!WJ"`" MІJ [  \ $"  2 J Җ J $2kJ "  "dJJ 0?N  @+`J@  ] +`@ Y   +@  J :  ]A \ $62.J "  "'JJ 0?N $ @+`J@  J+`@ "J  +@   J  + J` `,* J  J*`:  ] \2J 2J  J >S  @m6 0BJ ,f ]"2b"  "' J 0?N   @+`J@  +`@  @ " +@  + J  [+IJa a Passive mode㿘QQcd`#h ! \Q"cDStore unique㿘S LQ"cDReceive unique㿘S <XQ"cDCDUPCDUP command not recognized, trying XCUP. XCUP㿘 @ ڐ"``Q#D!`Q#d S `@l" @ Ő"В`\ "a,restart: offset not specified. restart: invalid offset. Restarting at %qd. Execute get, put orappend to initiate transfer 㿐 S  @la#`0`@j 1(> #"SJ S  @lJ#0  @c> SYST㿘 @ l Limit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. 㿘'D#Sb 'HS    DDH @(؀ D  WH@S  @Z`Q" "HS  @kѐ!Hb  * * S@;b*` * * b*S" $ S  @k!@Q~"#D"`$Qx"#D@ *`* *  @ "` SS *` *   W" @.!L#Lc   ? $ @wc  $c?Ƒ. :  .@*` *  @""N .@`@2 !L#`? &`@O#  $# ?2`?S`?  &`@:  S`#  ` $#S  !h@k7Q?"cDfilenameusage: %s filename %s %qd 㿘'D  'HDH@'P HD  H@S @`Q?"cDH @)7  ?S" Q H`@uQ"#D%s %s㿐'D  'HDH@' HD  H@S @W`Q?"cDH @)S ?'S !H!`@dt@hh@=Q"#DSTAT %sSTAT㿘 ""@ `Local file "%s" is newer than remote file "%s". 㿘?8 S ``@ bPAGERmoreCan't allocate memory for $PAGER|%s㿘'D  'HDH@& HD  H@S @` QH @(f  Q?;"cD@#` #h@د@.  2 @cpc@i!)Q%('\  #d (%#d H$(@x<@2< <H$( @%#d@'?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenameregetrecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitdisconnectdirdeletedebugcrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. 'D'H   DH@%xȀ2 SH@S "cSb @S S H @ "`@ S"@0H`S c@Q?"cDZ@fcS ,`@*`@` `Ѐ`5M/Z,%S-Q  2 NP*`:  $ \"A @ @  %*`     *, @*`: @  D?"?H,  @fH :  i2 DH@fH@@.@`N 2 N @y.@S @@? @h O%D2L   S   Q 8@h?:%DQ#d  Z@hv@c Z#S` €@\!8 L  ` ?"``@* "@@g @f80@$S Z#@'D'HS`,`*   2 2;`D$SCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %s-Can't open %sWriting %sReading from fileSuccessfully retrieved file. host %s, port %s, path %s, save as %s. Invalid IP address: %s%s: %s%s: not an Internet address?Invalid port: %sCan't create socketconnect to address %sTrying %s... socketconnectRequesting %s Requesting %s (via %s) GET %s%s HTTP/1.0 Host: %s /Writing HTTP request200Error retrieving file: %sContent-Length: Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %s ?'?` @e@?h ?h @`?h`@w  ??h+h`@w   ??h ha@w    ?h  ?h@ha !@F /  L 2 , X!(h L  J!PZ?\ @ ?\ ?\ ?\H  ` (!x8P @d?` ?`? @a``@w  ??```@w  !?``L@  /!,@Ē / ?L 2,?h @, '䀢?!@R~0?c @?2 0??QQ:P?\@b ?\&@!?d ?d6 ?uLR#?d ?#"@Q@j# |? @`?c$ Z  :c? \`#S @%R:`?#@E H  B>?d@?_ "\@\!( W" ` #?"``@* "@@e$ #\ :঄ D `(`@`0\!( H`W" C`Z#`#<`  8`\ : Z# #2S SS ?`"@ # #* "@dْ S ?`" * " @dɒ S@~ `@Q"(0@$ Q@~ : \, !  Sb`?\ @Ø @Ӹ  / @Mb   @r쀢  "@ 2  #!@q"@QA0 "" @Ұ쀤 SL ?cp@z ?#@J " S 7  @l '䀢?- @Q"0t?#|@s˔  9 1  +@KZ&% @P" `$`@_S`@KH&@8c@;  @- '䀢 @Pؐ# 06@PԐ#(02Q#d ?` S c0@ ? c@@ ?`?#@#X#x# @q?#@@Ԑ@Ѣ@P#0 @@ѧ  N    ?#@,/@} ʰ c@Ô  #’ @ҫ @v  N   2 ?   ?#@*J@  %I!*  R  c2  #@t  "N N 2N & @}L ?cl' s *@x : Q:#P#P`#Pf  b?#lJ [?Q??:P?\@qb ?\&@!?d ?d??\@Oא"05LR#?d ?#"@Q@#  ?#@  @ @Н 0 @И`0?c$ Z  :c? \`#S @"Υ:`?#@ H  B>?d@Й?ဢ "\@\!( W" ` #?"``@* "@@b #\ :঄ D `(`@E`0\!( H`W" C`Z#`#<`  8`\ : Z# #2S SS ?`"@ # #* "@bU S ?`" * " @bE S@ `@O #0g@", Q#P#P?QZc c`@ QQ#d NS @b#0H#d "?S @b"@?#@@Ϻ @/L?dR#?d@"?`?`@͜?h@͗0 @N 0?\?\@N"0 P@N䀢??@?`?`@m?h@h? http fetch aborted. 㿘@$ʐ !S @bN @d Q#@۱  file fetch aborted. 㿘@$ !S @b8 p@N Q#@ۛ ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.:@/Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd*?[]{}Retrieving %s/%s %s/%sgetmgetp'D'H'L'Q@=#   S    ,@c ,@c@p Ȫ@l غ !J!-S!DSH* @{ : w ܲH* @_ @``@r%   a@r   LQ?H0H`@r  N`L@?707@zג /@p "= N / @2 .H* @M!0@&ǒ @ @p J@ /  倢 :*@ ߒ`L ۠ @z :  .@`@z : L 逤`\,@``L@  @& / `*@ \!  #\#`a(S @@ 7@^S   ''  8` 'N@  ''  % @S   %  @ 2 !X@L06'#'' 꺒\!, ~ \!@@ L@@p=a@  `L @p1a 2 `L@ `''' ꈒ\!, L"K?L QE?#d S` #x @` ؐ$@l !''䀦`'耥  L!' !W" $"  $"  ''  CQ#D@q d ܰ @R܀  'S  ? %s: %ssocketconnect to address %sTrying %s... connectgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt㿈 S"@z  @mg  , !J"@yj !, @u 2 `  #!@5 @LQ?"cD, `` @u!J"@@yJ , QJb"#`S"  @}D 6 4 @K Q?"cD' +Q?@n  : "`0`  *`@F/'$ @K͐ `` `$``@4``S`@F'@ `@ `@} 6ΐ@K p%cD@K i%cD 'S`p@} 6'@K AQ  @|  6@K @a!\$!$@a #\!$ $a<`2Q@Kk!(!$#d Qc`S @a8@ !$ "a<@a< Q@Q?"cD '?c!@|   Q\! @KD!PQ#`@̗ 㿘@! S ?`" * " @^] S@ ((` `"S H@W ---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT㿘'H'L'P'T'X(\a `9" 5S@^!! @>H 2@^!S!@1  2@^"S@S ?`" * " @] S@ 3\a<   @J"Q?"cD' @ˉaHa<@gHa<@^t"8@a<\ "`Đ@b@@'`?(`` ƀ  @g%c%c%c421 Service not available, remote server has closed connection. %s:㻘'D Z#@̯$ @@aH)Q9\7\/S%#D @D!$  !?@<!$   @4!$`(   @*!$`(  <@@<0`D` @Qcd @] 0@ !%#D  :Qcd`Q3 52``/`Y# *`Q#\ ``2 `2 Qc`@E`x`? "`` , :  @* "@@]`M"   #D*` * ?А%#D`#D " `  M"   2  `  )"-@-@`-@ ` - 2%#D "G,DQcd  ? 5`Y# ``? "`` , :  @* "@@\@^`$ d8$!Q#@v, #D"#` 1,\" Đ @2#D!(@(  !H@`" ?П@  ?`@ %#D 㿐''   @z send aborted waiting for remote to finish abort. 㿘@a X""(" !S @\!@ R#@D sentlocal: %s remote: %s -%slocal: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetout'D'H'LW"("b$'Z  :#\Q??;cP Q#d ; ?W"`' LH -S b0@LS b@@S DH@ L0eQ#tX"@"'݄ ''x't'|! 'pR@մ#؀ - \`Ā    Ā 1( | x@?& |x @Pt @J| @DWQ""@<a'x &@7c'|H@ђbP  HLWc a'_"H |2'H @ 'tHa@ '"X@H1x@ t@  |@ QWb ""b#06'@ma 'H@H"`x@ |@ Q#'P@ <  "S H@Gbpx@Ґ |@ϐ @]QQ:P@ x@ |@ȿ t @ȹQ?"#DWt""R@#؀ Qx1(    MD@@b  QD@9b ALQ#t? @(ڔ       P@y  1(H@G"`(  : W1""  "  W  > """  > "'pLD"w 2x@L |@I Wt"" @@"0\"X x@1 |@. Wt"" @%0@hp '@]? @ Qct`'t``  "# 7Z#SP@?$ P>` B>P@ \&@`\!( W" "Q#P ܒ0`` #?"``@* "@@Z #\  : B?   ` @`\!( M`W" ZQ#P C`Z#`#<`  8`\ : Z# #2S SS ?`"@ # #* "@Yƒ S ?`" * " @Y S@k `H@Fx"` # !Q5Z@^u` X\!(/1S 5   `@8-  ` #?"``@* "@@Yw #@- \  : B\!(?  W" #P  @3 ?` @*  @YK `B >?  .`:  *  @Y0`B >\!( BW" Q#P ;Z#@ # S@SSS ?`"@ # #* "@X S ?`" * " @X S@  @H@E"` @  # Z@E"Z??:@ W""@ x@i |@f t"<Z @_7Zx@Z |@W Wt"" @N\ Ā 1(Q?+"cD | @Ʒ?& |@ǐ Q?"cD"ZZ#`#  @  receive aborted waiting for remote to finish abort. 㿘@t X""(" !S  @X!P@  R#@W receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %s'D'H'L'P'X'h'dW !"b$Z  :#Q??;#P\   ; ?Wa'pW'@~<'l`?' !'\Q#d  HXSH -S H@b0LS b@@S " '` DH@L0?'`'X'TW"( @ 'R@ѡ# * \`Ā    Ā !( | X@Ž?$ |X @=\ @7WpQl""W"" @,a'X &@'cX '\H@}bP gHH |cH@f  TSH@h / c ` ` H@D$"`kX 2,H  ! !@fؒ   /, SH@D"`MX S # SH@! SH@C"`8X  # @H  'H)X @H 'H  Q#t  غ 0#tX"@"Lر L@Œ Q:P@  RX@ė \@Ĕ Q?f"cD@Ր# p (   @ " QL "D  X0?D"X @! 'dXXH@|bP XL#'hW5""$HHH |2H @G 'THa @' 'h"X@CYpWb ""bW""#0@hAP 'hH@CD"`p#'`hP@ے  $'!J#@#Jc @@ $c @C"$#$#<  Wb ""bW""@2?Q#t "(  (` h   @P  H@B"`pWl""W`""h0  "# 5J3ZdJ@P Z hP@Ԓ@2    $ Dc<` B\!( >cW" #Q#P d0S ` #?"``@* "@@Uʐ #\  : B?c  c S䀢 S@i d\!( M`W" ZQ#P C`Z#`#<`  8`\ : Z# #2S SS ?`"@ # #* "@Us S ?`" * " @Uc S@ ` #  @B""Z??:5 /H @B "0.   @.h @#8  `  @h? "  h @#"  3QH@A"`pWl""W`""h03Q!Z#1S@d` i`  'd` /!(# 5#   @-d ` #?"``@* "@@T #@ \  : B\!(?  W" cP #dB@<#` h ` h @6 ?` @hh*  @T `` \h?  ,`:  h*  @T#`B u<#쀢  !S  @b   @U"X\!( BW" Q#P ;dZ#@ # S@SSS ?`"@ # #* "@TG S ?`" * " @T7 S@ d @  #  @@"Z??:h @H@@"`@  pWl""W`""hX@ \@ T @@~=d^ Z#`|# x` W W@ W" i`#dL@ ?_'t@c1 'xtxH@ '|?TtS! `@N"@RH@0FpWl""WT"" @e @b \ Ā Q?*"cD@dQ?!( |`"#D@ǐ $ |`h"dd"Z@}ϐZ#`# X  @4 X@/ \@, setsockopt (ignored)PASVPassive mode refused. %d,%d,%d,%d,%d,%dPassive mode address scan failure. Shouldn't happen! setsockopt (reuse address)bindlistenPORT %d,%d,%d,%d,%d,%dp  'Q#h   @qX (` " |@@ ' @V |?"& |Q#X   ?c@qF  6%%@?!%!(`#QcH  !(@5 |?$ |Q"#h$cHS %@S!0!(#\#`Z#%aH@m S %@S!`!(#S` @ ,   ,  *` #Q*` 1(*` %,  ' ,  |`@bW     |cH @?!('( |S pS" p  "" !\! " 2#(`|?" @  @p  $`|@?d ` $!! !( ?c @p !(%@?N!i!( |S`@p͔  Q%@?A!\!(#X  |?c @p  6 %@?/! '%(|S`@p؀ |@?  ;!(@  #\%@?!#\a   ` ` `  %#\  !Ȓ` `a?`$ax  @ ` $a '|  @pC   @>   @; |?`$ |\ "a accept㿀 Qch`'($ |#(`|@w䠒  &@>"@`|?$`| @`|$`| '  @p  6`|@> `|@{&㿘Zc # c2 "# `  @w  "# 㿘@ِ (` "`㿘("  &@ac  S` M!J#  "`S` J#M!"`SQ#`&"  @k .!. S&!`&!`&!` &! ""`"` Spp"` &! &! #Q&!  Q&!"p"`#  c# \a$\# &!$$X Ā "S@ S  `? Ā )А @֔ \!$ R` 3 +`  *  M" 6S(@ - sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. 㿘 !SS ?`" * " @K^ !SZ#'LS" " @K @ $@:㘀  w@D z L@ dƀ`r ,@  -@Kѐ ? $@t  $㘀` Z2W @Z#؀ "SS @T?  -@K!S2N  -@K!S  S  2 Z -@K!0SZ#S` \@"0\!8 " N   ` ?"``@* "@@Jϐ  / 4@sS ,@qc ,@mc܁  /   & $H@J J@`JJ@J@2  "@  " 2J? 㿘QZ#"cxSX""bQ"#lZ"cS " @@ cؐ $c؁!$Q#xS H!$ Qcl H "cl##xH!..n`lh"cl\ DH " FQclQcl  H "cl"cl\ DH "/ ") ( \2  *  H*ߖ H "2*ֆ S* Q xQl 0   l  l\ D %sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s 㿘 2:?@S`S `.c.#.#@ &'b* 3S ` #` L #@ # * *@ @ 0"  %S+.)/'/`@? c @?( @z ? `usage: %s [-adegimnptvV] [-r ] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file 㿘M H/8a  @D @Q macdefmachineaccountpasswdpasswordlogindefaultHOME.%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %s8 /@ܐ"@/"@ #  ?!/@Y>"@5M /b@Hٔ/@ZCbP  "bx # /"@5Az @WՒ! &/@bc . /P/#|#Q'P+SS ;M@d B  0 =@V @YL 3c`@YG .c`@b8 . "@Y= c`@YS$ c`$L @b! . @Y& Đ$@Y< L @    "$@   0 X< U0ސ X@ @ @@q A&@@n6| 2/P0Ԁ /@n-c  xR @G  ?/@  @ː@J 'xR @.  ?/@  @@1 &@F50S P@`x    bS /@H2#P`| *` * * @Axb @ ` ,`` i  ,@+x \b`*`S" % ?* @*`@"` -%b **` *   " b* @*`@W` " "W@x0S*:  ,L? b, W" S 0@G 8$P@3ޒ|0 @3ې#/#P@qQ"x S /@G#PS 0@G  P@3Ð#/#H@3P@q8"x?㿘Px @X  @"x  ` `,5P`""|!P@"x%`"#`\2.@"x. . !P@"x` ` `  `, `\2.@t"x. .PJ| ( !x`!x @l"| "    stringlist: %m㿘@ 2&  2@ D` & @ P & 2@ 9`㿘  @2 & @5*` & 2@ $` * "  & 㿘  `  @ .`@  `@*@@㿘  : , @l 2  * Already connected to %s, use close first. tousage: %s host-name [port] %s: bad port number '%s'. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s asciinon-printstreamfile8SYSTRemote system type is %s. 215 UNIX Type: L8binaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. 㿐'DS   'HQc`S 2<bX DDH2@rD? H@S) X" \ S D $H @[+ ?#@J  H!S 2@bH@ 2b@Q?"cDX" X" J   2@kb*`H*` 2` X" H 2# Q#d XbS 2@TcS " X""Q"#t2 #8S*`#8  `*` *` *` *`*`2 #@S*`(#@  `(*` *` *` *` *` *` *` *`*` Q"#@Z"#W""W "b,2 #P\*`Ȑ#P  `*` *` *` *` *`*`2 #XW*b#X  b*` *` *`*`2 #`\*`#` S!`耢 *`H  @ \! Q cd?"cd2攐#h #Q`Q #@^ @^  SL? ."? ,S 2cpQ@ 2,Q#2c@j  *S Q "cQ "cpX""2 #S*#  * * * * `*"*S 2c@ Q Q"#Q"#p`Q#2c@j 2QS 2@D#Q"#danonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$init0'H'L @'HL|HQ?"cD߰ H L ,`X"Ā & @!  @!@>  'H@@ 24!'H@SX!! H4@x'L4!'H`4!'HH 2H5S'4@  @ܸ@~ 2 @/4a@ߔ/ OL@߫@?.@O 2'H'HH H4}" L L4@6"'LL4n"   4@&" '4^"0 4S`4Q"0 4@0:"8`2? X"Ā [ `S  014 "PZ*c"P  c*` *` *` *`*`S`Z#ڥ@ S?" Sb 54 S H@i b   sorry, arguments too long. (%s) 㿘Z#@*$S 5@C"(MS 5bH@7 ,@ $Ȓ"@L@ 8@  ?L@ ",@ uZ#&S @ 4  &@TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.㻘X" \!@ !(Q@""! ް @l$!\!@ (Q ""`"` ""0! 2P5@Ɛ#H 5#P@J? /  $$  ?!5@S#X@/, @@?L / /, 5 #@*|# *| *| *| *| *| *| *| *| *| *| *| *| @w*| 5#@/m @WQcd?"cd"cd\!(`"!(S g`?`5@`#%5!5 @ `@ #Q#D@˒ d Q#&`"QS A`?Q"#d\"!(5@Sc!($!@vT! 2P 6S 5@B#  s&"!(!@ǒ$ @l!f$!@[Ȓ 2.%s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! 㻘W" E\!0 2B 6c!S @@O $L@݂ / I`*  R  n"'  p aS  yS W""  6@B# \ "!0 7`@ 7@`06 %s: not foundh\!@  Ȑ@g ,, @_ 2Ȁ  7@.!@Ȳ @?&@ȫ SIZE %s㿐??!\! Q d?"d7"8 `Q#@[ $ @@U J  M"  Q??"#d ! 2 Q!SQ @A# @ Q"#dMDTM %s%*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. H?Qd#\a Q`#D"d7#@⢒ ;`#\#`Q#7cHĖ@9Ȑ @є ,'''''Д'ؒx@>4'ܰ?쀦`Sa  S 7ch@Q a 2 Q!SQ @A*# @ Q?"#dQ"#D㿐!(!? @{$! `w@u?! `?㿘 # W"? @M  "#  KMGTP %3d%% |%.*s%*s|********************************************************************************************************************************************************** %5qd %c%c --:-- ETA - stalled -%2d: %02d:%02d ETAh?!Q"@} "Q""`"" ( Q:@} W" Q#P`#P  Z(QD5--@C3`+ +`@0(@ P@wr(`& d4 d!8@t]S"?․@@| d@@@8bp#\!"@88!@t@$   a" ,4  <   2a" @@8aJ@` !"@8"x#\ B#\@t Q"" " '"''А"@'Q" " QQ:"Q""" " Q  "@ # 'Q"" " '"''А"@'쉠+(b 腠ZD#`#?  +(b؁;Q#P #P2 (@@!"@8@sc%S @@!"@8@sS%SQ#P(@ b @w !Z#@w?؁ ЅƅB'.@ @̐@ɐ!"@8@sY@@!"@8@sL@8.@@!$@ q S@& %qd byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d Q#d  @{Ӓ Q"" " '"''А"@'쉠-( 腠DZ#@wC?x-(xB3? ?@v  4  Z@(Z Z##`:aX #  :8"p:!xW"$;`  @w#\ -( -(( B ;h:!:!#p d@rw ZZ#`#T   P -(xHQP`DPZ#( @ D 4< 2P5P@ b @v !@v?px pƅB'.@d@&.@@ d$@ 8@9bh@F 㿘@ ߔcannot seek temp fileout of memorycannot read temp file㿘\#\ \ !"|  !` @"  \!;!`@ڔ 6  @:V )">tb')  \ #)baL%) $aL"  @ 28$@:8 > ")*b"  b*` *` *` *` *` *` *` *` *` *` *` *` aL*` ? $aL!)!X  @!Ő !X 8 @" 4 aL$? $aL!)!X  @! !X  @!  \!) @  @9 )">b@   \!>  B ;!* line too longcannot write temp file㿘@ʐ   @9 > ")*b"N 2 &##? !)*b!  b*` *` *` *` *` *` *` *` *` *` *`  *` C*` )\!|  !\! @   @9| )">b @ԧ!: \:!%!|\ @Ԃ "$\??:@9^ )"?a @ 0 !\!@ : <`!  B?@ :?L$? $L!)!X  @ɐ !X "@  @Ɣ\"aL@ T @  & @  &  !a@F ! J 0:㿘\!\%\x  W!)#\!LaX`$!L@.  28$x@3̐ D !)*b!  b*` *` *` *` *` *` *` *` *` *` *` *` !L*` ? $!L1)!X  @Y !X "?@ ?!L$aX? $!L1)!X  @D !X \@ \\\!X *`"`"\㿘)3\\\a\X 6a.@2 '@  ! !\\&a \\\ 6\X(2Ć Ą  ą(\\\@ \X*``"ā㿘\"!\"!\"!\\"!x!)!L#\aX`@D$!L!L$aX? $!L!)!X  @ !X @ rcannot open input filecannot close input file%lu 㿘N ! F@`@F@D(`  @2ِ)"F` @= 6N+? ! @Z  )!T@\  )@2)"Fa @u?0!T M HF!(F!0 @zK\!&newline inserted newline appended 㿘 \!\ah@\!`"ah"!`)!D`?\"!3)%)@ NaL\!ܒ`&aL  aL? C&aLX  @ X y?@[ u?$ \! @! aL? %&aLX  @ X [?@= W?aL? &aLX  @ X "@*  @? `F"h\!h   \!`  \` !`F"M@2/`H\!` \!h  "   \ "ah\ah"ah\`)aD`"`  "@out of memorycannot read input file㿘 3\+)/\5)G!X-))!D " ? % @Zڐ  %`  @e` cap  U aLbܐ %aL"  @ 24&ap@1 G !X . , , , , , , , , , , , , aL, ? %aLX  @- X ?@m ?aL%ܐ? %aLX  @ X @Y ܑ,` *@ \ "a`+\ap  \ %)bL'\ܐ $L"  @ 28%ap@17 G !X)*b!X  b*` *` *` *` *` *` *` *` *` *` *` *` L*` ? 7$L!)!X  @Đ !X E?@ A?L$ܐ? $L!)!X  @ !X ` @ ` 2 \!*  @ @0 )"Gah@ ? \!ܐ *@ \ "ah\!*\!` \!h  2?wcannot open output filecannot close output file㿘N ! H@Ēa@ǐ@A` @0)"Ha  @5 6N.? ! @  )!T@ZG  )@0)"Hb @9?0!T M HF!(F!0 @x&  㿘L)!D `Z`&)-\+\)\ @)Ԑ @ `a` !h *@ @ ?`@)!D ~  "@cannot write file㿘"# !)#)%I!D  N@H`  N@@t`  @0 b`@ ?!D unexpected end-of-file㿘\!ȸJJ !\!Ȥ"@ ?'_!')) \ #)aL') $aL"  @  28% @/ G !X)*b!X  b*` *` *` *` *` *` *` *` *` *` *` *` aL*` ? L$aL!)!X  @J !X  @  aL$? $aL!)!X  @5 !X @u !) \a@0  *?5\3)-)1)"G!X/)@ & x@J?  `"Ia@ հ  U Lb` %L"  @ 24&`@/7 G !X ." -  -  -  -  -  -  -  -  - - - - L- ? %LX  @Ȑ X  @  L%`? %LX  @ X "`@ `x@``@  ` @*))  \ #)baL') $aL"  @ 28% @.Ő G !X)*b!X  b*` *` *` *` *` *` *` *` *` *` *` *` aL*` ? T$aL!)!X  @R !X  @  aL$? $aL!)!X  @= !X )@} )`*'`stdincannot read stdin㿘 5L;\-))\9)"G!X3)7\`? %`@Wt  &ma  V  Lb#x %L"  @ 24'a@.< G !X /" , , , , , , , , , , , , L, ? %LaX  @͐ aX H?@  D?L%#x? %LaX  @ aX #x@ #x,` *@ \ "a`` 2`\#x "*@` @ ?J@-#"Jc@ &` ? ? 5` 5` p #x*#x&ȁ%ld \  \abfnrtv\㿘 K@>!Р K5L!K! )" K!@-ǒ  ^*`: \`?"`` y0{` \?"``* &@, \N`  @F `?"`"L"`2  0@  * & @,Ԓ "` 82  0@  * & @, "`  0@  * & @,  `N?"`` * &@, \ L`?"` * "@,}  @(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-file8'D@cf'H@@. ` )@@J? r`?)"!P)L'\% #) DH@n”!? s"$aT x p)"l) "l,$d)"aDHM@t H@& =@H*`'HD 'DHJ -) D "!T"@H 'HD?'D@ !) $!` @?   <      @k @ $!`L@o#@I @h "  a@_a4 `@[c, @X  `@Tcp\@#P L!M@,>`HL !)*b!  b*` *` *` *` *` *` *` *`F*` ) D #"a\HJ@ D@$ H H)!` &J@ !#!)!h@Es , D L!M@+`HHJ  ))"La@ )!` #)y #)9M!)7\5LL#X-)+L%L)\  \aH  HLa@sG"\!d @+’@ؐ) ?(\̀  )!T @+"La@D ` 2&aH b!@s"3 & ?- \#x@J?  "Lb @#  ? ?4 \@a"!P ?@& & ? \!@ \?" &??00/ &̐@+^"La@ `  aH 'b%`  aH b!@r"0 "L!@r"А @+5` ` aH b!@r" S 㿘\"#\\!\\!&!$@8 c! $c$!&!J`,`;2 \ `;$!$\c 4  "c\! \!\"! ?number out of rangeinvalid address㿘\ M" @ `\`!J@  `" `  \!Ȣ/M%)'N)\+\N"#aJ? U*  <( > > > > > > > > > > > > > > > > > > > > > > <( > > > = >D > > > > > <( >D <( = = =< =< =< =< =< =< =< =< =< =< > >D > > > = > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > <(aȐ`$a `⌐   aJ@  `$a `  aa    a@?>  @@ - # " -Naw  ^2w u&   e - ^2` h?^aȒa@?  Q  # "L NaM GaȀ . 6$a\G!>@- / @ `? 9aJ@- `*$aȀ*aȐ`$aJ``@\$aȰ  (? ;a\ $aȒ`"\! %a!aȀ ?!  @I? invalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%ld ! unknown command㿘\  M"@ ` J@  `" `  \aJ "aȒ`p P ē*`  ` a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( _ a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( a( _0 a( a( a( a( a( a( a( E, a( Hl J8 a( a( a( a( a( a( a( Q Q a( a( a( a( Hl Z a( a( a( a( a( a( a( a( a( B a( C, D E G Hl I K K L M N@ O a( P` Q R Tt X Z Hl Z ] a( ] \J`n"  `p`l" 2  "Ȁ\!J@` "!\!P \@\@ !} \!@  \J`n"  `p`l" 2  "Ȁ\!J@` l"!\!P \@\!\@Ca d\@ t! `^?\!@\ V \J`n"  `p`l" 2  "Ȁ\!J@` 3"!\!P \@z\!\@ a +\\a    2!"0\!̀ )!T "?\# )"Oc  !\!Mb   )"Oc @z  J`n"  `p`l" 2  "Ȁ\!J@` "!\!@   &ְ?@H &ϰ?  6L@Ȱ?  !!)!h@A3 , L@  )J!h 2L@)"Oc8  )!h &?@\"!*?" *" \# )"Oc !\!Mb   )"Oc @ "}?L@ ! )"OcPp J`n"  `p`l" 2  "Ȁ\!J@` O"!L@ !)!h@@Ô , )@D!h@jw0F\!P O)"ch: \!@;  5g G  *G V  \J`n"  `p`l" 2  "Ȁ\!J@` "!Ȑ\P"P〢 \# )"Oc  \J`n"  `p`l" 2  "Ȁ\!J@` "!1)\# )"Ocǔ  \J`n"  `p`l" 2  "Ȁ\!J@` "!)H " "H)Jb bM HL@na0\!  )"Nb \J`n"  `p`l" 2  "Ȁ\!J@` l"!\!P \@\!@ z?M \!@e  _ \J`n"  `p`l" 2  "Ȁ\!J@` <"!\!P \@\!\! 6@ ݐ  \\aJ` ")"Nb   J`n"  `p`l" 2  "Ȁ\!J@` "!\!@ h怢 \!@  \J`n"  `p`l" 2  "Ȁ\!J@` "!\!\a@   ԰ Ұ?\!@В )\!#\a \# a)"Oc `\!  )"Nb %! $a  )"Oc  \J`n"  `p`l" 2  "Ȁ\!J@` {"!\!P @@ R^ \!@v p \J`n"  `p`l" 2  "Ȁ\!J@` M"!\!\a@   L J?\!@H B \J`n"  `p`l" 2  "Ȁ\!J@` "!\!\a@ Q   ?\# )"Oc  \J`n"  `p`l" 2  "Ȁ\!J@` "!\ad  ad #, 2"@)"h "@\# )"Ocؔ  \J`n"  `p`l 2 "Ȁ\!J@` "!\!̀ ?)!T q0!\!Mb   \)"Oc # \!\"!@  J`n"  `p`l" 2  "Ȁ\!J@` t"!\!P )@)Jah  ahL@ !@=ޔ , L@  )J!h 2L@)"Oc8W  )!h\!> &N?L\!H\ E"a#\))#%)aJ`g"  `p` "+ &`9% `0!a0 `r 0   $a@9(  @%"@| # "|  ?$| ) aJ aȀ  )"x  )"Oc  )""\!J@  J`  )"Oc %)L)bx $L "%)@  2%)L? $L!)!X  @ \ !X ư?@  °?x@ "$x@@x$x) "bp)aL? "aL#)aX  @ 9 aX  @ y   \)"|)@ 0b \!P )b| b| ? "b|)b| "b| )b|  ?"b|\)J`n"|`p`l |2| "Ȓ` "| "Ȓ`"| "Ȓ`"|\!@[ U \J`n"  `p`l" 2  "Ȁ\!J@` 2"!\!P )@y)"x)b|)@G \!@( ")\!#\a \# a)"Oc `\!  )"Nb %!$a \J`n"  `p`l" 2  "Ȁ\!J@` "!\!P @%@P \# )"OcΔ  \J`n"  `p`l" 2  "Ȁ\!J@` "!@2 \aJqQ2\? "a\!Mb   )"Oc @ \#  \! \\"!\"!!@  &~? \J`n"  `p`l" 2  "Ȁ\!J@` Y"!)Jah  ahL@ !@;ʔ , L@  )J!h 2L@)"Oc8C  )!hWPO#  \a\a\ /\!\*"!!̀ &)!T "q ?\# )"Oc  \J`n"  `p`l" 2  "Ȁ\!J@` "!D)"aD\ "a\! @@ \a ?ϐ aȐ @6 !) @$"t#@  # "  )"Na@a $"t \J`n"  `p`l" 2  "Ȁ\!J@` "!\!)"t\! @4 @˔  ? \J`n"  `p`l" 2  "Ȁ\!J@` q"!\# P \!\!@2 0j\# )"Oc^ @ [ \J`n"  `p`l" 2  "Ȁ\!J@` 8"!Ȁ \La!@2L`\!@^ )!T /P@2A 0+\ "a\! @&@  \! @M ?)"P` )"Na@  %")"Ob @?㿘\# \"!\"!\!\!@  )`\!  )"Nb@} ?no match㿘\!G?%\+\`    ?, !熐! a` ` v   @s !؀`X ")*b"  b*` *` *` *` *` *` ?*`*`filename too longout of memory㿐\J` H M"    J@  `" `  !\!J )"La$ G  !$!J@ !`@$!Ȁ ' L\a!@1Z`\!?  )"XcP @{ %)`4X\b#)aL!)"@M$aL 28$@ X #h)*b#h  b*` *` *` *` *` *` *` *` *` *` *` *` aL*` ? $aL!)!X  @ !X 8 @ʐ 4 aL$"? $aL!)!X  @u !X \@ \a'J ) !b @* `#!Ȗ'J@ !)"*@@"  "shell access restrictedno previous command㿐 )!P')"Yb  \ "a?+)b  \ #)baL))" $aL"  @ 28%b@Z X #h)*b#h  b*` *` *` *` *` *` *` *` *` *` *` *` aL*` ? $aL!)!X  @ !X `?@' \?aL%"? $aL!)!X  @Ґ !X \@ \)⌐ !*@J Ƥ3))) 5)7Xh-) J@ !j %@b T !Lbb %!L"  @4 23&b@ h . ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,` !L,` ? O%!LX  @v X ?@ ?!L%b? %!LX  @b X @ b *@J \O%b *` `b T !Lbb %!L"  @˒ 23&b@{ h . ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,` !L,` ? %!LX  @  X ?@M ?!L%b? %!LX  @ X @9 b * %\! "J  \Y2b!tb T !Lbb %!L"  @^ 23&b@ h . ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,` !L,` ? y%!LX  @ X ?@ ?!L%b? %!LX  @ X \@̐ \\t  *@ᠦt  bp)Jah )@Րah@:'b T !Lbb %!L"  @ 23&b@ h . ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,` !L,` ? %!LX  @- X ?@m ?!L%b? %!LX  @ X  @Y b *??'Ȑ%\J H+\a c #)baL)\! $aL"  @| 2?%a@, X #h)*b#h  b*` *` *` *` *` *` *` *` *` *` *` *` aL*` ? $aL!)!X  @ !X 2?@ .?"Oc8 @?0&aL%!? $aL!)!X  @ !X !\@ݐ !\!)b@\!"!t*@L ! % 㿘 \"aL#+\!)') \!P aK ?\#x@ J?  `  ?s5 q?N` `  %a\J ` "aȒ"` !LN .!LN  !LT   $!L⿐ `!L? $!LX  @- X =?@m 9?!V!$` @  !L? $!LX  @ X ?@N ?\ !L"̐? $!LX  @ X |\@6 x\ 㿘 \!`@  @pX5\-)3)7)#h/)᠐ H` U L` %L bb" @L 24&H@ X #h . , , , , , , , , , , , , L, ? %LX  @ X Ͱ?@͐ ɰ?L&b? %LX  @y X "b@ b`@v`@@'\H  \ #)baL%) $aL"  @ 28$H@ X #h)*b#h  b*` *` *` *` *` *` *` *` *` *` *` *` aL*` ? 3$aL!)!X  @$ !X d?@d `?aL$? $aL!)!X  @ !X @O %)] * @F* #\<??!)!L$a`t$!L a @ | 2\!L? $!L!)!X  @ې !X ?@ ? !L"̐? $!L!)!X  @Ő !X  @  㿘\!\!@  \!? ) )aL  "aLՐҐ\!\W"! @ % \! @   @  )aL? "aL!)!X  @w !X R?@ N?ᢐ\a  ᛐᘐᔐᑐ$" `\!"@` $$$`\!\! " @"\!P \ \ )aL"̐? "aL!)!X  @* !X  @j  㿘!\!Q \!!\"!" @  `&  "`N1)))?-\!L`@(&!L !L\$! @   !L? &!L!X  @ !X '?@$ #? !L%̐? &!L!X  @ϐ !X "@ `¢\!  @ 㿘 ')L$L@ B )\L? $L!)!X  @ !X 9?@ 5?!`@  Ɛ ?\aP`T$$`\"!\ "!&@"@L%!? $L!)!X  @m !X  @  㿘  \)"Nb@b $?!`@  @" #\ $a `˖ &?@@ invalid mark character㿘M"`   \)"_c@' ?!*  2" \aԐ "a"  㿘M"    \a?* @ )"_c@ ?\Ԕ \耢@2`"@"Ԓ`\Ԁ㿘@&   >  %& @ X #h)*b#h  b*` *` *` *` *` *` *` *` *` *` *`  *` *` 㿘"  N \2 `?㿘))"X %)')L☒`$L@@28%"@̐X #h)*b#h  b*` *` *` *` *` *` *` *` *` *` *` *` L*` ?$L!)!X  @Y !X , @ ( L$☐? $L!)!X  @D !X )@ )N \`   * )"㿘)!L  )? X* @"X@㿘)!L  )? X* @"X@Oed.hupHOME㿘)!\ ) )? * X)\!*@ 1"X`#P` } %`@#  @  @% @'J /" /.*`@'ܒ!W Đ 㿘)!\ \ߺ \#P)? !X*@ * #!X@?㿐 )? X*@* "X  `h@j   )?"bt )?"b "# ..㿘)!P " N ! a@=a @1; /   )"Yb@r  invalid pattern delimiterno previous patternout of memory㿘\J@  a8):8: :V2 `"J`  *  H aX):X:"< @K 7 * ` )"p @I )@a * "`@R ap):p  "2 )""p1* @m[ )   @kJ!'@d &  unbalanced brackets ([])trailing backslash (\)㿘\!L@( @))"'b0*`:   [ \`L@@` `0 =" <  <|,L@ b`L@ @\!1* $@ F %)bL)*  $L"  @( 2"& @ؐ ap):p "L2 ? $L!)!X  { !X >  : L% ? $L!)!X  f !X 1* 1* !\!@b *\!` $! b P):b P  b:` "`  2`*`  m J^" J]" #J(8 ![2 J `.`:`=2  J ]   J]2J 2J J] J] number out of range㿘&@&#\aJ a\"!= @L a8?J` @0 aȐ $aa @ϐ  @+J  @&@#@  # " )"bc@Ȕ &@ ?*:  g2 `$aȐ & no previous substitutionout of memory㿘\ "J % J-: @2\!\! ")"ca@  !$\ȓ-J:` c3\))+\7)!0-) 5\aА  O !Lba %!L"  @ 2.&a@ c !0 `. `, `, `, `, `, `, `, ` , ` , ` , ` , ` , !L, ? %!LX  4 X!L%a? %!LX  & X f a *@$ȑ* : `  J "?`\&a *$ȓ*`:``  \!P L# "   x@J? ` ?6 o ȓ-J:` ua'\А  \ #)baL%\ $aL"  @b 28$@ c !0)*b!0  b*` *` *` *` *` *` *` *` *` *` *` *` aL*` ? $aL!)!X   !X  ߐ  aL$? $aL#)aX   aX \ʐ \\a"*ano match㿘 \!\ᔒ\! a"ᔪ ')))a ۚ%a@ &~?H\a h\!L $Lѐ `a{a$` @Ӕ L? M$L!X  3 !X P?s L?L? $L!X   !X "^ a\!\!"@ a\"!``d !)*b!  b*` *` *` *` *` *` ?*`*` ?` \! ? infinite substitution loop 㽰'D'L'P ٝ\!` `   ` D @g#'  5\+)/\;)b9c!0-)Pt$l U  aLbؐ %aL"  @" 23&l@Ґ !0`/b`,``,``,``,``,``,``,`` ,`` ,` ` ,` ` ,` ` ,` aL,` ? +%aLX  d X A? =?aL%ؐ? %aLX  P X \ \!` $ r ؔ@DD@ k$?l T aLbؐ %aL"  @~ 23&l@b !0`/b`,``,``,``,``,``,``,`` ,`` ,` ` ,` ` ,` ` ,` aL,` ? %aLX   X Ѱ?4 Ͱ?aL%ؐ? %aLX   X \  \!`   ؔ@Ԑ$ L  L  D @f$   P-\l   \ #)baL+\aؐ $aL"  @~/ 28%l@ߐ c !0)*b!0  b*` *` *` *` *` *` *` *` *` *` *` *` aL*` ? 4$aL!)!X  l !X I? E?aL%aؐ? $aL!)!X  W !X   $ \L )"e`X@I  ?\!`  g !\!ؔ@8!e x@*@ x @*`   㿘'H\!'P\`=!3\+)-\9)"7c0/)M &c \H  al" N aLbؐ %aL"@  @} 2-&al@5 0 /" , , , , , , , , , , , , aL, ? A%aLX 9 ǐ 4XaL%ؐ? %aLX   X  \@*@  \qal M 0l 94k P?Ѐ 4f H*   al" N aLbؐ %aL"@  @} 2-&al@Đ 0 /" , , , , , , , , , , , , aL, ? %aLX Ȁ V XaL%ؐ? %aLX  H X  `\@*@  W\  N aLbؐ %aL"  @| 2-&al@h 0 /" , , , , , , , , , , , , aL, ? t%aLX l  gXaL%ؐ? %aLX   X ,  *@ \! \!% @&M'\l  \ #)baL%\ؐ $aL"  @|W 28$l@ c !0)*b!0  b*` *` *` *` *` *` *` *` *` *` *` *` aL*` ? $aL!)!X   !X ?Ԑ ?aL$ؐ? $aL!)!X   !X \ \!*out of memory㿘!* %*#*  `d$ *@ @{*` $` *@ *`׊"  *@ `*` "ׁ `*@ *` & *$ @ h ")*b"  b*` *` *` *` *` *` *` *` *` *` *` *` @*` @{`$`$ nothing to undo㿈\!* \!* ? 1*)"hcp@~ ? \ "a+ )!L `"!L`I* +` *   "   3/  @"`!"`"`@" "@"` "@ "`"@"` ` "*  `2  : * 2  : * +` * ' ' '` * @*` ##  # 耢 "?"\!P *ܓ*\"!"*\"!)aL"? "aL1)!X  W !X    㿘'*??!$)*` * @*`    @ @@@z@??$*" \!*" \!*" 㿘@2HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s@E "#9ij` %L#-+@QH#?O? *H*  ` p   ƨ  ¦    &$@sU$%%c@P= @&*  @@E#Ȁ  #  i@Mc  i  i@Bc# 2  @?"c@> * 2 "cВc@7`. @@}#-* j` @T@ @}$ .-T`$,`$ @K[&@  #  j`8@Ӟ<  2  @@} ) #Ȁ 2 @#  @@K,8@@@K?8@<  2  #  #Ȁ " @b@|㿘@ӥ / 2N  2  N / ?:N0 /" ?:N %s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_read8l@@   @ /*T-<+3@  4   0 @Ͱ ka@ے0k!@հ 08V2 2"$fka(" @3N "*!PJ$`/"L? / /, $#,k!0@  @'%?,@JD?2<* @2<@2<k!X@<   ;      k!T@o 0x < @c @X@L0\@H(@W@X V  #Ȁ  k!@F @, 0K< @Ia 6 j`8@,    "#  j`8@ T#Ā  <@ 2'  $< @T0c <@n  c  @<  @2  #  k@a؁4  " @4  `??%soverwrite %s? 8 @I| `l"C<#̀ 9M Hlb*@TT?P`? "`@5~ ?P  $?P  y#Lc y`? &`@5hc  $c`  y Y*@yz *!T$ *!T& @I*?  l"*@{aT@yѐa \#)l+*@y@ @yq@""@`aT ` l"@W  @y@y8 #Ā @ϒ 2# , cԀ @qڒ l@Ғ o@*@ l"*@%aT @yz@yx l"*aT@ readlink: %sunlink: %ssymlink: %s㻘 @y#?` m! ,*!T@? m !*@VaT m"@ 0 #Ā  @ <mkfifo: %s㿘`"  *!T@?i " m !*!T@ m"@  #Ā  @; mknod: %s㿘` *!T@?@ "*m ! !T @ m#x@  #Ā  @ utimes: %schown: %schflags: %s㿘 ! /6  #$# @pe#$   $  $@p^# "`*!T@n @\ `   @   ` @ݐ  # n 0*@BaT  <! @6 `  @  n *@ǐ!T n 0*@(aT  ` "#  D@   0 D*@!T  # -n D n @*@ aT lchown: %s㿘* !T @    # n" @  %s %s usage: cp [-R [-H | -L | -P]] [-fip] src target cp [-R [-H | -L | -P]] [-fip] src1 ... srcN directory㿘M Hnnnb@R@y# 㿘@b:c:d:f:snr%sstdin㿘@A n@ycX *c5no # /  +)'@Lr`?T? 4M*  , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , $c,p@o`%c, -%c@fc,p"%#$@Q= @c* `@ ##؀  # #耢 "@@5@ !n#n@@#p 2@ @@cxĀ@3`@ 0L#nĀc@xf , [-cf] list: illegal list value[-cf] list: values may not include zero[-cf] list: %d too large (max %d)㿐'D)M'%## Do@b0 d'  J@ - `' "    @   4$J - "  @ J@ - `܀`'@ $J  o@ܒb8  o@ԒbXc ob@͖( &$c  *@`  D#܀`쀢 4"##@w 1㿘'L#`0# ? & @2  &?p ^L `? "`` , :  * $@a2  ?#܀ "*  ? & @1  &?+ )`? "`` , :  * $@1 ? & @1  &? 2 ` ?"`* $@ %s: line too long.㷐3p #'L* =(@  L@  b@"  ` #耢 n#x@ߐ##쀤BM "5L@```=?"``  * $ @L@ ``?"`` * L@ `  ¨  >#܀ 6``=?"`` * $@v L@ !L#?`$@ * $@^`L@ 2L@ 2`` ?"`* L$@E Iusage: cut -c list [file1 ...] cut -f list [-s] [-d delim] [file ...] cut -b list [-n] [file ...] 㿘M Hq@O>b@vK 㿘@ʔ Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. along with this program; if not, write to the Free Software You should have received a copy of the GNU General Public License GNU General Public License for more details. MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the but WITHOUT ANY WARRANTY; without even the implied warranty of This program is distributed in the hope that it will be useful, any later version. the Free Software Foundation; either version 2, or (at your option) it under the terms of the GNU General Public License as published by This program is free software; you can redistribute it and/or modify Copyright (C) 1992-1993 Jean-loup Gaillybitslzwbestfastversionverboseno-timetestsuffixrecursivesilentquietnameno-namelicenselisthelpforceuncompressdecompressstdoutto-stdoutasciiusage: %s [-%scdfhlLnN%stvV19] [-S suffix] [file ...] r㿘M Hrrrb@N#" file... files to (de)compress. If none given, use standard input. -9 --best compress better -1 --fast compress faster -V --version display version number -v --verbose verbose mode -t --test test compressed file integrity -S .suf --suffix .suf use suffix .suf on compressed files -r --recursive operate recursively on directories -q --quiet suppress all warnings -N --name save or restore the original name and time stamp -n --no-name do not save or restore the original name and time stamp -L --license display software license -l --list list compressed file contents -h --help give this help -f --force force overwrite of output file and compress links -d --decompress decompress -c --stdout write on standard output, keep original files unchanged%s %s (%s) 1.2.418 Aug 93%s 㿘#M`Hsbss@M!", H`  H#sHb@M  H㿘#M`Hsbss@M"+"8` "8#sHb@L  HCompilation options: %s %s DIRENTUTIMESTDC_HEADERS HAVE_UNISTD_H DYN_ALLOC 㿘!M Hsbss@LȘ"scss@Ls@Lct@L`t@L`t@L`(.exeGZIPunguncatgzcat.gzab:cdfhH?lLmMnNqrS:tvVZ123456789%s: -S suffix too long %s: -Z not supported in this version %s: option --ascii ignored on this system %s: incorrect suffix '%s' insufficient memory㿘'D@;'HH@ 1@sF&#  #t`Ȑ@*? D#*?DHt@  "`H+"" @qӒ  @ "` @qȒcА @qŒ   @qcА @q  @qc!#t`@*)   t#`@*"  2#+ "b|t`@*=  t#@*7` !+ ""x+""|! t`@ @rܐ"`u  ).'+%+/+3+-+++#+t+DH@* π E*  ֐ ֐ ֐ ֐ ֐ ֐ ֐ ֐ ֐ ֠ ֠ ֠ ֠ ֠ t ֠ ֠ ֠ ֠ ֠ ֠ ֠ ֠ t ֠ ֠ ֠ Ռ ՜ հ ֠ ֠ ֠ ֠ ֠ ֠ X ֠ ֠ ֠ p ֠ ֠ ֠ ֠ ֠ ֠ 0 < P X ֠ ` ֠ t ֠ ֠ ֠ | Ք դ ֠ ֠ ռ ֠ 0 ֠ D+""t@ +"b$x$|+b "bV$x$|%p&b&b&b%&b%%b$b+""@rL   "`Mc Ht@K^a(/@ ,  @M j, $x$|+e""b%b `$bu@  [tMc Ht@K=a@0+N"b @  It+b 6++"|"b+b ++"|"b+"tD. `"+"  Mc Ht@Kah ``+"| `$+cM.` Ht@Ja@ ɐ +"   +"| 2 ,""`D @nJ @ "` t@!@nA "ct@!@n8@ "ct@ߐ!@n/@ "ct@֐!@n& "`t@͐!`.D@+  H*`` @c$  D@H+@@+"  +" !+`?@!+@ c""%s: compressed data not %s a terminal. Use -f to force %scompression. read fromwritten todeFor help, type: %s -h stdinfstat(stdin) OK 㿘+" 5++" 0+L!+"| c`X@fR` #"|v M H#aHv!v!+"| "rv! @J5 Mc Hv@J.a@  +"|#$cv !*`!  `*` *` *` *`*`r "h*c"h  c*` *` *` *`*` +" *`+" 2LR#`(@hE v@! $c?@"c+ "bx+"|  "` @#+ "b+@ "+" #+@Tb0E-,L# X)+'%#T D€U` 7"| ؀ `@ @Z#+ '"b"#+" +" M Hva+"| !M H`#`" @"@t`(@I-%s: %s is a directory -- ignored %s: %s is not a directory or a regular file - ignored %s: %s has %d other link%c -- unchanged %s: %s: %s compressed to %s %s: %s OK -- replaced with %s8w@'ra` !+"x$"x#`(@t <  @. +" `( ? ? ? ? (? 0? 8? @? H? P? X?@ ?@0+" 2<+M Hw ah@+" 0+M Hwa@H%+ `'+"x $+"  +" 2+` M Hw!#  s@HВ+b A ?"b (4+""̀ #+"   +"x "+" +" r "h*c"h  c*` *` *` *` *`*`@;    @=!!?$#Mc Hw@Ha@ې+ "b@e+b|`" @#+  "b+"  !#+@b@ni#0+"x LR#$" @ +"| #Ԁ +" c+" cM Hwb@H7#cԀ ++"`?"c+"  M`Hw@ob  r@n w"(w"0 @H-,!+)+'%1#+#D€` 2+"| ؀  @ @# $b"#?"b@m#+"x 2 +@m +@>+"? ++"x F@4#0B" 8+" M Hw@Gb8++"|  MH`  cH`#`" @"@+" M+"x  M Hwb@@GM Ht@G`(+"x @ (%s: %s: warning, name truncated 8*'/+ #%#+)M-@ "%@mtG @<!?$@@mg$b@e  Hw@GVa@@mX@mV@3$b& @ + "| +"  b HyaX@G5b     $b@m2@3r@0㿘 +bx` "# +" @<{0@<__z-z-gz.tgz.taz.zzp,  y@%(cp "`@mِ %&@U@K@mȐ@m@ $?L /" `@@%%@ "`@  .Z㿘, @m#  ?"c  @! ;+"|   #   @ + ("b@m}%t@$` " )+ @d  . 2@`@Ր%"  %s: %s: unknown suffix -- ignored .tar%s: %s already has %s suffix -- unchanged 㿘#`@R+b|`N /+"  ++" 2k +" 2f +"  ++" 2\ +" 2W +" D+M Hza@F 9+@y@$EcX y@$?c` 27.z !.! .  .  .  *.  !+"  M+" ++"  bM Hza@E+b     "b"#Ԑ@` %s: %s: unknown method %d -- get newer version of gzip %s: %s is encrypted -- get newer version of gzip %s: %s is a a multi-part gzip file -- get newer version of gzip %s: %s has flags 0x%x -- get newer version of gzip %s: %s: part number %u %s: %s: extra field of %u bytes ignored corrupted input -- file name too largePK %s: %s: not in gzip format %s: %s: decompression OK, trailing garbage ignored 㿐+" +"x  @ `"@;  @ /  @ `"@#  @/ `" @/+?#b" %$ؠ{`(  b@1o#  {`0@1h   @ `"@ $+"  M H{`8@D!+,bH  "D # @  M H{`p@D+ "b? H{`@D+ +" "M H{`@D + +" " @ `"@  @  * `"@n *  @  * `"@\ *  @  * `"@J *  +" "# @`"@4  @`"@) 0 @ `"@  @  * `"@ * +"  M H{a(@DC @ `"@  @  * `"@א * +"  M H{a@@Cј??1# `@`& @ ?? S+" 2!+"x +" ! !1#  @` `$ @ *  .!#@ #-+$!{`@` `$`@u .*    `@!p`+b 2"b1!   #@V    ` `$  q+  j"`{a@/  !  2 @/  2$ ,"H"`D@4 t? H$ؐ{a@/   , `"`D+ 8"b{a@/y   ,#"`D+ ""'"#{a@/h   +, "`D+ "b" +"x +"  +"",""`D"  "c+" & +M H{a@BΖ+"""  +M H{a@B+b ? "bdeflalzh pack comprstoremethod crc date time compressed uncompr. ratio uncompressed_name %9lu %9lu %9ld %9ld (totals) %5s %08lx %11s %s 㿐,`̀ `+" "`~@  +" 0?~@  +?)?+"`+"+" ~ !(+" 2L~!P@ L`+"+b" @"@~@ Ӑ!`0%$쀦`#!0$ #؀ ,??@h  "$  $ @g  "@d* *` * * *` * $@^#Ȗ * +"  ,~`Е.`@ !p@ 1! ~#@ !P  ++""" $#&   "쀢2 ++""" ""  &L "L` c" @7"@~!@ Qc` @`?8@h@ ??`?`?`?` ?`(?`0?`8?`@?`H ?`P?`X?@6,?2,?̒@ ,?name too shortcan't recover suffix .internal error in shorten_name㿘 @hI+b| @ @l!]*?T 2,@a!, "cԐ?z@ra؀ 'y #X,?#X ,? ,? ,? ;,'@ /   @&ᰀ?L 2 L 2``  `,@*  `@ . 2L`@!L` "@g`%s: %s: cannot %scompress onto itself %s: %s and %s are the same file n%s: %s already exists; do you wish to overwrite (y or n)? not overwritten  "c # @6  # ?2 V+"|    F@5   ( ( c@Ȓ M+"| M H##v!r    Hc@@}T++" >M Hc@@i7H  H?P@\V   @@[`@[H O@'HM"@  `Y2M`yM H@@A`0+b   #@, M c Hw@@,a@+ "b 㿐`'` @s2'  <`  1+" 2 +M Hw@@a+b " "b" @V#%s: time stamp restored 㿘+"| #Ȁ`  +"  & M Hc@?ؔ# @ o #+b 2 +Mc Hw@?a+b b "bb 2 @  @#+"" @+ !+" 2 +Mc Hw@?a+b " "b" @%s: %s unreadable ..%s: %s/%s: pathname too long 㻘@W M HaP@?n+ :"b)+@ 1 2 @a @ah @f8@f5 #M@  /, @0א Hap@?7 %"@㿘,  @f7! `"@b $ !+" "!@b$"! "!@b$ !# "!@b$#!#耢 "!@b$#!#䀢 "!@b$#! @b|$ @e㿘+" @d @+)# 㿐77"#" !$#+ ""1   #%*@$##?*@  #$#*@ $#@#Ԁ 2 ##*@ $#@###c `* `$##2 *@ $### `@* $#@#`#2`* $#@!##c*  c$#㰑2 *@  $#%# 1cȀ* $#@#c2`* $#@ @)"`@ $+@b+"@1#3c #* `@&#@c#c * &#@Y#Ԁ @ # * &#@FL  !#@" ##㰒` `* ` $#㰑2 *@  $#%  1 `@* $#@#`2`* $#@!##`*  `$#㰑2 *@  $#%# 1`* $#@#`2`* $#@!##㰒` `* ` $#㰑2 *@  $#%  1 `@* $#@#`2`* $#@!##`*  `$#㰑2 *@  $#%# 1`* $#@#`2`* $#@` @"` 㿘#@c'?  @$"``"`bad pack level㿘? (@N"`"   @@d- ,`.  @ " "#" "#@  @ 6@"#"#`#€@1 & ? "` !& ! "`  @`! " # # *  "㿘Đ @ и 7`@] X S `@M ``@6'`@/'`@('`@!'`@'`@'`@ '`@*ɴ'!  >   (@㿘,  %Ē"@"@ ?:?"6! #@b] # @Ē"@"㴔"c$Đ""c33 `@ #  @  2@2@`@ ` @% #!   €   $  $ 㿘  ")%/#7-@ 3 @ *`@ @% *`@ @ @* 2 2@#@ "@   8 6#?@p" "@$?İ? $Ē `*  % *   *3@ 2@$  % @ `*  %  @@< Ē$ $Āc`  c @" &c!` #  `!  v#`#  cc @" 㿘    Gp` 7%5#/@); -`c@ *`@ @&%# *`@ @ @ * 2 2@#` #@ "@#' @ 8 ` #c"  8 #`?@ =Đ @"`#`"@$?%##`$Ė*  `  &* %# *0 2  @7$@   @" (%` ?@e `   @" % $Ē $Ī @$Đ?$! ` ! . !  PĀ` #c ?@% #`#  cc @" 㿘"#"#"#" "b  !,!P "*  +@6 ,!P  * +  *"*   "l,!Ě #*  +@6 ,!  * +  *#:"l,!Ě #**  ?+@6,! ? *@+  $*#  2@  #"2``   2 ! #". @2``   2!! #". @2`` ! 2! #". @2`` ! 2"@!  "6`@ 6@  `@ !$t2?  t2?  H2? 0      ((㿘.`అ.`5+ ./`./ .*  .@@... .`@@ .`!ష.`Հ .` 㿐   #     '2@? c * @<* @82 #75,#,`@`* @  @ 2` ,  @ 7 $@* @@U@ & @U@@&<ё, D#-,   , #?, @ "?,  ?2  *` ? 2  ?2 "##%, `"?,`* @  "@ @T͐$6 @$, x  # * * 3@   "  *@  4@ * 2 @ 6  㿘?""= "`   # @  ద "఑*  +2`  `` )#     *  " " @* 4@ ("`?#"@  " "`  2  :   & ? #/- ఒ  * %%  %* %%*`% , @*@,@4@ @ @ @  `-@*@2 , @2 % n ఀ Ҥ`"`c`*"@ 9㿘?     * ? ;0 `"- .@0@ .@0@`@ 0`@ 4`H`D0`D0`H         ̲`㿘?   @    G#   ";  ,@@)?2   , @`@? @@ B?  4 H D@ F? @  J? @ @        㿘,"Y ,"T!," #," @*    ? 4 @ * `@"㿘>@ǒ @Ē @  #," @ *  @ & @ e?!ablock vanished㿘" "b*@ #?@#@2,@W,T",Q"b` 2`b` 2`@ " `  @n  ,  ? @"0'@ @\ "@’bb@P `,",b ` @ab  " @b "b"6 㿘 * ` " .` `:2 ?"  a*`  2 !# #> a *  !# #> a *  3@ "#*2@  "#"@* b* `+b" "* `#"* +b+" %䀊/2#*  !#c,!Ģ" .    @R` @"b2 @6`4`@  "#@ " @ 㿘 "䀢K"",!P!#,!Ā@  ,`  )`*`d@md`"@f$@#-`@* 2 `` 2 ! *`@@@S``"l$@@J"䀤 ŧ4$@B$-l used on binary file  (  (@ 2` (2``?0 0 ?  㿘 "@=!. ## c 4# ##  ` *@ # $c㰑2 *@  $c% ' `* $c@ c# 2`* $c@ . 2 " :3# @ "@" .  2  0`* 2 㿘# ,!##@# `*@  $##2 *@ `)$#%#c `' @* $#@#c 2`* $# # # * `"@@2# "#㿘M5# c* &c6`*@ &!##*@ &@#6`* &@!## >`㰔 *@ $#㰑2 *@  $# %@#c>`* $#@d#c6* $#@Z5#!c*  &@I %s: %s: not a valid zip file %s: %s: first entry not deflated or stored -- use unzip %s: %s: encrypted file -- use unzip 㿘 "#   * @ *  @@  @"  *  *` * Ґ#P" M H!c+` ""`M Hc0    "` ,2  "b, "bM Hcp@3+ "bout of memoryinvalid compressed data--format violatedlen %ld, siz %ld invalid compressed data--length mismatchinternal error, invalid methodinvalid compressed data--crc errorinvalid compressed data--length error%s: %s has more than one entry--rest ignored %s: %s has more than one entry -- unchanged 㿈 "#" @,","+    *  *` *   *  *` * +"`,@  k kg!" a`2`    ` *  *` *   *  *` * ?MM H  `a0 ` `* `+  *@2ږ @!H  ?!-+3'%  @` `$ @ c* `@&c@ ?@,!x@," (, 3%#`@` `&`@ ,  $`* *` * *+" - 3%#`@` `&`@d ,  $`* *` * * *` * #@# @]!#쀤@@V!!," E   > @  @ *   *` * Ґ#P.,+"x +"  +M Ha@2+b , "bM Hb@2+ "b$","" ,"",""  'H'L'P'T  D\@X'H*`   $ H2 $#  , @   , * ,`@ ,`8$  *, @   .,`@  "@  ' "    ,  *`#`" H`@* '? 'h'  h.@"-` U-`?` &/`@"  @*`@(/  "@/* ?'@T'  ` @h #` !# "$ "/ /'&@4@, "  " 4&/H(`   c/L   / 7 "T* @ L/"P* @ 7&4@ /,   ""*` /@@4 @@/? @ "  &+? @ WK` @ 㿘 ?@T5  ? 㿐'D'H'L'P-1- @#/#9Lc*7 P'*'L  @ *`%@n *L  D*  `'`cw $4 @ *`%@I * ,`  *  @`ݠ@ `4 $# *@ L@n'c `,` @ *`%@ * ,`P$  @4 @ *`%@ *P  H*  `)`c2 u $4 @ *`%@Ґ * ,`  *  @`۠@ $4 @ *`%@ * $# ,`% "@4 &&@ % %@#@@U@ # *  `@'c `ޠ L"#"#"#ܰ 㿘## 4& ##)'` @ *`$`@S *  `?# ? 4 '+)`@ *`$@5 *  ?#*@4 5 *?'+)`@ *`$@ *  #* 24 @C"# 4 ?"#"#"#ܰ x  "<" ?? x .   "@! !x .  !"@!  x .  !"@ 'pp#\x! !,L,#֚t ( .   "@ 'hh#\x  ,- l tt0 lph  tl  incomplete literal tree incomplete distance tree 㺐#`#!)'  @ *`$ @l *``  4`!!)'  @ *`$ @O *``  4` !)'  @ *`$ @2 *``  4P M ' '-+@` *`$@ *`` 4,  ,# *` "  ,#,   * "@ '#\      0   -`@* @+3/@ ``@ *`%`@ *`@ ` * @' `4$@`  $ , ` ``@ *`%`@ *``` `4`?\$?? T=`` ``@ *`%`@c *``` `4`?/ $?? ' `@ *`%`@= *``` ` 4Z` ?  $??   Y{"#"#ܠ!,L,-`d#'$#\  3M H@- a0. ,--`h ' #\  M H@,a0DB0G   75  㿘# #%)' @ *@`$@ *@  `&? 4`%)' @ *@`$@ *@   `4`?"#`"#`` 㿐"#"#"# !$# "#8 "$#c܀   "ܐ?`"@c 㿘  "c  %#  @c    @R$c쀢 $  ?  # @~#"  -?`p-t (2 - p:      㿘"  "c )'% #  #@ @Qɔ$ `   $    ?@2  " @ #  㿘!#  @$c# "$#㿘!#`#c+"  c@ ###@ "#$#㿘@Q`?&@@JM @ *@`J@2 @㿘@l / 2 㿘@c .  @"` _J@ ."*@@ out of memoryargc<=0㿘@ @O}c @R9@ @ὒN !А@ђN @}>N .N 2@@N:  $@@+  2@@6!@ &@@-!@$` 3@aд$N N " $@$` $ %s: %s: %s 㿘M Hc@*%s: %s: warning: %s%s 㿘+"  M H`@*ʖ+b  "b %s: %s: unexpected end of file 㿘M Hc@*`x # @ 0`@*㿘M H@*`x@#%2ld.%1ld%%㿘`1  @4 . "* * @H#@H ?`&@ - -* &@C ?`&@  * &@1 !@G!H@7 @*A㿘@M I!؁output in compress .Z format not supported 㿘.`x   "`xM H@*b+""  %s: %s: warning, unknown flags 0x%x %s: %s: compressed with %d bits, can only handle %d bits corrupt input.corrupt input. Use zcat to recover some data.㿈'D 'H@+" `"ϐ $+". `"`+"  +M Hc(@)–+b 2+ "b+b  "b , 'M HcP@) +""C !''?   !. *`!  !@P c*?c; = " 6   *    `?   D@O7@ ? @" @6$,  ! -` !'@P@'?@6$?*  "Ā 5-`?@6$?+"`@' (?' (?'=   ` ?* ` *` :   c*!. ?#(@+  +Hc6&+"x #,@  ,@, @  ,@?@"@,%$4 c@NƐ+ 2  Hc& @?@"@ ܐ$c@N쀥6 -2 *4C  +"   Hcc"c 㿘4<* &24 !!8%+) <!8& 4*@`44 $4 %!8?"$!8 $a<!<""!<!842@  24㿘a4 "@> 㿘2!4"!8"!< Bad table  Б+```2@ @ @ `*` @  2 7 О `+`# ` +` *@  0  #@ @ " +`& `@( :23 `   +`# *``2 * @:`  *@ +``@ 6  " ?*@#@@"4* @ @(*+``@ 6!* 2*   `+2@ 23`* * @*3*1*@㿘C  >  #* &*#4 !2@?0=+'#4* 2 ` 2  `2`@`` ,    ? , 4 #* &*c 4㿘    c*`a$c#/#2 ?0T@Ba#4-+)@'4* 2*   2` ,   2`#v  㰀        ? @㰠?*`@?*@`@4a !c*`ac!c 㿘1#0 t  �-!  '   !?!40* 3 *`# !"0 3  @@ .   !2# 㿘!4c4* 2* @  2 @ .    2`#  ? *@@㿘!"#0㿘"!@"!D㿘a@ ?"a@#@.@   9"a@? "a@s!  +"aD!.@ $0?$!@#&?c !@$c`$!@ @.@   "!@? $!@0ρ㿘"#" aD #+1 #b`!D#!D # invalid compressed data -- Huffman code > 32 bitstoo many leaves in Huffman tree㿘"!H H%+)`H*` $ ``% @!L `"r $'L  L  !)-+" ` % T $@ L ac   !L*` '" "P !P+-,`&@)`  %`! `-!L,!L*`  " L @  P*`:*`#` "?L  " @ (*` (*2?`@*`*㰀?invalid compressed data--length error㿘"#" %"#"c +) *!Lb* @?c@c!`㌀*` $ c% # $cc㌐" 2@# @ `"+0 `, c@ `㌀*` $` c% $cc.`㌐"2#  *ܲ`!L@"Pc.` P# *@  #cuc"$co!H#쀢@? 8 J  J  J(8  J  (.(@ @"@ `@*.(㤒 ""(@ @"@ `@*(. 㤅(@ @"@ `@*POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿘'D.. !"` ""#"#"#N - + "c"# @Gp h "#"## "J # 0!.##@  . # .#. @ "#.DD "  *@J@ -J` "#!. D (* @@3`x ".  ##@ $  Dc D. "D"#." . D  *##@2# ?@J@ -J` # .w?" # r K  -`? @"c. * @J@ -!J` -`# #L@ @`="`L@  @ )#@$@ 2#W$@2  .  .`M*`@  H@@"``!5# #.@$# "k."L@ + `.K"`. *`?J` - @M H@"2` !MJ@ H@")`!## @$# &!D@  ."*`@."   M*`@ H@@"a!##@$#N :  :!## @$#'`  "@ `. * @J  - #J +!. . * @J` -2 J@Mc H@@!Òa( Mc H@@!aH!h"c.`  a"`!# @`$#. :`#J`.` "``:2J. M Hap@@!." : :26. J :J ..)" ..`"  "`.D@ `. M Ha@@!a." N :   :"*`@." "#. > 㿘  ֚ 㿘̚ 㿘@$HLPRXfgorstuwxthe -R and -h options may not be specified together.invalid file mode: %s%s: %sfts_read㿐@(  @Hb5#'=@^ 0W* lx         @*?J@ -=J`  =J` $@@= @*`& @@    @lb2 `"@? @ ?А  # $c @  c  "$c c  c@J   c@l[  @UN   c@lO`@e   @ "'@f H  4? .* 000X 00 0XX 2 @g    @貲  @    @訲  @ķ0 2. < @T* 2 @qN ` @Į 0#  @c(@Gusage: chmod [-R [-H | -L | -P]] mode file ... 㿘M H@c@F 㿘@usage: chroot newroot [command] .%sSHELL/bin/sh-i㿘@ M H@`(@FƐ @q ` 2 @p P  `@D`X` " @` `@9`X@C `  hp@E  `X@'㿘@ lost+found㿘#p#4 * @@@ `" `  " `@ Ӑ $  $ " `@*@@ ɐ   h *@  hJ 2    "  hwrong type to dirscan %d 㽘M 0`" $@"   D  @S 4, D, 4` @< 2* @ * =  (`  4@;L @  =`   b7= % @< "'  `@E % ( @` @u   @D" , -`@ 2`  4       DIRECTORY CORRUPTED㿘 @ @:`4 @E a8  4  4  (/  6+ @@ 2$  d@+`p @!` " 6 " . . .  ,  $ ~B?[<   4  U   Q @M   @$     b a=< @9   3  /@/ *   >"""@$  < b <  @+!`p @ `6  , @ ". `*41 2. 2 `)  `  4      `J@/`  &J@J@`?㿘@%s NAME=%s %s=%s DIRFILE㻐 8@@@P @@*`#@@@% <   X ` h @s0 H@nUNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUST㿘@m .`T : @  @ Ea@@ 0?  @!H<   ` h."@4 @ !X.`T :@ڔ"@#@  6 @А @@!p@ʐ!#@ 2  @%y!  "@4 㾐 ,@D (/   ?`    ?   " 67 4    p$􀢠4 # @, ,  ,   ,@C 㿘 ( ,  @ O "  `p`$# @, ,  UNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u ` @Ci 8@f@<  `? 0 ` h@B @#@ ``  #@ 2 @$ P # @א @#` H%@2  /c|'Ē '%.@'쀊 ,$` @  `!#@ .@$k x .b @ $` @ɐ  #@   ` @e #@ $`  @@ %T @ <  2@Ɛ @$5 耢 ."  @А  $ ( .b@y   @v! /" ''#,``*`K:`# @2@ h#` J@ !(@ 0Q@` @a  !P@} @5 0>#.  ?72 ` ax@4 2 !` @@!@} ` @'4` !!#* @\3  !@#.`  2 #@  @ @ ` @BR 8 /#'''''@F@X C#?`=@; @B3 8 /"'?''@(` a aC * 2` @ 2 2* @ * @>`@В  @'^@@ @  NO SPACE LEFT IN %s (EXPANDED) EXPAND㽘 ( @ `P 4ٰ , ( "Ӱ   "ΰ @&`8 Ț+` ( # ($ ( 0 :  B>  0 h: @& h`  ( P* :    @  @  0 @ e<eD `L @8 ` t,`@@" ( 0@(` d,`@@"` 0b@  )."@@ ` 0"@  ,`*``  ( @ P* :    @  @  0 @ e<eD `L @ ` 2,.b`@@d #x@+#@ "@Ґ# @"# , @,` *   ( ("`(" (  0 :  b>   0 h: "@& h  8@&W 㿘@ `p`."0."H&@&` @`(` (@`4 2@@  ` 4b@@  %.@? ` 4b@@  . @|4   3#  @2& `h ? @Ґ @Β`h @*@`hJ  # . 2@,@  2@ @  @L4 㿘@ @?2 @㿘#`   @6 2 ?,$?@&>  0,@6s  #,㿘!#$ ?"@"$#$DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS @ 2&@&`$ >`< @@@(@'x @%( :`֖ ` Ѐ`x h xɰ @` "0b@> @"#x @?+  (  0:  :`@ B @ Ѐ@\ p2<@ :LT @:@B @ @&` 8&`@`+N`0 25``&2``@% !@@!"  2#`@`%@ ``0@5: : > @N"0@\"#x` &``@ r (`Ѐ@  ( `8 &` p`0+ * :  ; @ b @ " N`0&`@5 & `@$Ô !@M@ "  L` t  @ ʕ;  d $@ PARTIALLY TRUNCATED INODE I=%u㷐M`0  `@ 2`0"`@`  ``(``0@!^ ``0 :`` t  @ ;  &` @ t @ ; 8  @ t@``"0b@:`@"#xs F@B@  `"l@2, @ t 6&*` - 9  " `@ " @$Ē " $- *#t@!\-@ :39 `%`@_ M`0 `@# a@u@" `f *  ?%blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d 㿘#O@L (``@4@3`` @3, ` "`@3 | -!`@Ք`!@3{!x @3u, @ @ @3l@ |  !@ൔ``!@  bad inode number %d to ginode 㿘 ##8@ Ā`  @ x@ 5 (  @3 @3)   @3#,  @ @#@ @3 x%l `* @ ?"  0@ $l`x@3@3"` @ x l@#z * bad inode number %d to nextinode 㿘#D ` "#D#- @+ >`@`"@3`@2˒`` @2Œ, ` @#= @3u`x```t* `d @#٣, "b"c@% x!#8@!=#8"   `" Cannot allocate space for inode buffer 㿘" "#D"#"" @%<8 H "4"b @3Ӓ)% t @#!$"*  "% t$""!#8  @9z# $#8@"8cD  `#D#D 㿘!#8 "$#8@9$#8cannot increase directory list㿘 @ 0:  :` @ B @ 8  ,  $ (@9: 7#@"c,* `$@"$` $`$`$`$`$`$``$ ( , $`@;$` #4@`d"!#p@9R*` $#p@7#4#p*`"`"4cannot find inode %d 㿘#@"Qc,* @     2 !@㿘#, #4p* ?@  @8cp?#@8c,!@8#p$#p$c,l (%s %sDIRFILECLEAR (CLEARED) 㿘@ <  "("0"8 @@g 3c@ @y"@ c@ @޺"H"c@;4  h  * 㿘 ( @2   ,@;  㿘 ( "  ,@%  2 ` #@8 &    I=%u OWNER=%s %u MODE=%o %s: SIZE=%qu MTIME=%12.12s %4.4s 㿐#@_ 8#4@R#@H p " p# @E@A #@ " !@. @6   @0  @' 0@&%d %s I=%u BAD STATE %d TO BLKERR㿘!H@V@!X hJ@ "     h4  0   *@*@ hJ@!`㿐   hJ ^  #   hJ   *J#<@ @(@ 0<@ 08 h  h *@@  & ( h  #*@6@H(& & &  4 :">  4#": & h p #6` *@` @: 8 /" ''ڐc@9  h *@b?"bdfpnNyYb:c:l:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o usage: %s -p [-f] [-m mode] %s [-f] [-b block#] [-c level] [-y] [-n] [-m mode] [filesystem] ... 㿘@ @c+ *"a% )#!@H?z? +q* DllllllllllXllllllll|lllllllDllllllllllXc@ %c@, b`X,@v ""@ʐ `, c`,@g "c | % |, m`,@X .p""@ @ܧ  `$,#H ,`$ #H,`$ ,#H`8 @ =`@  & *@8@  @8bH#@  @8wb @8s`  @@7`  @ ?# 2 @9ސ-%c flag requires a %s 㿐@I@J@  P@Dufsffsrwro㿘 @ђ` "   @ʒ`Ȁ 2  @Ò`Ѐ "   @`؀ 2     starting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) %d files missing %d blocks missing The following duplicate blocks remain: %d, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** / ***** REBOOT NOW ***** (#@  @7Xb!#@@L | #@ @!p@Y?q  /#@ j@!g c@`""@`@!@7`@- "@/!@,!@j#0 #@ "@c!@"@!#@ @"@@#@ @ "`@ 5#@ @"@ #@ @"@ ! ( 8̠"<@-'@7 . * *  #`(b@.. "* * 4  :` @.ܒ@ @ǖ |   #`" "`$@ڵ#  | P @```,@-V" %<`4`$<`$<?@. $<`8@-Ec"@$ `$<@ڎ#8!#0 @ڇ#P#0  # @cx 2 @x#!" @q#"  # @ic 2 @b#"""#0L" # ! ( @  , # + (J` %` , ' ``@,`` @,ߒ, t ` `d @,   ,& @ @4#@4 h@4 ## 6#@ 2@ ##x @#@ # @` W''' Ȓ@ @`   #@ @ @`W 0 phase 1, inode %d/%d㿘 @`!`,@,v"p@` (` , 1 + `@,^`` @,X, `  ` 6  :*$  c -  *  ,& @```4?@-     :*$   +@  *  @6͔ 8 /"l'Ģ "#<""# /b ("< ,/     6  (`%`А@o  `  ,& /""<PARTIALLY ALLOCATED INODE I=%uCLEARbad size %qu:HOLD BAD BLOCKbad size %qu ndb %d:cannot read symlinkconvert symlink %d(%s) of size %qd bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%u㿘@< 1`(cȒ@ 0 `X 0@  @ `` !@ @b!8  c@5(  h *@ @"c  0 :` B`B `   | u`  @|!@o#@ <2@%!P ː`@`4 :<` !o4@ @`0 ;  @ E@;` `6 | <!`@C 6@@((p# =`` 7 862`h`;1`h ,"`(j #  x`@`d@\+ "@ !x |  !` , `  @_`(` @4~$`h @%(`:` `` `!`h  `B*2@  2 $   ( `t@*x?   4 ,  (`  | @׶   􀤀  ( `t@+  4  ,  X`  | @ד  @ }#`. 3 T` `"@1J  @ !@*"  "@ fb b"""b``  h  h *@ђ h *@#4 *@# `?`?$`p`4`$`tI4`" " &`P @`4`$@)֓:` &`$`h 0"(@ r#@ @"X0@͐"h s`$" h"p@ O!8! h @*  h^*@c@3~ BADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.㿘   ֐ %b `Ȕ  "` @ "#@ @ֻ"( @n"  "@ b  `$}/-357%+    d   :`#*J $ :  < %<  * @M* b8 i̒ ` % @ Ɛ"@#@ @%b = @ c @04   @ "X@b - @ S `"$%c0"@""@c0@ `@@ 2`@2 `2$  $` & $phase 1b, inode %d/%d㿘 @`!`,@(ʠ! @` @3t 8 /"'Ġ /!8"b<#0`( ,-"`ب -+   @6  ( %N "`h'J "   ` @   ,& /""<DUP㿘` 2`'-)  2 ؀     ` $ " $   2  @ բ`phase 2, directory %d/%d㿘` @ephase 2, parent directory %d/%d㿘` @PROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODEDIRECTORY TOO SHORTDIRECTORY %s: LENGTH %d NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..' h ?* : `l*`! ׄlL@ < 0@ H   X@ ``C!퀢 "T@ ސ h@ % @ T  .!퀢 "?@ ɐ h@ 27 X@ ``@  @u 5  !퀢 " @  h@d  X@ ``  / 2  hJ @   p   h *`# *` #!cp#4@唖 @1 8 /!,'# /#"<#4cp*`:`@ @V" 8+@@  `G%䀢` a a"$  % @ !  @ "c@ @@!P c@! >` $ !`@     =:  @1 7@ h ?H @0 $ ' 8'̢`@ "#p/ @N"b< +)'@  `?%  "<`  "8`?"5`  $  씔h@` "(`  !x ㌑* 2 쀔@` "` ㌓*`  2  *` ?2  !x  $ `@ /""<.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d㶀# `(@ #@#  ,`$   '@磒b "`   듒c` @$ "  p "``$  [`c  O,`xc8` p ' // "/7  @eax #H@ 2`$ 6, @#(`$ "7@/:7@/3 `$ %`$#+ @ @03@ 4@Q " `$ 4g` `p`' // /!x!x `7/`$    ?  @y"@74`$  %`$#* ?2 @/Ð4 @ `p`X%   T`ےc ,@ "I H @Βb   `ؔh#@q?6   `ɔh@c ?% ` % `껔h@.7@ " `$ %`$`#*` ? 2  "  `8 `$L .`$ `2L ``0v$@ "   .2`$``@ %`$#@ `AX p  `  2 ``  2`Yp $ ,@a "  h * : `#*` \`$ `/@; h`$  hJ@ 2 #@ {  `@  hp @<h @@ * #`*`2 #  &`$ $`@ @  @#@ "@-  `$@ h0`$ `%  p !# J @ `鷔#  @, " #*` ?2 !*@:`" $  @$$ phase 3, directory %d/%d㿘`8#4@㿘/"T"b<#4cp* ?@ D/+)-` %` `3   hJ + hJ &  `  hJ  @4 u ` ꐐ $ $ #*` ?2  h z*@#p`/""<phase 4, inode %d/%d㿘`# @TUNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d` @- 8 /" '/#"b<#  V #%"  h' * :  1*   l#, R@`b.+b2!{  @`(`8 @*`:`@ "@)$b  #  /""<㿘  `D '+)   5  & @)$0  :`c*`J $:@`""0   "0 2  2  :*$ c  * *+ #<?%#<`à phase 5, cg %d/%d㿘`8 @}DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ldFREE BLK COUNT(S) WRONG IN SUPERBLKBLK(S) MISSING IN BIT MAPSSUMMARY INFORMATION BAD?bН?c4@ @?#H@`(b`h` *@, ?0#5   X 4X$ !#@ @a##@ 2 %$@ # "X%$ "c,`X`$L$   #` `#`"LX`$ %$P@!, *  @:@! |@"ݒ`,``: 0`@"Г-@ `,``: ! #@!#@K%$#@ @ ^# B#@ #@P@!F, *  @:@!9 |@"`,`: $`*@", `,`: @ L#c ; @ @ B @ %* DL? "# mL T?c<@ @"?c8@` @`: !@?c0@@"U ?c4@P  @Q%P% T, % X@ P* % \,: @% `$ @ |@ @",| , :`  % h$ * @% l@ |`* @"`,`: % d@"U%  ? \c< T@ @" ?c8 d@ @" @ @ @+L    , 0 2$ 8 @+; $8 ?   :*$ c +  * " /#L"b< , @ " @"U " @ T @ N.@   @ q  " #Ԁ 8@Ԓ@ 7$@4 % % ,?@2@M5 5 &% $ $% 8@!{ % p% % $% %  ( @6% (% ( , @6% ,% ,U  0@6% 0% 0 4 @*   T T?c8@@ @*@L??0 c @C h * :  ,* <`TTT`  %  ?%  :`b \  ?$ /@ *`(  X*`:`@``"  :`b \  ?$ /@* ?%   81  :`c*`J ":@`28,` :`c ` ` `  ?"@ /@*8`@֖8]   % |@>@  -`@ T T @ "@|@*@O@ @"@E@@?P@@ t*  @-` Ԑ  X@*  4$ $888@ X  `:* l"@ /@&* $%8 $ % $ :`c `   4 ?$ :@ 8 "  :@ @ٖ 8H$ 4  l  p  h    $4*   "  +`    p瀈  $4*  "  $@' ' @'   'p l>@ *` .@ bأ*@ @@`x   $ $  $  $$ * D# k " \ " \ @h x@`  " \ " \"Ԓ @(b(`?<@E   T T  T T ?c8@@0@ "',@` " ,?<@'Ԓ  T T  T T ?c8@@@'(,`@/L""<?c4@@%P@  @@{`x  ==-- *`D/ / //؝㿘'H'L'P'T'XM H@הH@(s %s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. 㿘  / ܀ / @ې!@ؒ / ܀  @ΐ" / ܀  / 8@"@(8 㿘'H'L'P'T'X ͔H㿘'H'L'P'T'X H%s (%s)㿘 # !@ɕ#Hݒ㿘'H'L'P'T'X H@( 8@~Ւ / @5 <  L  r @E /r㿘@~ / 1,!@5 /,@` @ 0 /Can't stat root Can't stat %s %s is not a character device x /"  @6@, 0I@ޒ8  @ @<'< @!L@/`ؐ "`@؀  e @   @ `kŢ @K ` malloc failed㿘@#  @}ْbXrealloc failed㿘@#ؒ  @}Ȓbstrdup failed㿘@  @}b؁RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%qd IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%qx IN SUPERBLOCKINCORRECT QFMASK=%qx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATBAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead *#|?"ctJ"@   # !@ߠ `@ <    x@ "ڰ @   "`x # !@ƾ @Ȱ !#@  @ǶJ $  @l  "ct?#@"#t @Ǟ #@ 2@ǖ "#" ! (, ?$ $ #`H,`$`$`@!S$ @!P  $``2r  x@Ð  ("b"c""""#@  S!"؀ 2f #@ 2a `x@0 "Y @! R \@@HL @,@  8  , @$؀ \`@\@"#\!8aPx!@a! "ؤ c"  |  @J @"H @ р #@ "X""E ?#@ 2<" (    $ ,@""c 0 :`*` * ?: ` t @;  @E$` (  "@q"` " ,  (  <`c"@^"  "`<,  ( `$ @# #c@ "`@ƈ#@c@ 2 ,@8" ,* d (`  @&* @#P`!#@ "@c#@#@   @"  ,`* d (``0`H @#x`!#@0` "H@?#@#@   @#  ,`* d (``4`L @w#`!#@4` "L@#@#@   @ː#  ,`* d (`e, $`He0e4e0  J#`!#@ :e0@#@#@   @#  ,`* d (`%(`<*# <`!#@ "e(@ϐ#@#@   @#  ,`* d (``H: : e8 e< "e8   (`!#@ H: :;%8@Š#@#@   @P#  ,`* d (``L: : e@ eD "e@  ϐ P`!#@ L: :;%@@q#@#@   @!#  ,`* d "`p;  ; ;e8` L"`p: : ;%@# 4 @%, 0#@ 2 @ E  x`(` "e,`:%0` <"e(`H;  ; 88` `L : : :e@ +`* d# e @%L?a#@ 2 @ 耢  T `( `"L` "P`#\"T`%`#"X` `##eP@, *  `@:`@ `|@`,`: e$``*@ړ, `,`: (`L ; e@ B  $` (* d HL  "؀   `@ @!+`h#t@  (` = `  0"@ 4  @`- @ "b` x 8 @-  d @•* "`2`!@#  !(_`X` 0  Ȩ #`,`:   ?@  "c!0@J0N!# @  "`h# !X# @  "c#!@/`03# @   "c#!`@ *`0$"#4  @# $c @p"!$#pc@k #p "c,c!@*`0@? 0@  MAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATE㿘/؀2 #  @镕;   x`( @ 2 % -%  F\!T@b,`4b b0@+@%&hҒbH!˒b`#@4 d @n-@ $#@j؀`% ,H?@ @, @ h@@  2  "@ % "e   "`  `"`"`"`" ""b  *`  *`  *`  *`  X"`X  <"`<  "`  @"`@  \"`\ | "@b #T"cT"  @y`  $\@sd\  d"`d  "`  "` %P"eP %H"eH %8:8 %@:@ %H"eH %0:0 @ h & | @¼"  h ?+Ʀ@ " b$ @©:`  `ƒb@ *#| %s: BAD SUPER BLOCK: %s 㿘 #@ " !z#x@‚ǐ#Ò%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) 㿘@ʧ ?"  ?  Mb  ǐ# @ Mb ```*: :@ `` /!\*` # le  @%h &4 &8 &&$`0&`,&`84&@u`(&|`` 4?@m 8?@h@&?`&:``* &@"* &|?@ 8?@@&@ @|$&@ ?@ސ &,|`&d:`d` &d `("#ioctl (GCINFO): %s %s: can't read disk label 㿘e`e @ `   # !@"ؒȐ"bad file type 0%o 㿘< @@"%  (@"  @" 0 @ |@   | " @g# INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] 㿘#@  H@֒`hɐ x@:`? J $ #t ɐ @)^ J#H 2 ɀ  LJ $ Lɐ @L #)Lɐ @@ ? $ @  $,`:  ",` ?  $ @А 2  ,`#  ` %#  2 ,`:  y Y n N2@Ӑ x,`:  y Y  cannot allocate buffer pool 㿘 ("c$  0@"`l 2""" * ?" " 'P$  $P 0@($  @6$/ɪ?@b @^`0 `2$ `$ P`$P@" $P, $ $ "#\deadlocked buffer pool 㿘#P#P  @ d *@  "  2 #P      2 #P? @ "@ "`P& P(&P`" "P "( & 㿘 @ d .@ #t@  x "〔@_& & & WRITING %sZERO'ED BLOCK %d TO DISK PARTIALLY 㿘N` C` ` c@!!`.`.``&`` @ (@$ ` '`,`" 8@|  0 d"@ @t*@  @` 0  `CANNOT %s: BLK %dProgram terminated 㿘#@ 2@ xʐ"S h #UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) 㿘+ct  x`(dJ#| ') ; #  @A; 2@ "'#@ 2'#  #  @+; $ ,ct:'!"t4@& #P `"@ t&``@@ @#\@ʐ#"@"#$ "" l @ р #@ Q# # "  `(` * #t*` | !##c(,`* * @@ؔ@E x#t@ASEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,㿘># @;  @ ː" ˒@Ҕ\ "@  ː"ے @@~"?'/@܀ 1ܚ< :`@ E @ C   @V 㔀`@@e@a˔b@N   @V˒@D  ܤDz@@; xWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:㿘 `># @;  @  ː"f ̒@, >"c W@ 6ː"K@! &#)ːc@ c "c<  :` D B   @ʖ c@"@ђ c@@ɐ x㿘 l( 8@4g  @6`   `8 M (@  8#(N@&827 6   8N@(&86 #<@> . # @*.@#<@"#<8 @`8@ @&` `?a/?..`@ /2b8 . b8   h ?  . I.  "b8 @ 8/ '#@-.#'#|'͐ 'x4 "/#@'''k'' /@O$ @? /,  /Ȁ2'/""8? ?,|@l" 㿘# n @S returning to single-user after filesystem check 㿘@ǐ"x "c  @ 㿘@Ԑ  @  @  (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d 㿘 %  $ "' "N 0 %  #@ "@#  :#   & & q# /dev/tty: x/"<&€$  ΐ @  /"@@''ΐ ' ''@'ɐ x' '@ @㿘08(` .@-(/H/l `` @:"8  @2 /`/@(&/`8 (8 ܰ ffs_isblock㿘 8"0 2@ * >* >@*@   `?>@ *` @ `?E!ffs_clrblock㿘 8">0.@>*` *` @ * * .@ >@* * .@"ffs_setblock㿘 8">0ΐ .@>* * @ * @ .@ >@*  .@#8ffs_isfreeblock㿘 8 ">  0 @`?>@*` @*` *   `?>@>  #㿘@$㿘 2` 0#  ` 0# 0# 0`` `!#0# .`!0#`0`" v0+0@"@?` @ @ @ 2@ ?@  "S  J&: `@ *`@"&@`@*@*`&@c @ߔ@:6@?`@*@,' $&: `@ *`@"&@`@*@*`&@c @蹔@:@?`@*@ *0# b&: `@ *`@"&@`@*@*`&@0 @芔@K@?`@*@0A0=0# 6@"`0`" @2` @ @ @ 2@ ?@  "  *0" *㿐@ @' @ #0'@  c 2'@'@v9?# @w   @Cі  @m 㿘  @0# `@#@ :0# `     "  @ "@  2  ""` M `@Ϡ 0#@4`+` *  " "`@  @@`"$ ` " @* $ $  0# 0 #("6 ` 6* 2  8 @ `@  "`` x''' '''@0#`* *    #       @ 2   ܀  %  ؀@ # @  @   @ 2@ 8     @  @;@ 1 % @ "  :" `.   `` * @ . "   * @.   exponent out of bounds㿘  ?!"#   "   @ 2 -2  : 0 .2 0  :  0  ϐ   ` ,   ` @  / 9@"7 "`` `~ *@@N" `=4 =  `  " `@"  `<*`# `    @ `*,#)!А  ` " @8* 02 ` 0"   ` .  *``0 # ?!  0*  ` @*@0   ҄ R*  .㄄ ( ? 〒    * * `` 0  @0 * " * `@&* 0 ` `+ " `*㿘0at @ )0 @0"@* , @s`@$ 0?"a|0"!x0"!t?'" .`*  0*!!xat@* @*`  $` ? "`@ @  "@,0 ! 0!t!x@* @*`@`at  -"`` !x@ *@ *`@`@sK  @t at !x@τ!x!xat@s7  @t !x0"!|!xat `%!x?& '` ? "`@γ @  "@,?"  %? @r??%!x?! @tN 0!t"@ `"!t".`@*`@ ` @(  rlast character not record delimiterfcloseline too long: ignoring %s...㿘?#@@'L)0!  ! @'  %!'@!0". * )0/0 !  $!! 0@!L * a?@@]ch $!!* @@jM ! %!`? "`@ @  "@ ,,@ :  6`@ !@  @0 "!" *?2.h@ @ #p` ,@6"6@Β!?  @j c$!&Ӑ#@ 6"6 line too long: ignoring %.100s...㿘0a  @"a`'r Ր 8"`b. * @0`""!`?#0a 2#!0!6V?* @@ǒch $a!* @@i !Ւ`8" $!#`!0! ??"@0  '0* 2 "a0! ? `@ !?  @ic$!b. * "@* <`@x" 㿘0Ja  0*a!" ?#@&@ #0c ?# ? & @+  &$*`,c :  % 2 &` ?, ? & @  &c @2 ?#`?   @!#p0 # ,` $&`㿘 @>  @i 㿘  " @>Җ  @h 㿘". * ?@  @rx 2@a$@?'   N@p?#H &@ǒc(  ?` @!"' @' ''$''.7 77'' /7@Q^ / #Xc08@@ȳ?2 c@@#h P?@ȩ    # !@ܠ#H@@    # !@͠#P@!#8@;    &  r)8`@* ,@I @D  #h@qL좄!'#H !#| "@ s #|@Z#m @G   # !@z#H@I@2   # !@k#H@:<   #H 2 @#`8@]@@ ?"@J?`` ? `@M"  2@@#@Mb `` *: : 2 @N@# @N@ c 2"cc  #H @N@ؐ H` 2  H "` ."` cd 2  0 "cd@@ ct 2  , "ct@@ c\ 2 1 ( "c\@@ 1b?2 L "b"bc  1 J "c "c1  !1  " (c$ "!1" 2!1 @Z  $"1"*  4 $"!1"  1"@@? $ $"c 11"* "c1" 1#1b 1"?a!M H@`a@ݔ  $b1a? @ "a"a#t1!1@?"` B "")#t@cd1a+ 8"  %cM Ha8P@ѫ!c 21"2 "c'P!#\'T"#X'X a'\"@4"$#\#t@.%#t!#`@)$#`c@%%c!#@ $#@t!$b`&a"$#\:` #t@%#t!#`@$#`c@%c!#@ퟒ$#@훒$@#Xa b@"@ $`&a@;:` $#h  P@  @x#h @/@-#H 0!@!@Q'?1"0 ' ''#\#p#@J'\'`#`10@!   # !`@#H@V@ ioctl (GDINFO)㿘e`e@˔ 613c|  (`@l"( c|@5#0 @u}#1"8@-1!ioctl (WDINFO)%s: can't rewrite disk label㿘 ( 6O6 e`g@ @uT h x@㿘'H'L'P'T'X  @H   8 @v  @u@w$@@ usage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: -N do not create file system, just print out parameters -O create a 4.3BSD format filesystem -S sector size -T disktype -a maximum contiguous blocks -b block size -c cylinders/group -d rotational delay between contiguous blocks -e maximum blocks per file in a cylinder group -f frag size -i number of bytes per inode -k sector 0 skew, per track -l hardware sector interleave -m minimum free space %% -n number of distinguished rotational positions -o optimization preference (`space' or `time') -p spare sectors per track -r revolutions/minute -s file system size (sectors) -t file system type -u sectors/track -x spare sectors per cylinder -z tracks/cylinder 㿘#H M`8 Hax`8 Ha@Ϗ!M H@ϊa@φa@ςb8@~b`@zbx@vb@rb@nb@jbА@fc@bc8@^cH@Zch@Vc@Rc@NcȐ@J`@F`8@B`X@>`p@:`@6`@2`@.`@; buffer malloc failed mfspreposterous size %d preposterous ntrak %d preposterous nsect %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size (%d) cannot be smaller than fragment size (%d) fragment size %d is too small, minimum with block size %d is %d There is no block size that can support this disk With a block size of %d %s %d minimum bytes per inode isMinimum bytes per inode is %d With %d bytes per inode, minimum cylinders per group is %d With %d sectors per cylinder, %s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment size%s groups must have a multiple of %d cylinders CylinderWarning: cylinderpanic (fs_cpg * fs_spc) % NSPF != 0cylinder groups must have at least %d cylinders Warning: Block size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder %s %s %d %s %d.%sWarning: insufficient space in super block for rotational layout tables with nsectand ntrak File system performance may be impaired. inode blocks/cyl group (%d) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increasedFilesystem must have at least %d sectors Warning: inode blocks/cyl group (%d) >= data blocks (%d) in last cylinder group. This implies %d sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cg summary malloc failed %s: %d sectors in %d %s of %d tracks, %d sectors cylinders %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %d, %s/'D'H' @  "c@ @ "cP@ @ "c@ @ "cL@"@& @M#H ?@ ' @a@M 2@Z"@  @8Z ? @: @ @  %\#c@*cx ?@@ے$cc@\@ q "cp@ " 0#l "`,#?"e,"e(# "e, <"e(##"@M @Đ c\!#@ #t##d  #@9 @ `41@0#(@ "1 0"@  4@##@@ c\#p@ @   o# @ @ @ #@@~ 6; @ @w  H40 PH L;  ; 88 : :  8@<`P "`P# 4 " T<`T "`T#0T"`:  "8 <`` "``# 8   0 @ 4 @:@/ #\1"$ 0$%P 02 $ t2 4@$ x$ | $ d<`d "`d1b,1"(c4?@韐 8?@隒@7&4 @鑐?@鍒@*@& @&|?@遐 ?@}@&? &<`* "`c@c* "c  0 *` * ?:  ;%0: c t @; %0 B<%0##|`"ଦ* "X2%: "X <2 % cX<:  "cX"cX%#\`@cX6 `x?@o@紒`0 @* ?@ @穒@4 x `@:   |@盐    @畒:` ?@ @@牒$ 1" $ 4 $%$ +?#c %P@u,`*   @: @h  |@Œ`,`: %$@ 0 `. @趡*`,`: @@@<c 0 *$ 0<- #X*@$#X@1$ c8`* "8` "`c40@2 8@q @n @ `4: "8"`*|"4* "|c\@ @c@`"㜸 `x?@Y@$``0 @P, `x?@K@@n  j `8eb@ג"@5`@ =㜐 0 8:$ 0: `$ 8@$ `@滒$ @%P,`*  @: @檢  |@`,`: %$@ 0 `, @*`,`: @ `@`0*  "`0`@c@ܐ"`x )# 0 @ґ*  x?@͒@j@ !@b!"@ `` #@! !@@` # @!h!@@ !`# 01" !@a# 41" !@{a@ #1" @F" "# ""8"H @b# ?@h@# $ 1"" `@ @S"`x?@N@$``0 @F* `x?@A@ޒ`@  `"@$`@3"?+c %P@ʐ,`*   @: @形  |@`,`: %$@ 0 `, @ *`,`: @#@c `"@$`c@"`x?@@剒$`# @ @ | $  @| | `@֟* @@Ɛ"`@= 61"@@5 " @/# `@" `` `@    "Ѐ`""#@# @#0# "@ #P@2, *  @:@% |@悒`,`: $`*@t, `,`: @'㜖`L ; e@ B  #$`d`|: @$`$@W``$`|@$``@$` '` 4@3#P@敖  #$eL$`1"#`$``LeD$`%h ``$`h$cXePcX@Ē`@俧*`|``@*   h#\$eT%` $eX#%`"eT"eX #|`* * @#c!##``@#\#"#XD L X +"h ?#\c %P#,L? TP@g* 2!#%P#c#Xܨ !# 8@Q |@J@姒@i@埒@<@_@6@YP@/@,L`<.#\ T@* R? eL?2eXe`@@!*eL?2eXe`@@,L?.#\ TP@*  "-,L?.#\ TP@ڠ* 2 8- @-   @$ , `$ ,x`@: ,@$: 4@㯐 @㪐$#8`0@@$@ h`@@Y @㉒$"@C@〒 @;`2!!8 |*@ @r @Ð@: 8 @ʒ@ƒ@!`|@[!0@`,`'`?$`,@v$$``@J@`|$`$`d* "`#H ##%`dx`|@2: `` @+$ @z$@#,"pD"* L 0"2`  "l <`p "`p)# @  "`$@U!@̐ FT#1" $%\$ @1"1"$ <$ X# < @L$ \$ D$"$ $ $ 1"$ , #$ * # *`#@"`#cH`/$``$!`|@͠!H```"@#\#`4`$ &`&$1b F"`,`F`?"#`#\'@!1"4 @"P@ #`, 6@4 (##`@≒`` @⃒. b` `d @~m, @Ő" "@L@## ,1"4 2@"#h #H @ @\#cc\@$ 1b,@Dc  ##0T" < d *  `$ @+# 0  #c , 6  '1`@`` @. ,d @ , , D(` `4 ` `;(` #H` 0`@뉒 @@뭐 @뫐 @멐 @"Panic: cylinder group too big 㿐%`@А`$4``@ƒ/@ ```  '``4?@ !#P$ /` @e'@#P"U$ $ $ `,?@2``@`4 4 '#cP`'4 $ e$ cP`8@ $ pcP $T`, $X`@eP* $\`,: @$`e$ `@q``|@m`@`| , :`  $he$ * @$l`@[``|``* @`,`: $d#P#dࠐ" $ @!@  %฀` '"   @"U P` :@`\@  ?$ +@*P` ?"`  ') x ` @n: ,` 0 2 #@#,  c"l`0 2  `@`` @/@ `0#``d @, 8Ϥ @6/1@"U 8@3#P@`@}%$ `#P`; +  l$@    * @* #P`㜐 $` |@ૐ@  `* @ T@`T@ @ "@`|@`@Ѻ`@@`@Ѱ@`@ѪeP@@`#P* `@ @֒*  Ԑ@ `X@̠@@i*  4 8@@#`("`()#P# ( 8"@ $ (@p 1$@*  4`" 4 8"'@"U P` :@``@  ?% +@*P`$ "`$ 8'@ 4'/@"U  8@gP@`@%$ `P`; +  l$@    * @* P` $` |@ߐ@> `* @ T@`T@ @ "@`|@ː`@`@$@`@@߻`@ޒeP@ߴ@`P* `@ @ *  Ԑ@ `X@@@ߝ*  4 8@ @ '@'@ 0@"U "P* @`4  "`4``P`:@``@ `` ?&@ +@@*P``$@  "`$#$ 7 #Pl p h @      $4+    "  ( @ @p瀈  #%$4+   " ##P   $ $ Ē@$  $   $  @ ` `$ `  @   @/@  0 @ d@ @,@㿘"`"`#H "` #!2# #l 4 2 1"@' : < !#% 4@]#$(L@ :`B *2  2 $h4dL@* @} 㿘" @#L ` @w4  @$!,`@*` 2` ` @f"cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 㿘#c!#P` `d`@%*#P@`"U."`` 2`'"x " P`#c``@ 8@ߠ@ P 8` P"@ 0#P@ "U`> # ` @#%$  #P :* l$    * +* #cP c?# Đ?" $@ ? "  #  " "c |@@F cP@bU * `TT @?"@#`|@А`@`@)@`@@`@eP@ݹ@`* cP@`bU  @ *  Ԑ@ `X@@@ݟ* #?4c 0"J 4@ `$ 8cP "@ "  8  8"@ $  $"@ # $ 8"@*`  4`# 4 8 ' @"U  ,P`:@``@  ` ` ?"@ +@@*# 8䔆 #P#` `d`@F*fsinit: inode value out of range (%d). 㿘@@@!#Pc& l` `d`@*#P@"U" @q"`@ ?" @ 6`b\ ` * +@*c#P` `d`@*c`$?$`?"`,@@*#@@@緐 @ݡ@ @ޒ,@  @V @ݎx`0* d, @c x@G* @杔 c`0@@n㿘@焐 getrlimitsetrlimit㿈#c@ 2'@觐 @%?$c@*@@蟐" @L 6 @x! @?耢 6@x!""cx#@x*@ 8 " "x@v 㿘    @;@㿘@Y  @ seek error: %ld rdfsread error: %ld 㿘#H  #\@8p@  0)> #\ @O;   0@i 6 #P@p@x2#h@ ! 0@埔 #p@a@x##h@Ր "wtfswrite error: %ld 㿘#H  #\@p@ʐ0-#h )> #\ @ ;   ,@$ 6 #P@+@w p@某 # ,@B  x@@wސ p@搐 $isblock bad fs_frag %d 㿘 8"M" H2M@ * >* >@*@  `?>@ *` @ `? H 8@Ha clrblock bad fs_frag %d 㿘 8">M HM.@>*` *` @ * *.@ >@* * .@ H 8@bpsetblock bad fs_frag %d 㿘 8">M HM .@>* * @ * @.@ >@*  .@ H 8@ݒc@COLUMNS㿐 `h@䷔?2  @   @ " P㿘@ -%c %s -%c -- %s 㿘@¢ = "`@' %!`@,`?, @)@% @  =`@6%  @* @@ @ $ @@  @僐㿘@X            x unionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:kernfsFilesystem not supported by kernel㿐@,%'# !@? ? oc,!@F@.= @&*  @@#`"@   # - @ ܒc@;~  usage: mount_kernfs [-o options] /kern mount_point 㿘M H@͒`@ڐ ,-o %s: option not supported㿘@tC  @;R @1`` 5L n L  o  @~ = 2*@ "  2   @2    &*@&`h@ vȠ @㿘@call completed call aborted call abortedinterruptunknown ACU typecall failedr%s: can't open phone number file unrecognizable host name missing phone number㾐R!|'!d`'!  !@>@!a4#  ! @⢒ @⟒@ < "'Đ @▒  @ⓒ @!a 4"t @ ؖ3 @` $!L 8 "` @ 11!@1!#3 $`@1"K @5 4"tL@  K , 'K K + '!@ € q"`8଒@@   'K 01!h@Db0 2 !h@/"81"@+4"t)!@_ g'K@b`  'K s+ '@ K@t"  'K a  K   'K  ,K 2+!@ € "`8@d!  !@W@:଒@@ 5 ଒@@   '@A  343# a@@ 0 @  " @&1 "h@!1""call terminated disconnecting...㿘 8  a4# @ Ö0#4!4"t3 a@@ T!N  @e# 3# 3@@ a3 @ 㿘@I  <@ 㿘3 `  @ؐ   2 v831vadict3000courierhayesventelhourminutesecondLocal file name? %s: cannot creat List command for remote system? 㾘L`. > ?"`` * "@sD!HĠch@$ @@ )!#ŀ $ct!`@0!x@ ! 4@0"ct@[[take] usage: from [to] %s: cannot create cat %s;echo 㻘"Ġch@ Д$ *% h@B   @"0h$ @a @ ؒ! 6 @"0 $h@o@ %d write error lines transferred in 㻐'H'L'IJ a@#Ŕ@Ӓ"#(#h@૒ Œc#@  /a@ a@ cx O ` ` 2  @ ^@쀐   @5c@ܐ ( @M 4"t!@c  #x$  O `( 2/3*`L@:  -O`&` "$(*O  'TaN `#@`"(H@@#А &('(   H@@ݐ#4R#€   !@w#"@  @ 4Œc!\@  @߼@2HLocal command? can't establish pipe can't fork! can't execl! 㾈"آ@ Ɣ! L@  @"0C@: @#0;'!x@ !  @@@̒ 0*@  @uc4" @m @%E쀢 0@7 @נ @Ր  @@\#@Ӑ 㿘Đ "c, @I r%s: cannot open 㿘L`. > ?"`` * "@q|!HàaP@ H$ @@/` 2!4 @0 "t L@ T!~ @c! timed out at eol chars transferred in 㿐#h@B "#, @`x  @ Œc#@   N*`@8: N 4R# !@   @!!@_  @i4"t)+-Ĵ  ? & @  &#, m'j``T!ހ )`%` ` T!ހ  'T!ހ T!> @ @  @ "T!NT!ހ " T!N #@oT!~  %c`!#@5Œ@ޚ c``#,  `@Wa@   x L   @   5R R @  N*`@: N @̐ @ @4"tRaN  Raހ !#@$!\Œc@.   @ #4[put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo 㻘!Ġch@ $ 5!¢ h@z   @ِ!0& h$`@ h@ݒ` 4 @Ȓ0R# $`$`@b timeout error (%s) 㿐/!@  4R# "5! @@M$#`%@̔ @F #` !@ W#@  `3a@@  5㿘 @ncĐ "c`can't find `%s' away for 㾐@ L` "@ . :  * "@o "ؒ@ f! a#h@݉  @6  @3   @ PŒc#@h @8N @)#)4"@~Ő @" 4R#! @5O @݃   @  @ @  @@z 4R#€  ! @~ 0"@ǐ!\Œc@   @ 4 @  @ݒ 㾐@~ L` "@ . :  * "@o "ؒ@ ! d#h@  @ܲ  @ܯ   @̔Œc#@ @7 @#,4"@~A @"n !4R#! @4ˠ @4Ȓ @   @~  @{ @  @|@ 4R#€  ! @~ 0"@@!\Œc@܉   @~4 @Y  @V [sh] ! can't execl! 㿐 @O h @D  @A @ ]@7e  @"@ I @8 p @-  @* 0@'  @$ 4"ta\@4x /  a\@ &4#В@3  @ x@ݐ  can't create %s 㿐#h@P 4"tT.   !\@ @ a!\@ #@' O n  @![cd] %s: bad directory ! 㻘 "@@$ !T 4#@ 6  "H@Œ @"` %s [EOT] 㿘#h@ - "  "@ @"@@ :#@@ 㿘5 ` !@@۲@\ Ր 㿘@Ē "#(@ؐ -c㿘4"ta\@3ʒ /  a\@x4#В ؖ@2P   J(8  2J J J"@J  J  J`"J* J &J %s%d %s%c 㿈 3!4,@@$@@0` !@ "  !3!D, ``2쀢 2 2 `@   s@~, @~ p[set] onoff㾘 "@! H@ F4"t   ?, #h@  !%  ?,!% !  ?,!4"t   ?R.`*4"t  ?R`* " "@4"t  ?*2!   ?*@ > h!@XȐ @+b 4$'d4 ;'Ȓ {"4! @Ȑ  @4㿘`{!!@” @[ `z!@ڻ 㿘@|. >   @@ڦ @j~{[*?$`'"\pipeecho %s/bin/shfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" 㻈'D @`p D@%  @l zD$ D@@1 ?4#Ѐ   @چ@ڄ @@ڀ@~ @ ؖ@0 @!   @lÐ @l@jI @f`h@)$@^@쀢  '쀢 M H @I`.  @l ' $M H D ` M H D`@/ 0 h*N`   (*J  *1 h㿘 N@ "N    send breakget this summaryset variablesuspend tip (local only)suspend tip (local+remote)exit from tipchange directoryconnect program to remote hostpipe local command to remote hostpipe remote fileput file to remote UNIXtake file from remote UNIXsend file to remote hostreceive file from remote hostshellusage: cu telno [-t] [-s speed] [-a acu] [-l line] [-#] cu: unsupported speed %s Bad flag %scu%ldall ports busy link down noneConnect failed 㿘  @}  @ڂ ""Đ$"a'Ģ   `@J@ -Y"!dJ` a"` s 94M@ 0&J@2a"  t l"'`?@2=@ 4Đ?2a|9??$a5` M@|c`@-  M H` @/a @< @|U`$`??$!` " !@@a ` *?! "?@@! ` *? @|!@? ` !!<@؏ @، @؉ @؆!    1!@iP@L ? @|}!X@ 2 L @|v!h@ #@ #@k& @!@X@  @!x4"#T!Ȁ @!@z " T! @|S!@K@ #@Ő  @!@d㿘’ " @䐐 ȁ`'D @+`'@6D \'" @0y /Đ @ ?"c R!Ȁ L@Z Ȁ @ʐ 4R!bt*  R    @"a@ !! @j "` "İ!@в4R!bt*  R    'В !@` !@+  @В @ i#0@Ȑ  ?ātip: flock???%s (%s) <%s, %s, %s> %s 㿈3# 1R @y~  @jp"0'@0  @@" 2"@y< '@e\*#\#`!3b#@b@͌##R @yR acan't open log file %s. 㿘4"t @{c3 "cM H @Ғc؁ !"$'(+-.03569:" " $ z"  ( "$"(" #c4"* *!""ؐ"" " " " " " " " $" ( ***** *@X" @;!X@8# @8c#$ ##@w5@.Sŀ "ch@@@Ԣ 㿘@@##0`#0  @h`@ԏ 㿘!" @#p $"㿘!" @#|$"㿘@#@#p㿘 Ē @4㿘 Œ @%s㿈'H'L"!T c@'' @̒ '"H@vΒ@ " !H3Lc ? & @c  &cH*`:   *L'L'HH*@Ҝ @ҙ !T 2 H􀢀 "  㿘 @҇ Đ "aT@v#"@ڒ %c㿐4"tT!.  @S k'L)`? $`@J  $#x  `//OL o@đ, #l FO@h/*  "`=O#$  OL @` T `?$ 쀢` Ē!@ T!  @v,#`#$ OL @O`? $`@  $#x  `/O@| \T `M"  G"* /!@` T! "`O@u#|`㿐4L "/? "@   "#x  `3J!` !*: #J 2 ? #p   @O@ubH@ J  O*: @!@ 4( (@`@ `" * 8J@ ` `2J@   J   n r t fEb J/  ^ ? \K` `*8H H *8*@`@ *@2 *@*@`*@*@`*@` Jِ *@!* 8``„ ^(` @ ?(((("%c %2s%-2s %c %s 㿘!h. @u:`3J!`&!)'4"t!x ? #p 2 Lo@tpL? ` *@t L  h#Ġa@ɝ@:@;?А @c'4R!bt*  R   'А //Ԕ >'Ȑ ?'Rធ zw 'Ԑ'a @ʔJ H/H/Lost carrier.write㿘#x    š"0   @ + @С   # 2#`@c9#pnoneoddzeroone%s: unknown parity value 㿘4"t ""  `@ Ő ;"cx"#x  @ߒ`  @ג`  @ϒ`(  @ǒc  !M H`0@@) –"0 @  * ``$ 㿘!Š##@, !X@? "@X a㾐%X@0 O $ 8 ,,X@" O  ,4R# # "@a24"# y/@sܒaĀ "c n/ y/4 "c#@ݔ "@ 㿘4R# # @3@" 㿘4btR``?"` "@ 㻘 @ώ  @ϋ  @χaܐ !"@ς @~a @{ @wc<@ۻ" -4"t+!@ϩ$  Z # V@f@@b `x L `,  x @lT. 6c3T 2 @0)&  ^*|:  " c`L?"`` @* "@@ad  * @ā/var/spool/lock/LCK..%sCan't open lock file. Can't read lock file. Stale lock on %s PID=%d... overriding. Can't seek lock file. %10d lock write(!@Ö*@! L @  @aM H@5a\?@ P 4 ,@a@.M H@#aJ?@}@  # M@:? Ha@   @ύ  @a[@@b!?@b(@a%@А@Ξ@  @@%@a5"0?㾀!@I@Home directory path too long: %s %s/.tiprcrset %s㻘4"t`"t` ?  @@ 2$ ? `$@  4"t@|al $ M Hal@`X*4$al@@r'` '%#@M  @r @&W 2*@d@4bt `u ?*`uaccess denied out of core 㿘N @e  2 @q"0@  "0N@  "  4 ! "*N .  " @d (  P@˹ @^ & @q"0  ?.   &  !V @ N@ &   . all 㿘@1cP 4"t`"tL @   " @y  2L  !4@0 2 @ !4"4 @qr#X$"4record%s: unknown variable 㿘@y =  ,@ ; `  @pd03@`  V0%@y ? "N,@ǐ L`@  @0 ! @ 60 (@q%s%s=%s=%-5ld㿘44 !``""4 #Lc  ?`$  @ c* $c@_A4 `"$4p!4"4@$"4   "V   $4Pb4. 54Jb4 2B`L$"4?`"@& ! !* "@_  +@p!x"4  `$$"4 D 0`$"4 @p!4@p!x"4  ` $"4fN "4$"4@p!p4b4 ""b4@p#X㿘.`@  .`@ .`@ @`?㿘4"t`"t@   " @    n r t bf  (R *`8: K\ ^2A*J< *9  Є (8K * (8J@!``J@*J/ 74?(J`/  `74?( ?* @** ( *((` ?㿘~ 2   "@oz @w`  parparitylelocalechohdxhalfduplexrawrawftpetetimeoutcdelaychardelayldelaylinedelaytatandemdidisconnectecechocheckHOME/bin/shSHELLverbverbosetabtabexpandscscriptremoterecrecordrcraisecharraraiseprpromptphones/var/log/aculogloghohostfrframesizefoforceexexceptionsesescapeeoleofweofwriteeofreofreaddialdialtimeoutbabaudratebebeautify starting call...K can't initialize bizcomp.... can't set dialing mode...D%s 7 can't get dial tone...ringing...1 %d second dial timeoutbiz1022 4"tTN @n @! %!!8'@@u/р "!@ (`@Ŗ!@*@@!h 2TN!p@nϰ 0! "@nȐ!@|!#5`Ԁ`,@]Za`Ԁ @W㿘c(V㿘cH㿘ch!!@ʴ @K !@ɒ 㿘!c@ʤ 㿘5 " @А"؁㿐!@@ʐ @dc'@֧"؀ 4@"!@ʖ @ @Q  / @ ǰ @E 㿐'D @=c5D"`J`%'@z"؀ 4@"!@e @ߐ D /J 'D DJ @ 5 Ԁ`?Using "%s" can't synchronize with courier couriercan't synch upAT E0 AT C1 E0 H0 Q0 X6 V1 OK AT D %d second dial timeoutcour4R#€ @m!#Ġxa@œ a @'@m @m̐!4#  T aa@ @JԐ a@ aa@ @y! L@#ba@ N   ,J@ ="*@`J@  =#a@@ba@{ @%535a`$!4"t ,@\b( a @㿘`x!!@ɷ @J} `y!@ɰ @@!㿘!b@B timeout waiting for reply 㿘@mC 5 "a#@Ց 㿐'D @,`'5"!DJ @!   @d# 4@"!@R @̐ D /J 'D   @  9600/ARQ 9600 2400 1200 RINGINGCONNECT%s !  | a@ @@ @A a@x@ΐ i @ɒ`'x' ?'|@k @5"!@# 2P4"t@r`,!@ @j A ` 1/s! 6O ֠@7b TaN 2'b@  5!`!@  #İ  "* '|'|"@lqx@f   AT Z +++h !İ!@ `0!@J @k (@In b!@ȡ̀ !@Ȃ ('̐@t 0 20 @t O  @t K " @IK `8!@ @ID `x!@w @I= `y!@p  `!`0@  㿘@d@ @) @[@`X$`''$` @؀ ;'''@#5L@$`@#* "@*`@*`$` "'''!$#P @ @#P 2  ?#@Ґ #P  @  @s@„  P㿘@ 㿘@ connection timed out dialing...X'D'L'/Ġ!@L'  @'@#X @k|#H@j 0f4R#€ "L@kq#`L@r#L`Ȑ '@%@ݐ$'@$@$ @p `k `l@ǝĐ @Aa@ȔD* @@` @z cp@[ @HQ cx@T @D@ND@b L`d"OàȐ@ @ @2OÐ A`?㿘cp!!@+ @H! !@@ 㿘㿘#X@O  starting call...line busy...acu open error...lost carrier...dialup line open failed...84R#€ 'D@jԐ!@ € "c # 2"" @j° 0~@# "  5!@ p# @Ʃ`@D* @`  @[15@! &!Đ @Ɨ  @Ɣ  @Ƒ @G #@D'D@Ʈ @@ !@C Ā "a # 2"8"H@jv@( 5!@Ƹ )#@ !#@& # @x' @S @ +!Ā ?L@T#@ƽ#  !@ƴ 㿘@ #@Ґ 㿘@GN !! `x@~ @Ɯ!㿘@G? 5!Ā $@h # !@Ɖ! `x@b @ƀ! dialing...ATv0 ATTD01234%d second dial timeouthayes@ 4 R#€ "L @i!L@##Ġa@ a @'a@  aa@ ! !@@ aa@ L   ,J@ ="*@`J@  =#a@ @ђ5 "b! !a@Ȕ @k*   @e!ȑ* :  1" @ 5 "b   "b!@Ē %5 !4x"t  ,@XaВ   @㿘`x!!@Ź @F `y!@Ų @㿘! a@w timeout waiting for reply 㿘!@iF 5 "b#@є 㿈'D' !@.`'5""@o# @# $ 4@"!@Y @Ӑ  /@fD DOJ@"' 쀢 @  OKCONNECTRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)㿘!@h!Ȑ?Б* : `+*`!"t !@hА!"!!@hː!!!@hƐ!!!@h!!!@h!!!@h" !!". :`@h !@h!ȁATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 㿐!!@Ò @F ",!@E !@ !c0!@Ě !<#8* :  0 3!@hm#@!@hj#X@E b!!@IJ!c!@} @Es !!@ `x!@Ģ @!AT Cannot synchronize with hayes... 㿐 1 #"`!@Y @EO b!@Ă􀢠(! (@a'@pk 0 2! @pe O  @p` K  `x!@` `y!@[  ˢ`"@h  Using "%s" can't synchronize with t3000 t3000can't synch upAT E0 AT E0 H0 Q0 X4 V1 OK AT D %d second dial timeout4R#€ "@gѐ!#Ġa@ a @'@{ ""@g!4# ""T b a@ @DĐ a@ "b(a@ "@y"@ L@#"bHa@ N   ,J@ ="*@`J@  =#a@Ґ@"bPa@ @%535bL`$Px!4"t" ,@V bX" 밖bL P@P㿘`x!!@ç @Dm `y!@à @@ü!㿘!"bP@U timeout waiting for reply 㿘#@g3 5 "bLÐ @ρ 㿐'D #@`'5""LDJ @   @T 4@"!@B @켐 D /J 'D   @  12000 7200 1275 7512 57600 38400 19200 14400 9600 4800 2400 1200 RINGINGCONNECT%s #"h  | a@ @" @# a@Քx@° i #@«`'x' ?'|@eb @5""L@ 2P#4"t@T`,!@Ӕ @L A# ` 1/#e"p 6#O ֠#@{bx TaN 2'#b@z  #5"T`"T@{ #İ  #"* '|'|#"@fSx@H   AT Z +++h !İ!@| $`!@O @d (@CP b!@ƒ̀  '̀ !@_ ('̐@ni 0 20 @nc O  @n] K " @C( $`!@ @C! `x!@T @C `y!@M  `!$`@  㿘@A@ @ @8@`X$`''$` @슔؀ ;'''@#5@ѐ$`@#* "@*`@*`$` $#'''!$ P @눔 @c P 2  ?#@믐  P  @u  @P@느Ä  PI  READYcan't synchronize with vadic 3451 vadiccan't synch upD NUMBER?Vadic will not accept dial command will not accept dial%s Vadic will not accept phone number will not accept number DIALING:Vadic failed to dial failed to dial dialing...ON LINEcall failed call failed4"t!$#d$  `@@@$#`@$@#  )$@e#଒$$v!@ʒ Ę#4 ! @# @B $#@r$@#  %@d ଒$%R( 2%@@Ȗ@Y@n 2  %@dِ H଒$%:p@Ȓ !% @B@?%@S 2 TN%@d ଒$%฀ "%%@d %@= ؠ @ %!@ޒ   @d ଒$% 㿘@!㿘@!㿘N  !Ē!@ @A N ""FAILED CALLX'D'Ė '%@yc G%/D@x`؀`?'4"' &@Na`@̒ X  00@ - @Ƞ%&#D@- Ā@" " a@h    *'*@Ր  㿘Ð X@n 㿘 N@@ ` N@   2   J@*`:  `? starting call...line busy...acu open error...lost carrier...dialup line open failed...㿐'D4R#€ 'H&@cϐ"H@ Ā "a # 2&&" "0@c 0^@!  5#|@ P'@`d@D* @`  @W15@ &#| @  @  @ @@ D@H A@@ !@F Ā "a # 2&&"H"X@cy@+ 5@'  @h @@#| ?  @!̰ 㿘@ Ð!@˫ h@@i #a `x@ a@@ @  a@U`a@ @a㿘@@G 5#| !@p !!̀ !`@n @!!! `x@d @!/dev/cua1/dev/cua0Unable to locate dialer (%s) `@L@ <5L` 5 Z#` #@w "   23'!@bےn Ka@@2)`@3)`  a̘ 'Ж @'a@  /Ǡǒa@ڔ   a@/ǒ  a@/L@  @`<  /Ǣ`!@ L@  @ /Ǡǒ1!@  /ǒ!@ @? !@   M/Oǀ Bǀ G2Đ /ǒ!@ Ƣ g2 @V ,(` U(  gh 8  * *`  * ؒ  @ @@ ˀg@+ @T  @( &  >@    *@ * @ *@ &` `  `* +  ` *  :@]>`  `@V @S㿘  @L&  㷐 U@ R`@4 @L``@G@* 2` @ : g `  @ ,(` ,h' 2h` '@8' w" @'@@   B<@& @hB <@2@2&     ":0 " 0  @  : ` :??0  $2`"`"`  :`0 p  @c@% 8 'pt@b , #\ $#`ab   @`?  2 H "`؀` 2@C  " ذ?㽠P  @,x 'P $` $` $`  $` $$` ($` ,@$` 8 t@ $`  ab  h `$#\#`@ ?  2  x && &&& 0&$&(  D@&, 㺈 ? ?a b?  (`? #\$#`@b ?  2  `  d@Òhd .@ ?nfsread: short packet, %d < %ld 0 ' #  #  #  #  $#  ($#  ,# # $# $# (ab $L ,#\#`@ ? L `"`H 2" ؒ?@T@|0  "@ 2 H"`ذ?㿘@ 2& 2 "` ,`"`6  1c 2 ?& &` ` !"`"` ?nfs_open: must mount first. 㷈 1b b @B  N n`/2N N /" N ` 0 \ @; x   $<N  /   I  N  /.Ȕ >.0 . 29 1@@ $) `` &`;@@ߔO /@" x@ x @ x N  ` 1&` "@ x@ x㿘  "& @ x&  nfs_read: hit EOF unexpectantly㿘' # 2! 2% @}   ݖ? `  !T @ ; @  & B> 2&       D": 0 0   @  :  ` : ??0   ,04(2`:2` <"` @"`D :`0 㿐`@O`0@```@Ԓ`@n`` @h,@ ` @% @`x `` * `d `0, 2`0`0@"`x @ *` @ ?" ? 6" ?%`0@5㿘` `.`@ 8 W& `@&@`,F D @>`h?  "9& @ 0$@``d@  0, 2 0@ր$ @ @@,`ɬ& 㿐   `Pe<@p  4`0*:  8  2`0 8e<`0e<eD `L  Ȁ)t 2; @n`0$  " @1 `d   +   0 @-$ $  $&@&   b 8   @   " & 㿐`@ѐ  `<@@.  0 "  2  @  2  &*@ B`<@@@8Ԑ2 ``@͐ 㻀 @  Ц@ Ô &`@ @ $  ``` @2 e\F!T@ `0@@eg 0   `t@`$ `  'b  L@  @5<`/2L@`L@ /"`L@"s   ג  / ``4e `L@  /,@P谒 X,@/ S (  2HL@@ $D  A ;@ Ie( 8@ \ 0 T䰒 ) @ ` 0`  d( @ #O /' '  L@  @  `0@ V @ P@ M Ё㿘 `&   " ` 0@ <    `` 0@ 1 `@ .@ + Ё 㿐 %`@@8 ``@F @ @@ B<@2&     ":0 " 0  @  : ` :??0 2`"` "` :`0㿐`   <<@`@@82.@``@.@.?,   " #" @ @ B <@  @  @ B<@ rarp: bad socket. %d No response for RARP request O   @ 0K? @  . 7Ɛ(3` +` +` 3`` 3``~3` `"p3` `3` `bD3` `2 4#\@Ζ .  @  ?` 22b8`b82 b8 @ 0 , ? @  ,??"a 2"8 $`㿘 ,h @Ԙ 5㿐@ 2!"`  5@2?@ 2?`(2?`&2?` 2 ? `@  ??bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p la"'ТА $`$` $` ' 2b8X@'䀢 X??$ab  ,` ?#`2 !#\#`@#@   @ b#(<?# 1a! 2@Q! a4!'*@k2 ` #P@ I#?' 1 " ܐ 1a@ ? 2"X 1bh@wX  ? 1@a ? ? 9 P'' 1a 1 @H 2C?@ @? :?ab , ` 1?2 #`ᔘ"#\"#` @x#@ 4' 2 H"`ؐ '@( 2?@I 2?#'@ ? ?㿘`&"@  &@  㿘 &   ? @&@ .@& @"  #d d  e  f g #" ?+d +e+f+gd "@#callrpc: error = %d  . ..group܀ master.passwdpasswd protocolsݐ pwd.db servicesݐ spwd.db-disktab.shadow. disktab/ fstab܀0 resolv.conf1 hosts܀ . ..fsck_ffsBfsck0reboothalt0ifconfigBinit0mknod0mount0 mount_cd9660 mount_ffsB mount_nfsB mount_kernfspnewfs0 mount_mfsBping0route0shutdownBslattachBumount disklabelBxdmesg0 . .. chown܀ chroot  installboot  sysctlwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: games:*:13: staff:*:20:root guest:*:31:root utmp:*:45: www:*:67: network:*:69: named:*:70: dialer:*:117: nogroup:*:32766: nobody:*:32767: root::0:0::0:0:Charlie &:/root:/bin/csh daemon:*:1:31::0:0:The devil himself:/root:/sbin/nologin operator:*:2:5::0:0:System &:/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source,,,:/:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico www:*:67:67::0:0:HTTP server:/var/www:/sbin/nologin named:*:70:70::0:0:BIND Name Service Daemon:/var/named:/sbin/nologin nobody:*:32767:32767::0:0:Unprivileged user:/nonexistent:/sbin/nologin root:*:0:0:Charlie &:/root:/bin/csh daemon:*:1:31:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source,,,:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico www:*:67:67:HTTP server:/var/www:/sbin/nologin named:*:70:70:BIND Name Service Daemon:/var/named:/sbin/nologin nobody:*:32767:32767:Unprivileged user:/nonexistent:/sbin/nologin chester:ns#83:nt#15:nc#2619:\ :pb#498000:ob#0:\ :pc#3260655:oc#0:\ :ph#2761410:oh#498000: Seagate ST1239N SWIFT:\ :ty#winchester:ns#35:nt#9:nc#1264: Seagate ST12400N 2.4GB:\ :ty#winchester:ns#82:nt#19:nc#2668:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#4156744:oc#0:\ :pg#4058590:og#98154: Seagate ST12550N:\ :ty#winchester:ns#80:nt#19:nc#2747: Seagate ST1480N:\ :ty#winchester:ns#64:nt#9:nc#1456: Seagate ST15150N:\ :ty#winchester:ns#78:nt#21:nc#5119:\ :pc#8384922:oc#0: Seagate ST410800N Elite 9:\ :ty#winchester:ns#108:nt#27:nc#6087:\ :pc#17749692:oc#0: Seagate ST42100N - Wren 9:\ :ty#winchester:ns#96:nt#15:nc#2574:\ :pc#3706560:oc#0: Seagate ST42400N Elite 2:\ :ty#winchester:ns#84:nt#19:nc#2604:\ :pc#4155984:oc#0: Seagate Sabre-5 ST81236J:\ :ty#XD7053:ns#82:nt#15:nc#1633:\ :pa#99630:oa#0:ba#8192:\ :pb#261990:ob#99630:\ :pc#2008590:oc#0:\ :pd#548580:od#361620:\ :pe#1098390:oe#910200:\ :pf#361620:of#0:\ :pg#1646970:og#361620:\ :ph#1908960:oh#99630: SeagateST3283N:\ :ty#winchester:ns#57:nt#5:nc#1689: Sun1.0G:\ :ty#winchester:ns#80:nt#15:nc#1703: SyQuest SQ555:\ :ty#winchester:ns#34:nt#2:nc#1273:\ :pc#86564:oc#0: Toshiba MK 156F:\ :ty#winchester:ns#34:nt#10:nc#815: Vertex V185:\ :ty#ACB4000:ns#17:nt#7:nc#1163: # # Internet (IP) protocols # # $OpenBSD: protocols,v 1.8 1998/08/01 05:34:51 angelos Exp $ # # Updated based on RFC 1340, Assigned Numbers (July 1992). # See also http://www.iana.org/in-notes/iana/assignments/protocol-numbers # ip 0 IP # internet protocol, pseudo protocol number icmp 1 ICMP # internet control message protocol igmp 2 IGMP # Internet Group Management ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st 5 ST # ST datagram mode tcp 6 TCP # transmission control protocol ucl 7 UCL # UCL egp 8 EGP # exterior gateway protocol igp 9 IGP # any private interior gateway bbn-rcc-mon 10 BBN-RCC-MON # BBN RCC Monitoring nvp-ii 11 NVP-II # Network Voice Protocol pup 12 PUP # PARC universal packet protocol argus 13 ARGUS # ARGUS emcon 14 EMCON # EMCON xnet 15 XNET # Cross Net Debugger chaos 16 CHAOS # Chaos udp 17 UDP # user datagram protocol mux 18 MUX # Multiplexing dcn-meas 19 DCN-MEAS # DCN Measurement Subsystems hmp 20 HMP # host monitoring protocol prm 21 PRM # Packet Radio Measurement xns-idp 22 XNS-IDP # Xerox NS IDP trunk-1 23 TRUNK-1 # Trunk-1 trunk-2 24 TRUNK-2 # Trunk-2 leaf-1 25 LEAF-1 # Leaf-1 leaf-2 26 LEAF-2 # Leaf-2 rdp 27 RDP # "reliable datagram" protocol irtp 28 IRTP # Internet Reliable Transaction iso-tp4 29 ISO-TP4 # ISO Transport Protocol class 4 netblt 30 NETBLT # Bulk Data Transfer Protocol mfe-nsp 31 MFE-NSP # MFE Network Services Protocol merit-inp 32 MERIT-INP # MERIT Internodal Protocol sep 33 SEP # Sequential Exchange Protocol 3pc 34 3PC # Third Party Connect Protocol idpr 35 IDPR # Inter-Domain Policy Routing Protocol xtp 36 XTP # Xpress Tranfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport Proto idpr-cmtp 39 IDPR-CMTP # IDPR Control Message Transport il 40 IL # IL Transport Protocol sip 41 SIP # Simple Internet Protocol sdrp 42 SDRP # Source Demand Routing Protocol sip-sr 43 SIP-SR # SIP Source Route sip-frag 44 SIP-FRAG # SIP Fragment idrp 45 IDRP # Inter-Domain Routing Protocol rsvp 46 RSVP # Reservation Protocol gre 47 GRE # General Routing Encapsulation mhrp 48 MHRP # Mobile Host Routing Protocol bna 49 BNA # BNA esp 50 IPSEC-ESP # Encap Security Payload ah 51 IPSEC-AH # Authentication Header i-nlsp 52 I-NLSP # Integrated Net Layer Security TUBA swipe 53 SWIPE # IP with Encryption nhrp 54 NHRP # NBMA Next Hop Resolution Protocol skip 57 SKIP # SKIP any 61 any # host internal protocol cftp 62 CFTP # CFTP any 63 any # local network sat-expak 64 SAT-EXPAK # SATNET and Backroom EXPAK kryptolan 65 KRYPTOLAN # Kryptolan rvd 66 RVD # MIT Remote Virtual Disk Protocol ippc 67 IPPC # Internet Pluribus Packet Core any 68 any # distributed file system sat-mon 69 SAT-MON # SATNET Monitoring visa 70 VISA # VISA Protocol ipcv 71 IPCV # Internet Packet Core Utility cpnx 72 CPNX # Computer Protocol Network Executive cphb 73 CPHB # Computer Protocol Heart Beat wsn 74 WSN # Wang Span Network pvp 75 PVP # Packet Video Protocol br-sat-mon 76 BR-SAT-MON # Backroom SATNET Monitoring sun-nd 77 SUN-ND # SUN ND PROTOCOL-Temporary wb-mon 78 WB-MON # WIDEBAND Monitoring wb-expak 79 WB-EXPAK # WIDEBAND EXPAK iso-ip 80 ISO-IP # ISO Internet Protocol vmtp 81 VMTP # Versatile Message Transport secure-vmtp 82 SECURE-VMTP # SECURE-VMTP vines 83 VINES # VINES ttp 84 TTP # TTP nsfnet-igp 85 NSFNET-IGP # NSFNET-IGP dgp 86 DGP # Dissimilar Gateway Protocol tcf 87 TCF # TCF igrp 88 IGRP # IGRP ospf 89 OSPFIGP # Open Shortest Path First IGP sprite-rpc 90 Sprite-RPC # Sprite RPC Protocol larp 91 LARP # Locus Address Resolution Protocol mtp 92 MTP # Multicast Transport Protocol ax.25 93 AX.25 # AX.25 Frames ipip 94 IPIP # Yet Another IP encapsulation micp 95 MICP # Mobile Internetworking Control Pro. scc-sp 96 SCC-SP # Semaphore Communications Sec. Pro. etherip 97 ETHERIP # Ethernet-within-IP Encapsulation encap 98 ENCAP # Yet Another IP encapsulation any 99 any # private encryption scheme gmtp 100 GMTP # GMTP pim 103 PIM # Protocol Independent Multicast reserved 255 Reserved # rfd0Cb rfd0Cc fd0Da fd0Db fd0Dc rfd0Da !rfd0Db "rfd0Dc #fd0Ea $fd0Eb %fd0Ec &rfd0Ea 'rfd0Eb (rfd0Ec )fd0Fa *fd0Fb +fd0Fc,rfd0Fa -rfd0Fb .rfd0Fc /fd0Ga00fd0Gb 1fd0Gc 2rfd0Ga 3rfd0Gb 4rfd0Gc 5fd0Ha 6fd0Hb 7fd0Hc 8rfd0Ha 9rfd0Hb :rfd0Hc ; uk0< uk1= ss0> scan0܀? ss1@ scan1܀Attyp0 Bptyp0!Cttyp1 Dptyp1 Ettyp2 Fptyp2 Gttyp3 Hptyp3 Ittyp4 Jptyp4 Kttyp5 Lptyp5 Mttyp6 Nptyp6 Ottyp7 Pptyp7 Qttyp8 Rptyp8 Sttyp9 Tptyp9 Uttypa Vptypa Wttypb Xptypb Yttypc Zptypc [ttypd \ptypd ]ttype ^ptype _ttypf `ptypf avnd0a brvnd0a cvnd0bdrvnd0b evnd0c frvnd0c gvnd0d hrvnd0d ivnd0e jrvnd0e kvnd0f lrvnd0f mvnd0g nrvnd0g ovnd0h prvnd0h qvnd0i rrvnd0i svnd0j trvnd0j uvnd0k vrvnd0k wvnd0l xrvnd0l yvnd0m zrvnd0m {vnd0n |rvnd0n }vnd0o ~rvnd0o vnd0p rvnd0p svnd0a rsvnd0asvnd0b rsvnd0bsvnd0c rsvnd0csvnd0d rsvnd0dsvnd0e rsvnd0esvnd0f rsvnd0fsvnd0g rsvnd0gsvnd0h rsvnd0hsvnd0i rsvnd0isvnd0j rsvnd0jsvnd0k rsvnd0ksvnd0l rsvnd0lsvnd0m rsvnd0msvnd0n rsvnd0nsvnd0o rsvnd0osvnd0p rsvnd0pvnd1a rvnd1a vnd1b rvnd1bvnd1c rvnd1c vnd1dprvnd1d vnd1e rvnd1epvnd1f rvnd1fpvnd1g%rvnd1gvnd1h rvnd1h vnd1i&rvnd1i vnd1j rvnd1j vnd1k rvnd1k vnd1l rvnd1l vnd1m rvnd1m vnd1n rvnd1n vnd1o rvnd1o vnd1p rvnd1p svnd1a rsvnd1asvnd1b rsvnd1bsvnd1c rsvnd1csvnd1d rsvnd1dsvnd1e rsvnd1esvnd1f rsvnd1fsvnd1g rsvnd1gsvnd1h rsvnd1hsvnd1i rsvnd1isvnd1jrsvnd1jsvnd1k rsvnd1ksvnd1l rsvnd1lsvnd1m0rsvnd1msvnd1n # $OpenBSD: services,v 1.19 1999/01/08 17:06:23 art Exp $ # # Network services, Internet style # # Note that it is presently the policy of IANA to assign a single well-known # port number for both TCP and UDP; hence, most entries here have two entries # even if the protocol doesn't support UDP operations. # Updated from RFC 1340, ``Assigned Numbers'' (July 1992). Not all ports # are included, only the more common ones. # # from: @(#)services 5.8 (Berkeley) 5/9/91 # tcpmux 1/tcp # TCP port service multiplexer echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users daytime 13/tcp daytime 13/udp netstat 15/tcp qotd 17/tcp quote msp 18/tcp # message send protocol msp 18/udp # message send protocol chargen 19/tcp ttytst source chargen 19/udp ttytst source ftp-data 20/tcp # default ftp data port ftp 21/tcp ssh 22/tcp ssh 22/udp telnet 23/tcp # 24 - private smtp 25/tcp mail # 26 - unassigned time 37/tcp timserver time 37/udp timserver rlp 39/udp resource # resource location nameserver 42/tcp name # IEN 116 whois 43/tcp nicname domain 53/tcp nameserver # name-domain server domain 53/udp nameserver mtp 57/tcp # deprecated bootps 67/tcp # BOOTP server bootps 67/udp bootpc 68/tcp # BOOTP client bootpc 68/udp tftp 69/udp gopher 70/tcp # Internet Gopher gopher 70/udp rje 77/tcp netrjs finger 79/tcp www 80/tcp http # WorldWideWeb HTTP www 80/udp # HyperText Transfer Protocol link 87/tcp ttylink #kerberos 88/tcp krb5 # Kerberos v5 #kerberos 88/udp supdup 95/tcp # 100 - reserved hostnames 101/tcp hostname # usually from sri-nic iso-tsap 102/tcp tsap # part of ISODE. x400 103/tcp # ISO E-mail x400-snd 104/tcp csnet-ns 105/tcp cso-ns # also used by CSO name server csnet-ns 105/udp cso-ns rtelnet 107/tcp # Remote Telnet rtelnet 107/udp pop2 109/tcp postoffice # POP version 2 pop2 109/udp pop3 110/tcp # POP version 3 pop3 110/udp sunrpc 111/tcp portmap rpcbind sunrpc 111/udp portmap rpcbind auth 113/tcp authentication tap ident sftp 115/tcp uucp-path 117/tcp nntp 119/tcp readnews untp # USENET News Transfer Protocol ntp 123/tcp ntp 123/udp # Network Time Protocol loc-srv 135/tcp # NCS local location broker loc-srv 135/udp netbios-ns 137/tcp # NETBIOS Name Service netbios-ns 137/udp netbios-dgm 138/tcp # NETBIOS Datagram Service netbios-dgm 138/udp netbios-ssn 139/tcp # NETBIOS session service netbios-ssn 139/udp imap2 143/tcp # Interim Mail Access Proto v2 imap2 143/udp bftp 152/tcp # Background File Transfer Proto snmp 161/udp # Simple Net Mgmt Proto snmp-trap 162/udp snmptrap # Traps for SNMP cmip-man 163/tcp # ISO mgmt over IP (CMOT) cmip-man 163/udp cmip-agent 164/tcp cmip-agent 164/udp xdmcp 177/tcp # X Display Mgr. Control Proto xdmcp 177/udp nextstep 178/tcp NeXTStep NextStep # NeXTStep window nextstep 178/udp NeXTStep NextStep # server bgp 179/tcp # Border Gateway Proto. bgp 179/udp prospero 191/tcp # Cliff Neuman's Prospero prospero 191/udp irc 194/tcp # Internet Relay Chat irc 194/udp smux 199/tcp # SNMP Unix Multiplexer smux 199/udp at-rtmp 201/tcp # AppleTalk routing at-rtmp 201/udp at-nbp 202/tcp # AppleTalk name binding at-nbp 202/udp at-echo 204/tcp # AppleTalk echo at-echo 204/udp at-zis 206/tcp # AppleTalk zone information at-zis 206/udp z3950 210/tcp wais # NISO Z39.50 database z3950 210/udp wais ipx 213/tcp # IPX ipx 213/udp imap3 220/tcp # Interactive Mail Access imap3 220/udp # Protocol v3 ulistserv 372/tcp # UNIX Listserv ulistserv 372/udp nnsp 433/tcp usenet # Network News Transfer https 443/tcp # secure http (SSL) photuris 468/tcp # Photuris Key Management photuris 468/udp isakmp 500/udp # ISAKMP key management # # UNIX specific services # exec 512/tcp biff 512/udp comsat login 513/tcp who 513/udp whod shell 514/tcp cmd # no passwords used syslog 514/udp printer 515/tcp spooler # line printer spooler talk 517/udp ntalk 518/udp route 520/udp router routed # RIP efs 521/tcp # extended file name server timed 525/udp timeserver tempo 526/tcp newdate courier 530/tcp rpc conference 531/tcp chat netnews 532/tcp readnews netwall 533/udp # -for emergency broadcasts uucp 540/tcp uucpd # uucp daemon remotefs 556/tcp rfs_server rfs # Brunhoff remote filesystem # # From ``Assigned Numbers'': # #> The Registered Ports are not controlled by the IANA and on most systems #> can be used by ordinary user processes or programs executed by ordinary #> users. # #> Ports are used in the TCP [45,106] to name the ends of logical #> connections which carry long term conversations. For the purpose of #> providing services to unknown callers, a service contact port is #> defined. This list specifies the port used by the server process as its #> contact port. While the IANA can not control uses of these ports it #> does register or list uses of these ports as a convienence to the #> community. # ingreslock 1524/tcp ingreslock 1524/udp prospero-np 1525/tcp # Prospero non-privileged prospero-np 1525/udp nfsd 2049/udp nfs # NFS server nfsd 2049/tcp nfs # NFS server rfe 5002/tcp # Radio Free Ethernet rfe 5002/udp # Actually uses UDP only # # # Kerberos (Project Athena/MIT) services # Note that these are for Kerberos v4, and are unofficial. Sites running # v5 should comment these out and uncomment the v5 entries above. # kerberos-sec 88/udp # Kerberos secondary port UDP kerberos-sec 88/tcp # Kerberos secondary port TCP klogin 543/tcp # Kerberos authenticated rlogin kshell 544/tcp krcmd # and remote shell ekshell 545/tcp # Kerberos encrypted remote shell -kfall ekshell2 2106/tcp # What U of Colorado @ Boulder uses? kerberos-adm 749/tcp # Kerberos `kadmin' (v5) kerberos-iv 750/udp kdc kerberos # Kerberos authentication--udp kerberos-iv 750/tcp kdc kerberos # Kerberos authentication--tdp kerberos_master 751/udp kerberos-master # Kerberos authentication kerberos_master 751/tcp kerberos-master # Kerberos authentication krb_prop 754/tcp # Kerberos slave propagation krbupdate 760/tcp kreg # BSD Kerberos registration kpasswd 761/tcp kpwd # BSD Kerberos `passwd' kpop 1109/tcp # Pop with Kerberos eklogin 2105/tcp # Kerberos encrypted rlogin rkinit 2108/tcp # Kerberos remote kinit kx 2111/tcp # X over kerberos kip 2112/tcp # IP over kerberos kauth 2120/tcp # Remote kauth # # AFS Services # afs3-fileserver 7000/udp # AFS fileserver afs3-callback 7001/udp # AFS callback server afs3-prserver 7002/udp # AFS protection server afs3-vlserver 7003/udp # AFS volumelocation server afs3-kaserver 7004/udp # AFS kerberos authenication server afs3-volser 7005/udp # AFS volume server afs3-errors 7006/udp # AFS error server ? afs3-bos 7007/udp # AFS basic over-see server ? afs3-update 7008/udp # ? afs3-rmtsys 7009/udp # ? # # Unofficial services # supfilesrv 871/tcp # SUP server rsync 873/tcp # rsync server cddb 888/tcp # Audio CD Database supfiledbg 1127/tcp # SUP debugging radius 1645/udp # radius authentication radacct 1646/udp # radius accounting webster 2627/tcp # Network dictionary webster 2627/udp icb 7326/tcp # Internet Citizen's Band # # Appletalk # rtmp 1/ddp # Routing Table Maintenance Protocol nbp 2/ddp # Name Binding Protocol echo 4/ddp # AppleTalk Echo Protocol zip 6/ddp # Zone Information Protocol # $OpenBSD: disktab,v 1.16 1998/09/23 07:30:57 todd Exp $ # # @(#)disktab 5.5 (Berkeley) 2/27/91 # # Disk geometry and partition layout tables. # Key: # ty type of disk # ns #sectors/track # nt #tracks/cylinder # nc #cylinders/disk # rm rpm, 3600 default # se sector size, 512 default # sf supports bad144-style bad sector forwarding # so partition offsets in sectors # p[a-p] partition sizes in sectors # b[a-p] partition block sizes in bytes # f[a-p] partition fragment sizes in bytes # miniroot:\ :ty=winchester:se#512:nt#2:rm#300:ns#64:nc#80:\ :ts=3500:\ :pa#10240:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#0:ob#0:\ :pc#10240:oc#0: rdroot:\ :ty=ramdisk:se#512:nt#2:rm#300:ns#8:nc#1024:\ :pa#8192:oa#0:ta=4.2BSD:ba#8192:fa#1024: \ :pc#8192:oc#0: floppy|floppy3|3in|3.5in High Density Floppy:\ :ty=floppy:se#512:nt#2:rm#300:ns#18:nc#80:\ :pa#2880:oa#0:ba#4096:fa#512:ta=4.2BSD:\ :pb#2880:ob#0:\ :pc#2880:oc#0: # test if not having an 'a' works? fakecdrom|Fake image for Bootable CDROM:\ :ty=winchester:se#512:nt#1:rm#350:ns#640:nc#2048:\ :pa#1310720:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#1310720:ob#0:bb#8192:fb#1024:tb=4.2BSD:\ :pc#1310720:oc#0:bc#8192:fc#1024:tc=4.2BSD:\ :pd#1310720:od#0:bd#8192:fd#1024:td=4.2BSD: ASI-1.0GIBM:\ :ty#winchester:ns#80:nt#15:nc#1632: Arte DEC DSP3160S:\ :ty#winchester:ns#112:nt#16:nc#1744: CDC 9720-850:\ :ty#XD7053:ns#66:nt#15:nc#1358: CDC EMD 9720:\ :ty#XD7053:ns#48:nt#10:nc#1147: CDC EMD 9720-1230:\ :ty#XD7053:ns#82:nt#15:nc#1633: CDC IPI 9720:\ :ty#ISP-80:ns#82:nt#15:nc#1631:\ :pa#33210:oa#0:ba#8192:\ :pb#131610:ob#33210:\ :pc#2006130:oc#0:\ :pg#196800:og#164820:\ :ph#1644510:oh#361620: CDC IPI 9722:\ :ty#ISP-80:ns#156:nt#7:nc#1630:\ :pa#33852:oa#0:ba#8192:\ :pb#132132:ob#33852:\ :pc#1779960:oc#0:\ :pg#197652:og#165984:\ :ph#1416324:oh#363636: CDC Wren IV 94171-344:\ :ty#winchester:ns#46:nt#9:nc#1545: CONNER 30170E:\ :ty#winchester:ns#46:nt#8:nc#897:\ :pa#14720:oa#0:ba#8192:\ :pb#40480:ob#14720:\ :pc#330096:oc#0:\ :pg#274896:og#55200: CONNER 30200:\ :ty#winchester:ns#49:nt#4:nc#2121:\ :pc#415716:oc#0: CONNER CFP4207S 4.28GB:\ :ty#winchester:ns#125:nt#20:nc#3353:\ :pc#8382500:oc#0: CONNER CP3500-540MB-3.5:\ :ty#winchester:ns#50:nt#12:nc#1768:\ :pc#1060800:oc#0: CP3100:\ :ty#winchester:ns#49:nt#4:nc#1023:\ :pc#204864:oc#0: Conner CFP1060:\ :ty#winchester:ns#111:nt#8:nc#2329: Conner CP3540:\ :ty#winchester:ns#49:nt#12:nc#1805: DEC DSP3107L:\ :ty#winchester:ns#83:nt#8:nc#3147:\ :pc#2089608:oc#0: DEC DSP3210 2 GB:\ :ty#winchester:ns#86:nt#16:nc#3040:\ :pc#4183040:oc#0: DEC DSP5200:\ :ty#winchester:ns#71:nt#21:nc#2619:\ :pa#32802:oa#0:ba#8192:\ :pb#65604:ob#32802:\ :pc#3904929:oc#0:\ :pg#3806523:og#98406: DEC DSP5350:\ :ty#winchester:ns#91:nt#25:nc#3053: DEC_RZ26:\ :ty#winchester:ns#57:nt#14:nc#2568:\ :pa#66234:oa#0:ba#8192:\ :pb#132468:ob#66234:\ :pc#2049264:oc#0:\ :pg#1850562:og#198702: DEC_RZ28:\ :ty#winchester:ns#84:nt#16:nc#3043:\ :pa#64512:oa#0:ba#8192:\ :pb#196224:ob#64512:\ :pc#4089792:oc#0:\ :pg#3827712:og#260736: DEC_RZ58:\ :ty#winchester:ns#85:nt#15:nc#2112: DEC_RZ58_whole_disk:\ :\ :pc#2692800:oc#0: DEC_RZ74:\ :ty#winchester:ns#91:nt#25:nc#3053:\ :pa#65975:oa#0:ba#8192:\ :pb#193375:ob#65975:\ :pc#4192825:oc#0:\ :pg#3931200:og#259350:\ :ph#2752750:oh#4192825: Fujitsu M2243AS:\ :ty#ACB4000:ns#17:nt#11:nc#752: Fujitsu M2246E:\ :ty#winchester:ns#35:nt#6:nc#1196:\ :pa#16170:oa#0:ba#8192:\ :pb#28140:ob#16170:\ :pc#251160:oc#0:\ :pg#206850:og#44310: Fujitsu M2263SA:\ :ty#winchester:ns#53:nt#15:nc#1652: Fujitsu M2266SA 1.2GB:\ :ty#winchester:ns#85:nt#15:nc#1652: Fujitsu M2266SA 1GB:\ :ty#winchester:ns#85:nt#15:nc#1642: Fujitsu M2344K:\ :ty#XD7053:ns#64:nt#27:nc#622: Fujitsu M2511A:\ :ty#winchester:ns#25:nt#1:nc#9950: Fujitsu M2512A small:\ :ty#winchester:ns#25:nt#1:nc#9950:\ :pc#248750:oc#0: Fujitsu M2512A v2:\ :ty#winchester:ns#25:nt#1:nc#17840:\ :pc#446000:oc#0: Fujitsu M2622SA:\ :ty#winchester:ns#64:nt#7:nc#1429:\ :pc#640192:oc#0: Fujitsu M2624FA:\ :ty#winchester:ns#64:nt#11:nc#1440:\ :pa#22528:oa#0:ba#8192:\ :pb#67584:ob#22528:\ :pc#1013760:oc#0:\ :pg#450560:og#90112:\ :ph#473088:oh#540672: Fujitsu M2652SA:\ :ty#winchester:ns#88:nt#20:nc#1935: Fujitsu M2654SA:\ :ty#winchester:ns#88:nt#21:nc#2174: Fujitsu M2684S:\ :ty#SCSI:ns#74:nt#6:nc#2338: Fujitsu-M2284/M2322:\ :ty#XY450:ns#32:nt#10:nc#821: Fujitsu-M2312K:\ :ty#XY450:ns#32:nt#7:nc#587: Fujitsu-M2333:\ :ty#XD7053:ns#67:nt#10:nc#821: Fujitsu-M2351 Eagle:\ :ty#XD7053:ns#46:nt#20:nc#840: Fujitsu-M2361 Eagle:\ :ty#XD7053:ns#67:nt#20:nc#840: Fujitsu-M2372K:\ :ty#XD7053:ns#67:nt#27:nc#743: Fujitsu-M2382:\ :ty#XD7053:ns#81:nt#27:nc#743:\ :pa#80919:oa#0:ba#8192:\ :pb#129033:ob#80919:\ :pc#1624941:oc#0:\ :pd#470205:od#209952:\ :pe#944784:oe#680157:\ :pf#209952:of#0:\ :pg#1414989:og#209952:\ :ph#1544022:oh#80919: Fujitsu-M2624S-512:\ :ty#winchester:ns#64:nt#11:nc#1429: Fujitsu-M2651SA:\ :ty#winchester:ns#88:nt#16:nc#1934:\ :pc#2723072:oc#0: Fujitsu-M2694ESA:\ :ty#winchester:ns#77:nt#15:nc#1830: HP 97549T:\ :ty#winchester:ns#64:nt#16:nc#1909: HP 97556:\ :ty#winchester:ns#72:nt#11:nc#1668: HP 97558:\ :ty#winchester:ns#72:nt#15:nc#1933: HP 97560:\ :ty#winchester:ns#72:nt#19:nc#1933: HP C2247 1.05GB:\ :ty#winchester:ns#95:nt#13:nc#1661:\ :pc#2051335:oc#0:\ :pg#1640080:og#0:\ :ph#411255:oh#1640080: HP C3010 / Cranel 2.0GB Fast SCSI2 H10:\ :ty#winchester:ns#95:nt#19:nc#2165: HP97548SU 664MB:\ :ty#winchester:ns#56:nt#16:nc#1445:\ :pa#35840:oa#0:ba#8192:\ :pb#71680:ob#35840:\ :pc#1294720:oc#0:\ :pg#197120:og#215040:\ :ph#342720:oh#609280: Hewlett Packard C2490A:\ :ty#winchester:ns#107:nt#18:nc#2159: Hewlett Packard C3323A:\ :ty#winchester:ns#98:nt#7:nc#2995: Hewlett Packard C3725S:\ :ty#winchester:ns#140:nt#9:nc#3362:\ :pc#4236120:oc#0:\ :ph#4193280:oh#1260: Hitachi DK315C-10:\ :ty#winchester:ns#75:nt#11:nc#2467: Hitachi DK315C-11:\ :ty#winchester:ns#58:nt#15:nc#2478: Hitachi DK315C-14:\ :ty#winchester:ns#75:nt#15:nc#2462: Hitachi DK326C-10:\ :ty#winchester:ns#87:nt#7:nc#3200: Hitachi DK326C-6:\ :ty#winchester:ns#87:nt#4:nc#3200: Hitachi DK515C-78:\ :ty#winchester:ns#69:nt#14:nc#1354: Hitachi DK516C-16:\ :ty#winchester:ns#80:nt#15:nc#2170: Hitachi DK517C-37:\ :ty#winchester:ns#81:nt#21:nc#3297: Hitachi DK815-10:\ :ty#XD7053:ns#67:nt#15:nc#1735: IBM 0662-S12:\ :ty#winchester:ns#114:nt#6:nc#3002: IBM 0662S12:\ :ty#winchester:ns#108:nt#5:nc#3803: IBM 0663-E15:\ :ty#winchester:ns#37:nt#20:nc#3182: IBM 0663L12:\ :ty#winchester:ns#66:nt#15:nc#1979:\ :pc#1959210:oc#0: IBM 0664-M1H/N1H:\ :ty#winchester:ns#86:nt#16:nc#2856: IBM 0664CSH:\ :ty#winchester:ns#125:nt#30:nc#2787: IBM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM DFHSS1x:\ :ty#winchester:ns#125:nt#4:nc#4383: IBM DFHSS2x:\ :ty#winchester:ns#125:nt#8:nc#4388: IBM DFHSS4x:\ :ty#winchester:ns#125:nt#16:nc#4390: IBM DPES-31080:\ :ty#winchester:ns#108:nt#4:nc#4901:\ :pc#2117232:oc#0: IBM DSAS-3270:\ :ty#winchester:ns#108:nt#2:nc#2542: IBM DSAS-3360:\ :ty#winchester:ns#108:nt#2:nc#3297: IBM DSAS-3540:\ :ty#winchester:ns#108:nt#3:nc#3259: IBM DSAS-3720:\ :ty#winchester:ns#108:nt#4:nc#3292: IBM OEM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM OEM DFHSS2F:\ :ty#winchester:ns#135:nt#8:nc#4076:\ :pa#4100760:oa#0:ba#8192:\ :pb#301320:ob#4100760: MAXOPTIX (NON-ISO, 1024b) DATA:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 1024b) SYSTEM:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 512b) DATA:\ :ty#winchester:ns#60:nt#1:nc#15081: MAXOPTIX (NON-ISO, 512b) SYSTEM:\ :ty#winchester:ns#60:nt#1:nc#15081: MICROP 4221-09MZ 10204:\ :ty#winchester:ns#139:nt#9:nc#3198:\ :pc#4000698:oc#0: MICROPOLIS 1991-27:\ :ty#winchester:ns#149:nt#27:nc#4400: MICROPOLIS 3243-19:\ :ty#winchester:ns#106:nt#19:nc#4139: MICROPOLIS 4110-09:\ :ty#winchester:ns#95:nt#9:nc#2283: Maxtor 7213SR NB:\ :ty#winchester:ns#65:nt#4:nc#1595:\ :pc#414700:oc#0:\ :pg#414700:og#0: Maxtor DXP3105S:\ :ty#winchester:ns#57:nt#14:nc#2568: Maxtor LXT-200S:\ :ty#winchester:ns#43:nt#7:nc#1117: Maxtor LXT-340SY:\ :ty#winchester:ns#70:nt#7:nc#1355: Maxtor LXT535ST:\ :ty#winchester:ns#61:nt#11:nc#1547:\ :pc#1038037:oc#0: Maxtor MXT1240S:\ :ty#winchester:ns#70:nt#15:nc#2306:\ :pc#2421300:oc#0:\ :pg#2421300:og#0: Maxtor P0-12S (1632):\ :ty#winchester:ns#90:nt#15:nc#1478:\ :pc#1995300:oc#0:\ :pg#1995300:og#0: Maxtor P0-12S (1795):\ :ty#winchester:ns#90:nt#15:nc#1510:\ :pc#2038500:oc#0:\ :pg#2038500:og#0: Maxtor P1-17S:\ :ty#winchester:ns#83:nt#19:nc#1816:\ :pa#78850:oa#0:ba#8192:\ :pb#78850:ob#78850:\ :pc#2863832:oc#0:\ :pd#78850:od#157700:\ :pg#2469582:og#236550:\ :ph#78850:oh#2706132: Maxtor P1-17S NB:\ :ty#winchester:ns#90:nt#19:nc#1711:\ :pc#2925810:oc#0:\ :pg#2925810:og#0: Maxtor XT-1050:\ :ty#ACB4000:ns#17:nt#5:nc#1020: Maxtor XT-3280S:\ :ty#winchester:ns#25:nt#15:nc#1222: Maxtor XT-4380S:\ :ty#winchester:ns#36:nt#15:nc#1202: Maxtor XT-8380S:\ :ty#winchester:ns#53:nt#8:nc#1626: Maxtor XT-8610E:\ :ty#winchester:ns#52:nt#12:nc#1626: Maxtor XT-8760E:\ :ty#winchester:ns#50:nt#15:nc#1616:\ :pa#97500:oa#0:ba#8192:\ :pb#63750:ob#658500:\ :pc#1212000:oc#0:\ :pd#280500:od#97500:\ :pe#280500:oe#378000:\ :pf#489750:of#722250:\ :pg#561000:og#97500:\ :ph#658500:oh#0: Maxtor XT-8760S:\ :ty#winchester:ns#54:nt#15:nc#1614: Micropolis 1304:\ :ty#ACB4000:ns#17:nt#6:nc#825: Micropolis 1325:\ :ty#ACB4000:ns#17:nt#8:nc#1022: Micropolis 1355:\ :ty#winchester:ns#34:nt#8:nc#1018: Micropolis 1528-15:\ :ty#winchester:ns#83:nt#15:nc#2102:\ :pa#32370:oa#0:ba#8192:\ :pb#64740:ob#32370:\ :pc#2616990:oc#0:\ :pg#2519880:og#97110: Micropolis 1548-15:\ :ty#winchester:ns#131:nt#15:nc#1701:\ :pa#33405:oa#0:ba#8192:\ :pb#66810:ob#33405:\ :pc#3342465:oc#0:\ :pg#3242250:og#100215: Micropolis 1558:\ :ty#winchester:ns#35:nt#15:nc#1218: Micropolis 1578-15:\ :ty#winchester:ns#35:nt#15:nc#1231:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#646275:oc#0:\ :pg#548625:og#97650: Micropolis 1588-15:\ :ty#winchester:ns#53:nt#15:nc#1637:\ :pa#32595:oa#0:ba#8192:\ :pb#65190:ob#32595:\ :pc#1301415:oc#0:\ :pg#1203630:og#97785: Micropolis 1598-15:\ :ty#winchester:ns#70:nt#15:nc#1931:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#2027550:oc#0:\ :pg#1929900:og#97650: Micropolis 1624-7:\ :ty#winchester:ns#114:nt#7:nc#1647:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#1314306:oc#0:\ :pg#1216152:og#98154: Micropolis 1674-7:\ :ty#winchester:ns#35:nt#7:nc#1255:\ :pa#16415:oa#0:ba#8192:\ :pb#32830:ob#16415:\ :pc#307475:oc#0:\ :pg#258230:og#49245: Micropolis 1684-7:\ :ty#winchester:ns#53:nt#7:nc#1785:\ :pa#32648:oa#0:ba#8192:\ :pb#65296:ob#32648:\ :pc#662235:oc#0:\ :pg#564291:og#97944: Micropolis 1908-15:\ :ty#winchester:ns#95:nt#15:nc#1890:\ :pa#32775:oa#0:ba#8192:\ :pb#65550:ob#32775:\ :pc#2693250:oc#0:\ :pg#2594925:og#98325: Micropolis 1924-21:\ :ty#winchester:ns#94:nt#21:nc#2072:\ :pa#33558:oa#0:ba#8192:\ :pb#67116:ob#33558:\ :pc#4090128:oc#0:\ :pg#3989454:og#100674: Micropolis 1926-15:\ :ty#winchester:ns#101:nt#15:nc#2769:\ :pa#33330:oa#0:ba#8192:\ :pb#66660:ob#33330:\ :pc#4195035:oc#0:\ :pg#4095045:og#99990: Micropolis 1936-21:\ :ty#winchester:ns#101:nt#21:nc#2772:\ :pa#33936:oa#0:ba#8192:\ :pb#67872:ob#33936:\ :pc#5879412:oc#0:\ :pg#2846382:og#101808:\ :ph#2931222:oh#2948190: Micropolis 2105-8:\ :ty#winchester:ns#94:nt#8:nc#1448:\ :pa#32336:oa#0:ba#8192:\ :pb#64672:ob#32336:\ :pc#1088896:oc#0:\ :pg#991888:og#97008: Micropolis 2108-10:\ :ty#winchester:ns#94:nt#10:nc#1450:\ :pa#31960:oa#0:ba#8192:\ :pb#63920:ob#31960:\ :pc#1363000:oc#0:\ :pg#1267120:og#95880: Micropolis 2112-15:\ :ty#winchester:ns#94:nt#15:nc#1452:\ :pa#33840:oa#0:ba#8192:\ :pb#67680:ob#33840:\ :pc#2047320:oc#0:\ :pg#1945800:og#101520: Micropolis 2205-05:\ :ty#winchester:ns#109:nt#5:nc#2088:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#1137960:oc#0:\ :pg#1039860:og#98100: Micropolis 2210-09:\ :ty#winchester:ns#109:nt#9:nc#2099:\ :pa#33354:oa#0:ba#8192:\ :pb#66708:ob#33354:\ :pc#2059119:oc#0:\ :pg#1959057:og#100062: Micropolis 2217-15:\ :ty#winchester:ns#109:nt#15:nc#2105:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#3441675:oc#0:\ :pg#3343575:og#98100: Micropolis 4110:\ :ty#winchester:ns#114:nt#9:nc#1998: Micropolis 4221:\ :ty#winchester:ns#109:nt#9:nc#4079:\ :pa#4001499:oa#0:ba#8192:\ :pc#4001499:oc#0: NEC D2363:\ :ty#XD7053:ns#67:nt#27:nc#964: NEC-D2352:\ :ty#XD7053:ns#57:nt#19:nc#758: Quantum ELS 127S:\ :ty#winchester:ns#54:nt#3:nc#1541: Quantum ELS 170S:\ :ty#winchester:ns#54:nt#4:nc#1542: Quantum ELS 85S:\ :ty#winchester:ns#54:nt#2:nc#1535: Quantum Empire 540S:\ :ty#winchester:ns#92:nt#8:nc#1431: Quantum Empire 1080S:\ :ty#winchester:ns#92:nt#16:nc#1431: Quantum Empire 2100S:\ :ty#winchester:ns#137:nt#12:nc#2497:\ :pc#4105068:oc#0: Quantum GoDrive 120S:\ :ty#winchester:ns#56:nt#4:nc#1067: Quantum GoDrive 160S:\ :ty#winchester:ns#58:nt#4:nc#1413: Quantum LPS 105S:\ :ty#winchester:ns#42:nt#4:nc#1221: Quantum LPS 120S:\ :ty#winchester:ns#60:nt#2:nc#1987: Quantum LPS 240S:\ :ty#winchester:ns#60:nt#4:nc#1995: Quantum LPS 270S:\ :ty#winchester:ns#76:nt#7:nc#992: Quantum LPS 525S:\ :ty#winchester:ns#70:nt#6:nc#2444: Quantum LPS 540S:\ :ty#winchester:ns#125:nt#4:nc#2113: Quantum Lightning 730S:\ :ty#winchester:ns#63:nt#16:nc#1415:\ :pa#161280:oa#0:ba#8192:\ :pb#96768:ob#161280:\ :pc#1426320:oc#0:\ :pg#1168272:og#258048: Quantum PD 80S:\ :ty#winchester:ns#34:nt#6:nc#832: Quantum PD 120S:\ :ty#winchester:ns#42:nt#5:nc#1114: Quantum PD 170S:\ :ty#winchester:ns#42:nt#7:nc#1117: Quantum PD 210S:\ :ty#winchester:ns#49:nt#7:nc#1189: Quantum PD 425S:\ :ty#winchester:ns#60:nt#9:nc#1540: Quantum PD 700S:\ :ty#winchester:ns#70:nt#8:nc#2441: Quantum PD 1050iS:\ :ty#winchester:ns#92:nt#12:nc#1859:\ :pc#2052336:oc#0: Quantum PD 1050S:\ :ty#winchester:ns#70:nt#12:nc#2444: Quantum PD 1225S:\ :ty#winchester:ns#70:nt#14:nc#2442: Quantum XP32150:\ :ty#winchester:ns#109:nt#10:nc#3850: Quantum XP34301:\ :ty#winchester:ns#118:nt#20:nc#3561: Quantum XP34300W:\ :ty#winchester:ns#107:nt#20:nc#3907: RICOH RO-5031E:\ :ty#winchester:ns#54:nt#15:nc#710:\ :pc#575100:oc#0: RZ24:\ :ty#winchester:ns#38:nt#8:nc#1344:\ :pc#409792:oc#0: RZ55:\ :ty#winchester:ns#35:nt#15:nc#1218:\ :pa#32025:oa#0:ba#8192:\ :pb#59850:ob#32025:\ :pc#639450:oc#0:\ :pg#547575:og#91875: SEAGATE ST11950N:\ :ty#winchester:ns#81:nt#15:nc#2715:\ :pc#3298725:oc#0: SEAGATE ST15230N:\ :ty#winchester:ns#111:nt#19:nc#3974: SEAGATE ST31200N:\ :ty#winchester:ns#85:nt#9:nc#2692: SEAGATE ST31230N:\ :ty#winchester:ns#104:nt#5:nc#3978:\ :pc#2068560:oc#0: SEAGATE ST32550N:\ :ty#winchester:ns#109:nt#11:nc#3495:\ :pc#4190505:oc#0: SEAGATE ST3600N:\ :ty#winchester:ns#79:nt#7:nc#1853:\ :pc#1024709:oc#0: ST83220K:\ :ty#"ISP-80":ns#102:nt#19:nc#2652: SUN0104:\ :ty#winchester:ns#35:nt#6:nc#974: SUN0121:\ :ty#winchester:ns#39:nt#4:nc#1520: SUN0207:\ :ty#winchester:ns#36:nt#9:nc#1254: SUN0327:\ :ty#winchester:ns#46:nt#9:nc#1545: SUN0424:\ :ty#winchester:ns#80:nt#9:nc#1151: SUN0535:\ :ty#winchester:ns#80:nt#7:nc#1866: SUN0669:\ :ty#winchester:ns#54:nt#15:nc#1614: SUN1.3G:\ :ty#winchester:ns#80:nt#17:nc#1965: SUN2.1G:\ :ty#winchester:ns#80:nt#19:nc#2733: Sabre ST82500J:\ :ty#XD7053:ns#82:nt#19:nc#2609: Seagate (CDC) Wren V 94181-702:\ :ty#winchester:ns#48:nt#15:nc#1543: Seagate (CDC) Wren VI 94191-766:\ :ty#winchester:ns#52:nt#15:nc#1659: Seagate (CDC) Wren VII 94601-1.2G SunOS 4.1.1:\ :ty#winchester:ns#70:nt#15:nc#1925: Seagate (CDC) Wren VII 94601-15:\ :ty#winchester:ns#71:nt#15:nc#1905: Seagate (CDC) Wren VIII ST41650N:\ :ty#winchester:ns#89:nt#15:nc#2070: Seagate Elite ST43400N-3.5G:\ :ty#winchester:ns#99:nt#21:nc#2736:\ :pa#2843360:oa#0:ba#8192:\ :pb#2843360:ob#2841993: Seagate IPI ZBR Elite:\ :ty#"ISP-80":ns#78:nt#17:nc#1893:\ :pa#34476:oa#0:ba#8192:\ :pb#132600:ob#34476:\ :pc#2510118:oc#0:\ :pg#663000:og#167076:\ :ph#1680042:oh#830076: Seagate ST11200N:\ :ty#winchester:ns#80:nt#15:nc#1714:\ :pa#2056800:oa#0:ba#8192:\ :pc#2056800:oc#0: Seagate ST11900N:\ :ty#win @ 7y   @@7yҪ@@P^<@`bT U7y\(A7yP7yZ5}_7yZ5}_ Tw-A7y S@7y %X7y %X gGA7y7y "Fp7y "Fp USG 7y nfx7y nfx7y nfx../../instbinٺG 7y -07y -07y -0../../instbin;#ǚ7y (7y |P7y |P 䉫7y w-7y P7y P 87y 07y ;`7y ;` Yh*7y 6X7y 6X7y 6X  bQ7y 7y 7y PYeҁ{7y Sx7yh>x7y0 'a}4!7yc7yc7y{K*'Ia7y",87y",87y0 ('!7y#]h7y#]h7y{K*(e?a7y&X`7y&X`7y{K ),!7y("(7y("(7y{K*)ja7y+n7y+n7y{K *!7y,N87y,N87y{K**#a7y/Ip07y/Ip07y{K +v!7y1'7y1'7y{K*+a7y47y47y{K ,"!7y5?* 7y5?* 7y{K*,kTa7y8:7y8:7y{K - gD!7y:7y:7y{K*- a7yc7yc7y{K .N2!7y7y7y{K*.Èa7y7y7y{K /Mn!7yY7yY7y{K*/2a7y:h7y:h7y-|˜ 0W!7yy07yy07y.U0*0!lwga7yV(7yV(7y-|˜ 1!„!7y0{X7y0{X7y.U0*1F(Ma7y"7y"7y-|˜ 2~!7y#7y#7y.U0*2:{a7y&7y&7y-|˜ 3c!7y(7y(7y.U0*3a7y+7y+7y-|˜ 4!7y,7y,7y.U0*4Ga7y/7y/7y.U0 5*D!7y1?7y1?7y.U0*5P9a7y47y47y.U0 6J8p!7y5A7y5A7y.U0*6}eda7y87y87y.U0 7T!7y:֐7y:֐7y.U0*7KGea7y7y7y.U0 8s!7y,7y,7y.U0*8̀a7yX7yX7y.U0 9g=!7y !̐7y !̐7y.U0*9a7y 7y 7y.U0 :Wz!7y Mθ7y Mθ7y.U0*:/gCa7yH7yH7y.U0 ;~ !7ycx7ycx7y.U0*;a7y @p7y @p7y.U0 < V!7y>e7y>e7y.U0*<-a7y9F7y9F7y.U0 =!7yH7yH7y.U0*=a7y@7y@7y.U0 >ά!7y/p7y/p7y.U0*>Ja7y")h7y")h7y.U0 ?gh|!7y#07y#07y.U0*?ʅwa7y6mY7y6mY7y!ts!7y7~7y7~7y!#H ga7y:[7y:[7y!64!7y Ip7y Ip7y!#H Ea7y &h7y &h7y!Q!7y O7y O7y!#H a7y ,x7y ,x7y!L-!7y @7y @7y!#H /ma7y 87y 87y!BP(!7y h7y h7y!#H ,a7y xU7y xU7y! 9!7y {(7y {(7y!#H rGa7y X 7y X 7y!3^4!7y }P7y }P7y!#H w~a7y h7y h7y!#H!7y 7y 7y!#H NUa7y 7y 7y!#Hh !7y ^7y ^7y!#H Qa7y #Y7y #Y7y!#H (!7y $7y $7y!#H Qga7y '7y '7y!#H BY!7y )OA7y )OA7y!#H  a7y ,J7y ,J7y!#H !7y -{C7y -{C7y!#H Ta7y 0v$7y 0v$7y!#H N/!7y 2?p7y 2?p7y!#H b!a7y 5L7y 5L7y!#H ;!7y 77y 77y!#H `ߠa7y :7y :7y!#Hx !7y!Έ7y!Έ7y!#H  R&Ya7y!7y!7y!#H[!7y!cH7y!cH7y!#H {H9a7y!'7y!'7y",G( (!7y!6L7y!6L7y",G( !a7y!1-7y!1-7y",G(M!7y!p7y!p7y",G( _0a7y! h7y! h7y",G(Ea7y"7y"7y",G(.!7y"D:7y"D:7y",߻` Ⱦa7y"?7y"?7y",G(#!7y"ϸ7y"ϸ7y",߻`  Q%a7y"7y"7y",G(!7y"47y"47y",߻` ?ƞa7y"/7y"/7y",G(-!7y"j7y"j7y",߻` Wݣa7y" G7y" G7y",G(qJy#!7y""%l7y""%l7y",߻` a7y"417y"417y$ Fh0 2Ph!7y"6h7y"6h7y$ Fh0 va7y"9c7y"9c7y$ Fh0!/=!7y";-}7y";-}7y$ !ܩOa7y#7y#7y$ Fh0"*!7y#7y#7y$ "ua7y#7y#7y$ Fh0#h9!7y#Jp7y#Jp7y$ #a7y# ~+P7y# ~+P7y$ Fh0$!7y# G7y# G7y$ $%>a7y#B7y#B7y$ Fh0%B,!7y#s@7y#s@7y$ %a7y#n87y#n87y$ Fh0&5!7y#8z7y#8z7y$ &˙a7y#3V7y#3V7y$ Fh0'5;!7y#d|(7y#d|(7y$ '7oa7y#7y#7y$ Fh0(]&!7y#)7y#)7y$ ( jEa7y#"#7y#"#7y$ Fh0) N;!7y##7y##7y$ )ra7y#&膈7y#&膈7y$ Fh0*!7y#(7y#(7y$ */Xa7y#+7y#+7y$ Fh0+f!7y#,@x7y#,@x7y$ +TAa7y#/p7y#/p7y$ Fh0,-H!7y#1 B7y#1 B7y$ ,va7y#47y#47y$ Fh0-ʉ!7y#5H7y#5H7y$ -Vq>a7y#8ɸ@7y#8ɸ@7y$ Fh0.<!7y#:p7y#:p7y$ .Sza7y$7y$7y$ Fh0/o!7y$$07y$$07y$ /+2Ba7y$l7y$l7y%*yH0mm!7y$h$H7y$h$H7y%*yH 0Oa7y$c@7y$c@7y%*yH1}xQ!7y$,7y$,7y%*yH 1Ca7y$'7y$'7y%*yH2!7y$ X7y$ X7y%*yH 2ba7y$#S7y$#S7y%*yH3uE!7y$%S7y$%S7y%*yH 3WYa7y$(07y$(07y%*yH4Ov!7y$)7y$)7y%*yH 4`Ȫa7y$,Ő7y$,Ő7y%*yH5t{*!7y$. 7y$. 7y%*yH 5vja7y$1Ǹ7y$1Ǹ7y%*yH6n!7y$27y$27y%*yH 6Gta7y$5``7y$5``7y%*yH7UK!7y$67y$67y%*yH 7la7y$: 7y$: 7y%*yH8.ϯ!7y%(PP7y%(PP7y%*yH 8 5a7y%#-H7y%#-H7y%*yH9<!7y%7y%7y%*yH 9X a7y%7y%7y%*yH:§~!7y% y7y% y7y%*yH :4-a7y% V7y% V7y%*yH;<!7y% 7y% 7y%*yH ;/a7y%\7y%\7y%*yH<!7y%7y%7y%*yH <ܲa7y%7y%7y%*yH=!7y%f`7y%f`7y%*yH =J4|a7y%aX7y%aX7y%*yH>EB:`!7y%7y%7y%*yH >a7y%7y%7y%*yH?j!7y% W@H7y% W@H7y%*yH ?$ߓaa7y&D7y&D7y'. P4!7y&j(7y&j(7y'. :]da7y&G 7y&G 7y'. v!7y& 7y& 7y'. :3a7y& 7y& 7y'. #!7y&t7y&t7y'. :,Ra7y&9,P7y&9,P7y'. !7y&7y&7y'. :w1,a7y&x7y&x7y'. /mj!7y&07y&07y'. :4'Aa7y&27y&27y'.  /!7y&!7y&!7y'. :]S*a7y&%7y&%7y'. .!7y&'|h7y&'|h7y'. :yHa7y&,A=(7y&,A=(7y'. W\!7y&. 7y&. 7y'. :TAGa7y&267y&267y'. ̬!7y&47y&47y'. :}%_a7y&8,7y&8,7y'.  d!7y&9l7y&9l7y'. : 1a7y' 7x7y' 7x7y'.  @l!7y'@7y'@7y'. : 5a7y' 7y' 7y'.  ’!7y' x;7y' x;7y'. : ɵa7y'<Ј7y'<Ј7y'.  !7y'7y'7y'. : B~Qa7y'2`7y'2`7y'.  {8"!7y'7y'7y'. : =a7y'(HP7y'(HP7y'. D!7y'7y'7y'. :ra7y'"@7y'"@7y'. X!7y'$L7y'$L7y'. :a7y'77y'77y(0 S/+a7y(O(7y(O(7y(0 Sa7y(, 7y(, 7y(0 a7y( E7y( E7y(0 pO!7y( @7y( @7y(0ĉS!7y(87y(87y(0.h!7y(g[7y(g[7y(05d!7y(b87y(b87y(0ma7y(&H7y(&H7y) ܳ` 1C#a7y()Cj`7y()Cj`7y) ܳ` iH8a7y(,7y(,7y) ܳ` +4a7y(/Ѷ7y(/Ѷ7y) ܳ`  _!7y(3e&x7y(3e&x7y) ܳ`Bl!7y(6`p7y(6`p7y) ܳ`)qA!7y)S7y)S7y) ܳ`-8!7y)p7y)p7y) ܳ`8fa7y)N07y)N07y)&ߡ0V a7y)PX7y)PX7y)&ߡ0hTypnam for $i; exit 1;; esac case $unit in 0|1) blk=16; chr=54;; *) echo bad unit $unit for $i; exit 1;; esac nam=fd${unit}${typnam} rm -f ${nam}? r${nam}? basenum=`expr $unit '*' 128 + $typnum '*' 16` mknod ${nam}a b $blk `expr $basenum + 0` mknod ${nam}b b $blk `expr $basenum + 1` mknod ${nam}c b $blk `expr $basenum + 2` #mknod ${nam}d b $blk `expr $basenum + 3` #mknod ${nam}e b $blk `expr $basenum + 4` #mknod ${nam}f b $blk `expr $basenum + 5` #mknod ${nam}g b $blk `expr $basenum + 6` #mknod ${nam}h b $blk `expr $basenum + 7` #mknod ${nam}i b $blk `expr $basenum + 8` #mknod ${nam}j b $blk `expr $basenum + 9` #mknod ${nam}k b $blk `expr $basenum + 10` #mknod ${nam}l b $blk `expr $basenum + 11` #mknod ${nam}m b $blk `expr $basenum + 12` #mknod ${nam}n b $blk `expr $basenum + 13` #mknod ${nam}o b $blk `expr $basenum + 14` #mknod ${nam}p b $blk `expr $basenum + 15` mknod r${nam}a c $chr `expr $basenum + 0` mknod r${nam}b c $chr `expr $basenum + 1` mknod r${nam}c c $chr `expr $basenum + 2` #mknod r${nam}d c $chr `expr $basenum + 3` #mknod r${nam}e c $chr `expr $basenum + 4` #mknod r${nam}f c $chr `expr $basenum + 5` #mknod r${nam}g c $chr `expr $basenum + 6` #mknod r${nam}h c $chr `expr $basenum + 7` #mknod r${nam}i c $chr `expr $basenum + 8` #mknod r${nam}j c $chr `expr $basenum + 9` #mknod r${nam}k c $chr `expr $basenum + 10` #mknod r${nam}l c $chr `expr $basenum + 11` #mknod r${nam}m c $chr `expr $basenum + 12` #mknod r${nam}n c $chr `expr $basenum + 13` #mknod r${nam}o c $chr `expr $basenum + 14` #mknod r${nam}p c $chr `expr $basenum + 15` chown root.operator ${nam}[a-p] r${nam}[a-p] chmod 640 ${nam}[a-p] r${nam}[a-p] umask 77 ;; ccd*|sd*|xd*|xy*|cd*) umask 2 unit=`unt $i` if [ 0$unit -gt 15 ] then echo bad disk unit: $i - $unit exit 127 fi case $i in ccd*) name=ccd; blk=9; chr=23;; sd*) name=sd; blk=7; chr=17;; xd*) name=xd; blk=10; chr=42;; xy*) name=xy; blk=3; chr=9;; cd*) name=cd; blk=18; chr=58;; *) echo bad unit for disk in: $i;; esac if [ "$unit" = "" ] then n=0 while [ $n -lt 32 ] do sh $this $name$n n=`add $n 1` done fi rm -f $name$unit? r$name$unit? minor=`mult $unit 16` for slice in a b c d e f g h i j k l m n o p do dev=$name$unit$slice mknod $dev b $blk $minor mknod r$dev c $chr $minor minor=`add $minor 1` done chown root.operator $name$unit? r$name$unit? chmod 640 $name$unit? r$name$unit? umask 77 ;; vnd*) umask 2 unit=`unt $i` if [ 0$unit -gt 15 ] then echo bad disk unit: $i - $unit exit 127 fi blk=8; chr=110; for name in vnd svnd; do case $name in vnd) off=0;; svnd) off=128;; esac if [ "$unit" = "" ] then n=0 while [ $n -lt 32 ] do sh $this $name$n n=`add $n 1` done fi rm -f $name$unit? r$name$unit? minor=`mult $unit 16` minor=`add $minor $off` for slice in a b c d e f g h i j k l m n o p do dev=$name$unit$slice mknod $dev b $blk $minor mknod r$dev c $chr $minor minor=`add $minor 1` done chown root.operator $name$unit? r$name$unit? chmod 640 $name$unit? r$name$unit? done umask 77 ;; rd*) umask 2 ; unit=`expr $i : '.*d\(.*\)'` rm -f rd${unit}* rrd${unit}* mknod rd${unit}a b 17 `expr $unit '*' 16 + 0` mknod rd${unit}c b 17 `expr $unit '*' 16 + 2` mknod rrd${unit}a c 106 `expr $unit '*' 16 + 0` mknod rrd${unit}c c 106 `expr $unit '*' 16 + 2` chown root.operator rd${unit}[ac] rrd${unit}[ac] chmod 640 rd${unit}[ac] rrd${unit}[ac] umask 77 ;; st*) umask 2 case $i in st*) name=st; blk=11; chr=18;; esac rm -f $name$unit n$name$unit e$name$unit en$name$unit \ r$name$unit nr$name$unit er$name$unit enr$name$unit sixt=`mult $unit 16` mknod $name$unit b $blk `add $sixt 0` mknod n$name$unit b $blk `add $sixt 1` mknod e$name$unit b $blk `add $sixt 2` mknod en$name$unit b $blk `add $sixt 3` mknod r$name$unit c $chr `add $sixt 0` mknod nr$name$unit c $chr `add $sixt 1` mknod er$name$unit c $chr `add $sixt 2` mknod enr$name$unit c $chr `add $sixt 3` chown root.operator $name$unit n$name$unit \ e$name$unit en$name$unit \ r$name$unit nr$name$unit \ er$name$unit enr$name$unit chmod 640 $name$unit n$name$unit \ e$name$unit en$name$unit \ r$name$unit nr$name$unit \ er$name$unit enr$name$unit umask 77 ;; ch*) umask 2 case $i in ch*) name=ch; chr=19;; esac rm -f $name$unit mknod $name$unit c $chr $unit chown root.operator $name$unit chmod 640 $name$unit umask 77 ;; lkm) rm -f lkm mknod lkm c 112 0 chown root.kmem lkm chmod 640 lkm ;; tty[a-z]) unit=`expr $i : 'tty\([a-z]\)'` rm -f tty$unit case $unit in a) n=0 ;; b) n=1 ;; c) n=4 ;; d) n=5 ;; *) echo unknown tty device $i ;; esac mknod tty$unit c 12 $n chown uucp.wheel tty$unit ;; cua[a-z]) unit=`expr $i : 'cua\([a-z]\)'` rm -f cua$unit case $unit in a) n=0 ;; b) n=1 ;; c) n=4 ;; d) n=5 ;; *) echo unknown cua device $i ;; esac mknod cua$unit c 12 `add $n 128` chown uucp.wheel cua$unit ;; pty*) case $unit in 0) offset=0 name=p;; 1) offset=16 name=q;; 2) offset=32 name=r;; 3) offset=48 name=s;; 4) offset=64 name=t;; 5) offset=80 name=u;; 6) offset=96 name=v;; 7) offset=112 name=w;; 8) offset=128 name=x;; 9) offset=144 name=y;; 10) offset=160 name=z;; 11) offset=176 name=P;; 12) offset=192 name=Q;; 13) offset=208 name=R;; 14) offset=224 name=S;; 15) offset=240 name=T;; *) echo bad unit for pty in: $i;; esac case $unit in 0|1|2|3|4|5|6|7|8|9|10|11|12|13|14|15) umask 0 n=0 while [ $n -lt 16 ] do nam=$name`hex $n` rm -f {tty,pty}$nam mknod tty$nam c 20 `add $offset $n` mknod pty$nam c 21 `add $offset $n` n=`add $n 1` done umask 77 ;; esac ;; spif*) case $unit in 0) nam=j;; 1) nam=k;; 2) nam=l;; *) echo "bad unit for $i: $unit"; exit 127;; esac rm -f bpps${unit}? tty${nam}? offset=`expr $unit \* 64` n=0 while [ $n -lt 8 ] do name=$nam`hex $n` mknod tty$name c 102 `add $offset $n` chown uucp.wheel tty$name n=`add $n 1` done mknod bpps${unit}0 c 103 `add $offset 0` ;; magma*) case $unit in 0) nam=m;; 1) nam=n;; 2) nam=o;; *) echo "bad unit for $i: $unit"; exit 127;; esac rm -f bppm${unit}? tty${nam}? offset=`expr $unit \* 64` n=0 while [ $n -lt 16 ] do name=$nam`hex $n` mknod tty$name c 100 `add $offset $n` chown uucp.wheel tty$name n=`add $n 1` done mknod bppm${unit}0 c 101 `add $offset 0` mknod bppm${unit}1 c 101 `add $offset 1` ;; bpp*) unit=`expr $i : 'bpp\(.*\)'` mknod bpp${unit} c 104 `add $unit 0` ;; random|srandom|urandom|prandom|arandom) rm -f random urandom srandom prandom arandom mknod random c 119 0 mknod srandom c 119 1 mknod urandom c 119 2 mknod prandom c 119 3 mknod arandom c 119 4 chown root.wheel random srandom urandom prandom arandom chmod 644 random srandom urandom prandom arandom ;; uk*) unit=`trunc $i uk` rm -f uk$unit mknod uk$unit c 120 $unit chown root.operator uk$unit chmod 640 uk$unit ;; ss*) unit=`trunc $i ss` rm -f ss$unit mknod ss$unit c 121 $unit chown root.operator ss$unit chmod 440 ss$unit # backwards compatibility with older PINTs rm -f scan$unit ln -s ss$unit scan$unit ;; local) umask 0 test -s MAKEDEV.local && sh MAKEDEV.local ;; *) echo $i: unknown device ;; esac done !@ /@!OǁJ M =⌄@2J`<"  J_"* * J *Á ? 4?can't synchronize with ventel ventelcan't synch up dialing...#k$ $ $D$I$A$L$:$ %d second dial timeout%s...#a@= 4(@b 4# ((W0R#€ "L(@b!L@#xa@ a @'(@!L  %a a@ L a"!!(a(@  @ @  !@!@ %5Ԁ !4"t( ,@P`a0( Ԁ  @B =Ԁ :4R#€ 6@i 2,@i L    "LL " J MI "@  ഓ*`@ `, L 2 (!H@av 㿘@!㿘!)` !@ @!㿐/*  & !ĢO # $!@   !/@f  !@a !@u /*   timeout waiting for reply 㿘)@a)!5 "cÐ!(@w 㿈/' )@a$'5"#@R!( @  &*4@"!@: @洐  * '*: Ð @ **: `?tip: ioctlP `x!!@)@= `y!@"(!(@ a"@ @=ڐ b@  6)@O|"H`  < <@   $`<  Ā '@= ``$ʐ 㿘@ dfiPRrW㿘@  )@Ғc"c5)* <-Š %#Ū )Ő@f?=? "6* %$$c$$c%cƦ %#@= @&*  @@@@ @ ŀ"c@@@#ȁ%s: %s%sfts_read㿘#̦  ##Ѐ@   # 2`@۰ 2* @ "1-*+Ţ ) @ܔ z  4? <* \\\P\\ @^  @&"0 4#̀   @^ @:%c#̀   @ < Ɛ@ݚ $   #̀ 2  4  @ <  4    # #@[  @   @ @'  #̀ #  *@:!%c#  *@ea%s: is a directory8 l /8!)- +*%Ţ '<@ 㸀 L#7  @^2 *a@:@H$   ##Ā #+ h@:/7$Ȁ 8  @ "* 8@@s @@ܐ # @@ "#̀  "a@:$  malloc8 @2 `@`<   @ ?@s"?&$@  +@b@ @`0 @   @Ɣ u<@ d 4<`<@ݐ gŐ  @ @_Ő @`0 @   @ G<@ d 4<`<@ 9Ő  @S @1Ő @`0 @   @j <@ d 4<`<@  @ @&0 Ő `"c@*!@9=remove %s? override %s%s%s/%s for %s? 㿀#  M H,aP@t0M#Ѐ "\ < ( T@[ؒ  "P @# @j @˖ M H,O逢` !`)#,!#\ @EM H@ې?P`? "`@u ?P  &?P y3Lcy ? & @uc  &c` y Y "." and ".." may not be removed㿘 A#@ ? ( J /2 *8J@Ԓ / J .2  J  .2 J 2   2 ,@8v#@  $c&`   &  usage: rm [-dfiPRrW] file ... 㿘M H-@`@ 㿘@,-0123456789an:oft:%07lo %07ld %07lx strings: length less than 1 strings: %s stdinrstrings: %s: %s %s:%s㿀@  -@a`'7 ?-"+=) #--@ӑ* :  G* ((((((((((`@* ?J@ - `@J` `@J` `@ `* @  7 #,@\#,J o"a x d-0 -0vat!r!@|o= @* @  M H-@̒a @ِ @, 2- # #M`H!-@[M!@@@ǐ -!P975??#;š, '@ -`aXL#@{ ? #  @[*'L# -a`@@?'# 'cؘ?'#y&L#S  Š#@M?e& j#耊2 !"2 !"2 ! " ̐  K"#H@ @! 2 , @@! ' @ @@ ̀ 2  @@@ ̀  @ @@!    @@@!  Ř##L#c@ ?2 '#& & '#"#ܠ #L; @j^2 M" @J`  2 "- `-!x@[cؐ@[{"@-!@[w@?#*: M" @J` c 2``?"`` c* $c@I 0ڒc` ?"`c* $c@I  @ 2@@㿘c#  "c܀@ 6##Ő# `"䀢`"L`? "`@r   "?usage: strings [-afo] [-n length] [-t {o,d,x}] [file ... ] 㿘M H/@]a@j 㿘@Lshutdown: NOT super-user -dfhknprshutdown: incompatible switches -f and -n. shutdown: incompatible switches -h and -r. shutdown: switch -p must be used with -h. Shutdown at %.24s. Shutdown NOW! ???forkshutdown: [pid %d] shutdown㿘@@   M H/@b@@  9//#5Ơ /-+'%#Ɛ@w"`?b?Ӏ E[* PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP P(PP0PP8P@PH &$%%%a($0$ $a@)= @&*  @@!  !0 M H/@rbp@!  ! M H/@cb@!  ! 2 @M H/@Sb@@@`@ Ơ!8$ @'@$@`, @@S`@  ,,   Ơ!8#%L$@`@ L L 2,, @!8a ` ",Ɛ!!/@C`#@Y0/@Y#@"a4  a4@໠ @ "/#($ @&?@` /@ zc0/@Yp#8@ @/#P @6$ @㿘! !, @  66a! a" 6 ƒ @& !   @K @(@s@6N@n!,@ڦ @6A   @PATH=/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin%s -n/usr/bin/wallwshutdown: can't find %s: %m*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %d minute%s sSystem going down in 30 seconds System going down IMMEDIATELY 㻈`  "`Ɛ @Vo!$11@{ 6"@"b1@Ƌa ' 1a@4P0V 1!1"1"4@ "X Ɛ!!1@BR"  @!ƀ ; <1@@ <1"h1"@ߒ ƀ 1bp1b@!,Ɛ!8@> @!8  2@O`@  @ƫ@  @F 㿘ǐ!8@ %s by %s: %shaltreboot System shutdown time has arrived but you'll have to do it yourself /sbin/reboot-l-d-nshutdown: can't exec %s: %m./sbin/halt-p/etc/rc.shutdown/bin/shsh㿐! 2  ! "/2 #P2  4@3!8@5 2@W !( "2@W!@Ð ! @i! '!0 2!82 2 !H!$ 2!P 2!X!$  2!P#\ @   2a`!2A!8! @! 2!2 2!H!0  2!$ 2!P !X2!!0  2!$ 2!P !X!$  2!P#\#`@ q 2a`!2!@3@22!@UE ? @? 2  2!2a@ ; @͐ @  @ @1 nowTZshutdown: that time is already past. 㿐3@V` "! @TҐN +  Mb  @@VƓ* "@*`" Ɛ "#%M L@ @@  2`: @O  ?,@ ,?,@`L@  3@ @?@7 "(N "3N0b  ^N?Г* @*`N В@$  NN  ?Г* @*`@ π`$ ` $N@N?Г* @*`N В@$ ` @N?Г* @*`N В@$ ` @N?Г* @*`N В@`;$ @$@Bl!ƀ?$!@!Ɛ"  " M H3@`@ @t/fastbootfastboot file for fsck 㿘3#&@*! 3c@ @Ԑ/etc/nologin NO LOGINS: System going down at 㿘#4`P@y !4!`@A @> @; @8&@! 4``@V "@?! @O 4`@J !Ơ!8@s@B@㿘!( 4@xȐ P@ bad time format.㿘4 @jausage: shutdown [-fhknpr] shutdowntime [ message ] 㿘M H4@]a@j 㿘@EweofretensionstatusrewofflrewindofflinefsrfsferaseeomeofdensitybsrbsfblocksizeejectTAPE/dev/rst0f:t:%s: unknown command%s%s: illegal count%s: %sioctl MTIOCGETP@{%@@  /Ȁ "ah @"ah!h4@j*bȀ 46 "c  @"Т %44"%4! @t耢? f t#,@= @6c&* ` @  @ `  `0? `@`@@] : !6$#@] :,@#@Ƣ` 6@ 6#쀢 6#x@%4'@`6"` @׊@i "    ""6#耢 @m @B 6  #  6#耢 4#@0@u  46 7@ @X ' J  6 @4@Ec '6#耢  W@t  6&# a@  6 4c(@͔#耢 @>0a@   4@c0@=6#耢 @@# 76543210WriteProtectMountedSCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) 㿘6#T`"#VV@"  5V @Tg#V 5 @0#V 5 @+#L`? "` * "5@TM#h0@B     5 $@TB#  ( , 05 4@T:#؁%s=%o%s=%x㿘  N 266 6!@T$x`vN rL`?"`` <* "@BU * "@A >usage: %s [-f] device usage: %s [-f device] command [ count ] 㿘6#쀢 Mah H6c8Mah H6cP@@ 㿘@ʐ@I !ǀ $!d@@J $!d 7@f``@+!`> 6 Lost connection to remote host.㿘7 @ջ`@shelltcpshell/tcp: unknown servicewho are you?/etc/rmt㿐!7  %7 7@1` $  7@Փ`@_@%7 "` 7@Շ`%d@[g @  d,@K 2 @ $d7 ǐ!d7`77`  @ ǀ?"a`@w ,' #?!`c @_a  <$'?c!!`@_Q $'  !`@_I invalid user name: %s㿘N M7*`: " @ `   _ -"Nbx@-’  N  O%s %d 㾘!7(@u7 "`@HcloseC 㿘!7  7#x7@8c$ statusS 㿘7  7 #7@&c Ȱ!p@w . 7 1Ȱ!pI%d %d ioctl㾘`!8@uB(8 0@?㿘!`@@l@@%s: %sProtocol to remote tape server botched (code "%s").xؐ@M O؀ E F Aؐ@C$8 ؒ@-)O؀ F?7" @_@J@ "*@8 @-@Qٰ㿐!`@1  OOProtocol to remote tape server botched.(rmtgets got "%s").㿘`,* :  , ` ,8@,ؐ"8"@@,Ԓj㿘@m:pinvalid file mode: %s%s㿘@w0  8@b@ : ! )8% +8@"? m p @, 2 ,@b@}!@{@= @* @@  @@1,`-@@ @?  J / *@8J 6 @@ 4` & `@@}6  6`8#@@,` `@ @/%s: %s89 % @|%@ٕL ,@|ܢ`?  28`2.`.2 @|ߐ  8#@,(?<    /@O 9`@, ? /`, usage: mkdir [-p] [-m mode] dirname ... 㿘M H9@Ob@\ 㿘@$OpenBSD: compile.c,v 1.9 1998/09/24 03:00:59 millert Exp $㿘!@ \" \@ @ H*` @ <* `P"L`@ 5*`"`dunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %s read commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command㿘 )MȐ!@(  ` 9@ ߒc 0}   ~ "@      ~@  L #"Ȁ "@ t & *  *@$9L@X)#@"W$ @ ` $@ "L  ~8L"@  " L   ~@ L ,27$ "  ~"@  "    ~(@ @ * $@~ "L ? ~"   " L  ? ~8L $L 2  9@ McP ,7J Ԁ`  LL@  ` L@  L@ 2` L9@ 3ch`  9cL@ *`` =; *` h0T\Pdܠ "  ~"@  "    ~@  * 2   * @$ "$  ~8$"@  " $   ~@ $L `Ȁ`  $ 9@͒c@" "L  ~8L"@  " L   ~@ L ;E Ȑ L9@cȠ "L  ~8L"@  " L   ~@ L \ L9@c "L  ~"@  " L   ~@ L  L:@l` @~$ "L  ~"@  " L   ~@ L  :@K`X:@`p`D`$ ?U$& @z.!?N$ @Mc#  :`@/DȠ "L  ~"@  " L   ~@ L  :@`X%:` "L  ~"@  " L   ~@ L $ :`@2$   ~"@      ~(@ :@`$ @P  :@Ȓ`@Ƞ L  \ :@`@o $@G` 2 :@`@?@ "L  ~8L"@  " L   ~@ L ;   @Ւ "L  ~8L"@  " L   ~@ L ;  Ȑ :@dayȁ\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])㿘'D , :  h'D \  < cD_ D <c@(DJ@ R, : J@ [ @D@M 2CD <@c=D \2DJ` ["&.@DJ@ \2 DJ`2D`#'DJ@ \2 DJ` n D .@D` 'DJ@ \ @J` \D.@`'D`DJ".@D @.@`'D`DJ@  [  *@J`^ *@`J] *@`J?  ]:*@J[)\J.:=!\ `*@J `]*@ "J$ `*@(8]2J 2J 2Jn*@J` J]2 "` RE error: %s㷐(  @ &@@  &@@l  @!=@0#@ @L@P` *"P123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expression㿘* :    i  ,@`$@@ג `&`&`  `T@&`@N8*`:  \& N=@To# "N,@``N    >@``&&` & \2,@ ` 2 >@͒`(,@ N` $@$(ʧ,@tʰ!@ђ( @ >@`Xmore than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'㷐'D &@&`&`?&`  #MD`"J@ @? ~8J@b @    `'D ? ~( @DJ@ g"  p 9 ; 1 n "wDmJ@hDiJ@ w`bD >@JbP _&@ \&` >@?bP DD@Ob P&@ 'D `? ~bD @   `'D `? ~DDJ J   *'DJ``* >@b@8,`D`&`& @v!? &`  @J%#  :`@ DJ@ >@bD b'Dtransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthN  \ ?@axe ? ?.a?cY 2 ?"a ~?M"@   ?  ~(@ ?#@@@ ?b@p 0@%  +@  (+@?#O @ +@J  &@㷐 @ 'M@b( >@? ~    " J ? ~( J  `\2 J " J "  *J  "  $(ǐ, @Ð*,@@̒ unterminated regular expressionexpected context address㿐N 9 \ 06  $ / @  r` 2&@ @@֒a&@ &@ &@@v &`@@Œa  whitespace after %s㿘L@ M"N    N  ``. @@b& @U@undefined label '%s'㿘I@#!#@ ?* :  8<* tt H $ H & @S &   @Qb@y  2 duplicate label '%s'㿘  @" `,`  `,` `*`̐!@ @'@ 2  @]` 2  @ 2 @Ȑ $$ $ $ $㿘 @ ,`  `,`̒a `* @ "   2   @] 2 $ 2  unused label '%s'㿘 ̨!'A, "  `  @Ò@`2 ,$OpenBSD: main.c,v 1.5 1998/06/23 22:40:42 millert Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s㿘@n> /AA#@+͠ )% '͐@yh?P? /8GM* @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@8%`D% h,@ː  ,@Ő $`M HA@~˒bp@ؐ = @`h* ` @` @`@ `@  @@`@ 0@ @I \@ L@`#   # !A@G&"Д @@ r%s: %s"%s" ..."㿘'7⠀ "W  r0##1#܀ `" T`@!B@HaH̀ "c # #!B`@F!P @ #$`" @̠# B@jX B !`, !`   *` *` *` *`*`" @ #$`"#!#@ `T Y"`TL #UL nQO" `#@`,"7"" T #J@ # J` n͐ "`` .#J  #7 i""##.`T "`T.. #T ##`"T @.`"а stdin㿐c؀ ?'̢ L#%C p ; 2$@$c$@B@GKaH  $c # @F/@ BaP@c`? "`@_ @  "@@_c $#@  X  !& g  "`Xc ͐ ^"`X#@G_#` `@ B# aP̀ @ @E  @#'@%L#CT`p "Tc`? "`@^ @  "@"@_Sc  $ 2$@$c$@B@FʒaH $c # @E@ BaP@zc#@  㿘@' " " 7""@"㿘@ 7" "@" "$OpenBSD: misc.c,v 1.3 1997/07/25 21:05:41 mickey Exp $%s㿘@J   # !C@En#ؔ @<㿘  @u   # !C@EW#ؔ @%㿘#c耢 "@DDx@" ʠ$c@csed: %lu: %s: 㿘'L'P'T'XM HD`@|L 4 !M  `T@D@|`!M H@|D@|~` @ $OpenBSD: process.c,v 1.4 1998/04/30 06:21:16 deraadt Exp $%s%s: %s %lu 㿀" T'ͤ+5/-̨1L  $ \`3@ "@ `?Ƒ* : `CD"*` X|H l$<X`,H  *`&HL*`@ *`%L`,L*` * $` $ ` $$` "`  0 ".@` D'! ) @ 3 ?$ " @$l    @ @@ @` D!@@ `    @#@ƒ  2$@ @  2@ `    @#@y  2@ @Ֆ#@ 2@ @y ?$$ @ξ# 2$@ `    @ά#@@C `,H  *`&HL*`@ R*`%L`,L* @*` $ `  $ @` `,$ `v%`,@`4@p&`4`4 "m@`&`4 2f@`?` & @pR!? $` # @C`  DaR`@ H # @Cu`  DaA>@  Da @ '' ''' $ $ $ $ $%% % % %  2@ ` @,  @ TD"@D9@`Z `    @#@> $\%d not defined in the RE㿀 ̀   8 " @  ` Fa`"T ͦ@  "`   ]?0J!ͬ  `  d@ @  d@y  `@ d@`` `    @_  d  $   @C ŀ`1͐ * #͐`d `   $ @, ?!͠ `#`d $ @)  `@`d`   $ @`` ' ' ' '' "` $  $  $ $ "" " " " "    L@( `"5   21 ` ?2!͐ & @n! ?"`  #  !D`@B'! !    @B     #  !D`@B! ޔ rstdout: %s?c , 6L+)L? `L``  `  @˖#`  G@Ba  @z  @̸#@[^`  ,`LL# @ # `G! @A  " 4" ,COLUMNS\ \ \abfnrtv%03o㿐!7"?2NG@*" " @B0$"`h@ 7 " <$" <"bN gG#L#7"G@B}# NM"@J  \c`?"`` c* $c@0 7 c` \?"`G#`c* $c@0 \N@J c`?"`"L` c* $c@0y  G#(@B&  N 7L`?"`` $* "@0Z $L`?"` * "@0K L# @ # `G! @@  first RE may not be emptyRE error: %s㿘 @,  q'͑:  & \ ?M"@  *`: ?? "d, :  \2  N`\`&2   @  :& &  & , 2 * @?@@ ?"*@?2  ?"!  "@ "?@ d@ & &  & d @@  & ,    @  & &  & ,㿘    & & &"&  @ & *@%s: %s㿘>'I% ?N  w"!  { s" .") * ?" @    @@` ݔ " ?"& @z   @?  ˔& 2N 㿘 `" 0  2 {  "_  2  ")    @p  a   T@ X  X S ͐ "`0 *@$    @I  2 :   T@ 1  X ,  2   T@ " 0  $ @  ` @    T` `? X 2  `?㿘   8   H%b( " 8 J? "? ̀d  :8: P   d@$  `8    !H֠"H 㿘@hĔ7"㿘 7" @7"&allocate bad sizecannot allocate㿘   J@maȐ?2    @``   :  2@@@2`  Ȁ`2+. @  2@J@moa7"2"`"@ &@"@@" @"@"`.  @"` ` "`?""`  "` @ allocated object too small㿘? J @m9cP4 / ` ?#&?""& 2&&`allocation resizing free pointercannot re-allocate㿘  ?`ȐJ@m aȐ2 = `; ?  @ J@lc,`@[` @@2&`7"&$"&K@l`@2&`"`"@$"&` $?$?,`  "` "`Q @` ? `$@` ?( @ 8 2   @ @ &$??,` $?$?R??`@$? ?* 8@]@freeing null pointerfreeing memory outside of block (corrupted?)freeing free object㿘 2?K@lZb I?    K@lLb   * 2?K@l<b+` 2&`@&?&2# ?* 2"?@""     *   @㿘@2 7 ""` "@@&@@CLPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s 㿀J X #!L`(@r: ? L"  P ?}`(  (J`[* `Lj L@ жL@ `L@ @7"@2Y$LQ   2  L@R]a J$@7"@A`L:! 6L-J L/!(@*V L'!H@"@ @`@@@ a0`@@ @@@@ @$!`@Jp $'!0$`|'' 'L@$!x@I!'#@sƘ@@tR@ 䀢 #耢`L!@J<  # !L@<<!@J1 @= #J@ "@J@ /  @t 쀤  7@tr@|`@tk"쀦`L !@K can't get current directory - %s㿘J X%#L(@q1`? L"  P ?(  (*  L@JA!`. #J@   @tS  @:  & L @s  L # !M@;!@J !@J’ Rnprsu,ne-p: %s-u: %s: %s㿀 J e-  ` L@ - L` `L@*`:  n e  E2 L@ `L@  @L@   ڤ M#N T'Ҫ((@p?m? 68* 9|888888888888888888908888888888888888889D888888889L89T89989 M#   @Kr䨒 M@Iw#(  `L@   @JՔ䨒 M#0@I_ !Ґ (   (*  L@Pa 2  (  (?$ ( (*  '!0 `''@ l'?#@@j( S \2R+@L@ f0` r a"H  b 0".  \ : \;+@: \7+@ c \1+@"0  t n \(+@ v \"+@! !      @А , *: @И  `+@ \`+@`L@ `   +@` 2 +@`+@!`  "`@G7   #@  @k ! + @Z 6@ c @sc 2 @,  @N$  @] pvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*㿘 J w`?O!xO!+Ґ`(@n? p"  v ? V`(     (*  2 ? 2ت ׀`ٰ     !@!@   !@| 0@  " @9o O  `O!@Hc ?`P *` AAPBB@@B|O@HM!x O!O!7"@H< O!@H4@oC ]ZO@H+! O@H%! O@H! 2 OO@H" `O@H"O@H"(:7 O"8O"P7"(  " O@G"`  2  O"hO!7"@G  O !O@Gݐ" O"@G77@G͐#2+"(㿘L#R#UZ#fi#lprtuxponly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s exportreadonly%s[%d]=㿐 P#J@ r s e   t    $P#0  ҰQ! (`   %  (@mq?i? 9[ * GhFlFlFlFlFlFlFlFlFlFlFlFlFFlFlFlFlFlF FlFlFFlFlFlFlF FlFlFlFlFlFlFlFlFlFlFlF,FlFlF4FlFlF@FlFlFlFHFlFPFlFXF`FlFlFh # # # #@   " #  $ #    +,, - '@jB  '@j9  Ґ(  `(* `J`-`+ `J  ` "( ?#瀊@P@E#8u  (*  , ,P @  ,"* (*  C @@" (*  CҪ @ `"#@@@g4@6   *#(P#hP#x@ @  `@s "<`@ Ѩ 0 `8!0   Ұ /P-P'L@0 ``-"`-(hx  @a @F   L ڰ P@E\#հ !0  ϰ "-Q @  /O  @ "` `2@`"` "  " `U`RP@EȐ#"P@E# P@E#$P@E# P@E#@P @E# @P @E#@@P@E#@P@E#@P@E#@P@E#L!@E A09 `QQ  @Eq Q  @Eg `-@Eb `-7 "7@)Q@EU (0" @b@EK7@lX7@ED#"  2g F L : dprtUxMhM`-taunaliasalias: -r flag can only be used with -t and without arguments alias %s alias not found 㿐Ӭ 0' Ґ (3SS"p' %Ґ $ @k"aHU   - + 98* P$NNNNNNNNNNNNNNNNNNNNNOxNNNNNNNNNNNNNNOXNNNNNNNNNNNO`NOhNOpNNNO  8   ( (*`    "J`-`+2 J  Ҫ  Ґ!8`?` S S@D{!p۰ Ґ (@j S@א!PҰ 6@i@ -`9S3Ҥ` = 2 @!@rʒ` @rǒ`+7 2 =@rr0?$*@`$@kR 7@D>#@ ܢ` "79Ҧ 3 =@>f $@`0@df@~`8 63@~ 'S "S!@r  @r}`+7 ? =@r(0$ =*@`$@k 7@C#N S!@C F'@~|   `$  " `2% !`   ?$ `  `, @5  `" @c`$ `$ ?$`+ $= @@`$0`  2radt㿐Ӣ 0 -+T)!Ґ(@ic? d"! t ? a(( !8>  (*  )@}f@}Ғ 2    ?$   ?$  2@~/#@~1 "  ?$ |` ?$no arguments㿐   U@B!(0   @9-   `? lpnz㿘 )'U (@i5ᰀ? n"  p ? l  ( z (  ?  (*    @Jc 2  @J\ 2   bgjob control not enabled%%㿘U@IMbȀJ P`? U@B "( #Ғ`(7@hܔ ?`( *   U@Hƒ ` "@H  J Y" %*d %*s %s%*d %*d %s㿐`7# +   U#\  @U#\@qq#`bad signal `%s'--ls:Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %d %s%s%s: arguments must be jobs or process ids%s: %s㿈  )L -& !*   M"  Ґ@~  2 V h V@H`x "   Ҡ (#V@h,`? l"  s ?" @~e   0 ( ґ,`   Ґ V@p̒`7@A+" ,` %7# #L!V@@e4쀢  ' *` `a @A   J Y 7" 17'V%7#@ " @A ``7@A#w   '  @'`   '7# #  @@4'@ @4  $ Ґ  U @h B  V h@@ 0; 3 1 % @F 2( '`@dy쀢 V @@ ?  @I   `@i 6 ` # @2 Va(@@u`,` 2L㿘  J Y #Ҁ aX @g$ $aXmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARG%s is readonly㿐!Ғ (7@g ? ( *  WH!` WA"L@  W@ J Wo" !0  L`2 W@@;b@t  2``?&   Ғ`*` 2`!X  !X  *@? @W"X@?Ӱ 0KҠ!X$ @f  ?    +// /  ?/// ?!X!X" Ҡ!X  W@"@ 0@"@ @$W"@? J D    @c @6 lm㿘 )'X (@fR@? l"  m ? ( $  (*   @@:? = "*@`@ 2   2cMc1cCc7<cxD,cpJc`^cXUcPY0cHU8c@7<c85c(D,cD,cSc>bVbVbaDbind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+aliasHf`?%s: bad numbernothing to shift㿐#0`(7@e ?") `(*  @5|  6 X#@>   * "    @ $ " $ X@>#ذ Sugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad mask㿀 %#Y(@eZ`Ȁ? ? S"  (*  2;@ * 2 @} ,< Y Є = Y ؔ   . .  #@< "` . ``  ,. .?Y @> Y @>ܰ !*   Г*,?Г:` А ( N ",Y @- * 2 @)<N 5Y3YZ 8`"`*`@8:` `N g  o a" `I N u"`@N``N `" INY@8ʐ! u  NI<<a*`@8:` A ?* :  5 * hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh    I"N N  @ޒ-:  -", = +"  N,`N",N`,Y  @8[! "NN bN <Y! @=f ,@q2  %s: %snot found㿐!Ғ (7@d) ?D (* `> `, @0   (Z`!( Z(!* @ !0  "@    `    @ZÖ   # !Z!@.@=  㿐!Ғ (7@cڔ ? ( *    @B  @B `2  " prsu,-p: %s-u: %s: %sREPLY%s%s is read onlyp  Ң (Z@c?3 r"  s ?* p  u @>Ԩ 6Z#ݴ `L ֨  @>Ԩ ѐZ#@<  (*  [? &@=B @gƔh@7\ ?  ,@  [ @<  '!0 `'' 'ج  '!0 `'' '?#Ү! 쀤 x"w@` ?`$` @`$`@j"` @(`$  @y @ $@ ؐ?$@],?$@]  J f@  @S(!D@S  ,\    * ` 쀤2@` @ 2@, @ 2, " ,? " , ?*` *`,@ $ @g[ @; 02J D    @v @  S`@gؐ ,!`  "`@:kp䀤` @=< <`?㿘!Ғ (7@bE ?!0 @P` (* "  @Y" trap -- %s bad signal %s㿘!Ғ (7@b ? (C *   17%\#\#$  " ?@;@b @;ېb? ) @xG    \@;"  "L -2L  "    @x,  "?@y 2 㿐 !Ғ (7@aΔ ? (? *  @^͒  Ғ "! Xc@:ɔ"!J r`!0``@?* 2  ( ``2@` !  @B  $  @Zh@Y%s: bad value%s: cannot %s%s: can only %s %d level(s)㿐 !Ғ (7@ar ? (*   @^ D  '`] @:8 !0``@* 2 : 2 ` ``  2```2@`   ]`@:F  `# 4`]`@:; J b  @Y vPvH-set㿐!0 ` ]n"89 @\ 0  &*`?`@@Z&  &: ?$` * 컒$`& ` &   J Y   fv㿘  #!]`(@`ɔ#h? f"  v ? `(  (*  "()[@+@ " $ @9ʒ` @4 [@@  @+ 2   ߀Shell: %8ss user %8ss system Kids: %8ss user 㿈@!^@x @:G#^@q`@:@!^@j @:9@e@:4 real %8s %8ss real user %8s %8ss user h@V  @#$a!$!x @$N@G!x"ܒ"@ @ 'a"      @ 'Ȑ  'Ң ^!X@ @hݒҢ ^!x@Ȕ@hӒҢ ^ @ ̔@hɒ@ek ȁ㿘1Ͱ .? . ?.?@n  0.@   ` 㿘a0 $  Ҥ Da0 . R $L@L 2  $  a0 R " @#  a0!0"   }`i}Xc}P~}Ht}8{}(t} q}{4}s\}c|s\|vT|c|x|r |k0|l |~|c|P|e,|wl*=unset+umaskulimit+truetest+read+=wait*=trap=times*=shift*=set*=return+false*=exit*=exec*=eval*=continue=builtin*=break[*=:*=.-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]-tx'c!'c"<'c"|'c"' " `,` 2`_@?=b  ,`_@?4b _@7"h f  'ܑ,``\'ࢄ W Ҫ D€  쀤`#`  €   @ ؀`̀ 0ܐ?'܀`ؐ  M``_@>bȀ    @ `?`?€  "   '@ ذ㿘`_!h_"0N # N@ *`: `N?2`@> 2 `@ 2?怢 `N@   internal error: unknown opȀ  `#`"8*` ptH 48H\4hT (NsNN !`? 2@Xʐ '4'4Ґ DJ '4`?@k X@f S@a N@VI@UHD @KF< 7  @@;< , @50< ! @*%<  @<   @U#< ( @ < 0 @ ( @ $ @ " @Ȁ4۰ ̀Ӱ  @Z4 '4 $ 4@{'44 @a( @@^@ `? @Zg @=u @ZZ @=h6@=c2 @=^ 4  0~0@,Ք  ,@,ϔ   m$`*a#8*` P\t0Q,0, V@ 0,@6Q  0N0,0,@$G  0D0!, @T7;@T286X@42  0/ @T%)@T 8$X@&   0 @T@T88@<  `? `  㿘@S8`!( @S  <  I  ? `@%unexpected operator/operand㿘@ ` €  2  b p  `?㿘@ 2   €   2  㿘@ " @ ` €    @ 㿘   €  `?@$missing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator㿘 2d  €  `V €  2P b G@ €    ?b 5X(    b 'p €    ?b       @ ?b  x)(!-a-o㿘   ``? Ғ`c  a`.`@;@ `?   $ 1 ` c8"㿘ۘ%s: %s%s㿘 .`    &c"@4 0c"@4 tfxchdXs@l0mnpprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)ulimit: %ctoo many argumentsunlimitedinvalid limit: %s%-20s unlimited %ld exceeds allowable limitbad limit: %s㿀   J` ` H*` S* a*c#@ # * * f+%͐`(@Z2? S"  a ?" H" " c#` #L" 2L  Ґ d`@3p  (*  @ `2d  d @3 0 d@:O` 2#?!#c@)Ĕ  䀢 !*` d a@xD: 8c#`z#+d#? 2 ?@耍  2@3a2 2d@3! @KV;  d! @3r ְ I  *`@` 2?耍 2? @ ` # !dd!(@$6!@@2 0# 2` #2 2d@32!  @K ;  d! @3% 㿘Ғ#Р?"`"`"` "`"#А "`8"eb@qM ! |c "c͒ @" @e* ̈́  COLUMNSLINES㿐 4! @."8#@`h@( %   7"#e"    @| "@{g  e"(   @| @{X㿘 @s Ғ DJ` J` @< J` @?@Z 㿐! 1Ґ @Z  # `#  @E @o @A  `?㿘@^  ȁ㿘Ҕ `2@` 0"* "㿘N Ҡ  `  *: @`{ N $ *  $ N P`W "`NР ' ' ' ' ' '  ' ' ' ' ' '  ' ' $ ~w' ( ''''/ /$ $ 8#@$ $  $ /@v/@F   @08#@Ғ`@v֔   K@ @K` 2J`J) + 8(8 2J       4?2  `?J `2"@㿘@ / 2  #f#t, ,`@/   @S2 0 ,  2JH #    " J#" * `J `? "*   J " &J ??  #H 2*  *  #*  "㿈 n@@h @@ .@ @ .P`$  @@ J? /" `@  !!0* `''.    ' 0$< , s', ''.@"@`' a0$< , W', ''" 'R P @%!0`fileglob: substitute error(n @ 3Ҵ a0!!@E@"" $!@>b ! $!g@0!cHW $!a0 ⃒`'' 'Ғ!t@$  a0$< , ', ''"@`'"@ a0   .  2  @6ܒ @M J Ґ@ !0x` "&&㿘 @`@6  `"@FPATH㿈߰ @#Ҡ@’ a0N`a0  `'' '@@0@a0   @  L 2,@'h@v!x@w7"@":   &!0` D . * a0Ṓ`@$@@@  $`2 @@6  "$`$``  ` h@24  Ҕ,  %  !0Ò`+@U, ?@%Ұ@5  0,``& ⥒``@ .``,`&. ' a0$< , ٔ', ''"@`'"@0 Ȕ&;|&()㿘&'d ! ?*` *`:  ' " !*`  `'  J "    *` `'2J * M"   " <  @iL @)!` ` L /@`@&L @`?'&&㿐\` '􀦠  h h!g#d@ $  &$'@*+?@!㿘 @@a0`@N̔.N '%iL \2LL  "L `*`[`?`$"LL  (2L@(  L /"  L  \L  N ~ *`.@* 㿘  @}@  + @@ JJ @"   㿘 #ґ, @ " a0]` , !0T`㿘`@}P N / ?8N0 /?N /2& *&㿐@h˒#@h͐ # @QX @` a0`$< , Z&`, &@&`a0@M`@"@`&@㿈@|  '!!0 `߮'' t'@' : @|-" @M / @ 2 @,  @,`@   /, "@@Mɒ@{ $ @< " :   , @U  , %@@@| @}a0` ,@&N tͰ h֘P@0hǤ8 p `P @(0ְ  nj0t(DphxXô@֐8P(x8TXՐh<`(P@@0 tpcommentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#-1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[%A"BCD㿐" " Ͳ" " " " .ͤ " " "!\"!`͐ *`#'͔"7!aDb$ "`"`"`В aD " "d ͔""@B ! ! !"@ ":  *`@^"?$ 1k!8')Ͳ @ V !\@  *   ,`*    ,` 6@% " ,`@!\*`&!\* @ "  0 0  ",0  "@@g  @Ia 㿐 2/@ * 0 1 /@A ??&  㿘` > @  0 ͓*`*   "`J ""` 㿘#`  ! @" @z˔ @zǔ  `@$ $`@ ?㿘#`'@yِ !?@ " `1 Ȑ ͒`?@"Ѐ ` ?@nL 8?͐ "`̰ 㿘  21@ 0  4&  @)" @  㿘  @@ 0 4"@  㿘 f􀢠  @ """ ` @z ?? "@ " N@?@2`?@! `"@z- @/"` `Ԑ "@ @4 @B ??? @8 ??͐ "`@ " @   @N@ @㿘@  㿘@ 㿘@T `@@㿘@K ~ 㿘   @ 09`??2#` M" #` @  *`:  _ $` @  2 *`:  _ $`  `??#`@G 㿘   @ 07`??2#` M" #` @  *`:  _ $` @  2 *`:  _ $`  `??#`㿘 Ā  ܐ@ @." 0`   ?$ @J?  ?0   J@`@V$   㿘@??@I ??㿘N   *@ : N`      㿘!@ N Ȁ Ѐ@  *`@: N  Ȁ Ё 㿘  o@6#x0  @ ^  ? @@㿘  @ 0 4"c" 㿘  @ @А 0 4"O 㿘 %!@*  $ %̀` @"    @"|  @ 0??$  㿘@s "͔ ` 2J@{ 0  ??" 㿘@j @h    *@`"  㿘@5! 㿘@/! 㿘 `* @%"@ 㿘 `* @@ 㿘 䀢  ! !!*`  * "@ 㿘! !!@ 0  "` @w " @v"` ͒@"!@$  @ 0@㿘a`a" `:"@ `|# 㿘  @  䀢 {09 I-search: 㾐?/%̀ q@ H@@ G = @ )1  2??,۰?! #*,@ р   ,@Q  O`^ $  B?  @ @Y @? 㿘̀` ?a %Ͳ @$ &a@[ 6@v4L@`^ ֐D?0 ?:@H !?" 㿘J@ ^`@v@-7   ?@j ?"㿘%#*`ݠ$`!@"$ ͐ "`` $"`"`*@"` 㿘  㿘  㿘@? 㿘" ̀?  @#%`@2!!D!d @=d!D "`"  ! Ԓ`" @"``@2    Ȁ@  Ԁ A  Ȁ@   Đ"& %#`ؐ?@ @  `  Ȁ@    @  >  *  @8 <@? @ ?? `( Ͱ ?#L 8?͐ "`́㿘1  @ @` 03 @J J "@ J J? IJ? FJ? ? ?*? *?J :J 7J? ?*? * J   ̈́? \ ̈́  \ ̈́  \ 㿘 䀢    " " "  4" ఢ@ <  s  㿘ͤ @EД!!T*`@ ` ؿ!T * $@ @[C $!T nothing to yank㿘!T`͐ "aX"!XX!*` "X`"`0s@ (? yank something first㿘 0  #s@ڐ ?0%#%Xa* @tv@`"@  X ?$X$XX* @ "X!Xa* @ ̈́       ȁ(㿘@e  㿘^͐ "``?"`"`"`"`\*  㿘!0@E`N *`:  ^2* N>  ? ` +*? N * ̀ ` 2*` ^*`  @ ?*@(́ %s%s = %s '%s' 㿘  7"!s٠#h@$ 2 7"!sΠ#h@$!sǠ#p@$ .   k!8*@ *`@`s #x!.`.   s#@$icannot bind, not a tty%s: no such function㿘#` t@# x k !8!s*` *  `"   2@$:#x :   , `  " "  2}`   r ' ` @ ,     ` `2N@ZW 3 +  k!8*` *   "@*l  :; k!8*@ *`@` t @#' ܐ@C` ,   !.,   `  ,  *!.,  " 㿘!͠ t͐?"`!Ր"`  `* ` ͖  +` @*  ``  l#  ``E *  *  &c`"a " !"@``"` *`  *`  (` (`  $*`( ́ 㿘 `@ 0 @"@"   "  㿘􀢠  "0@s  㿘-+`#`'%@%!"t$`%$`Ĩ" @r;$%`c}@4%%`$`$$@r*?U`` @   㿘 @` 㿘 @Z  㿘 @T  㿘 @N  㿘 @H  㿘 @B  㿘 @<  㿀#\#`#͐ `༔" ؖ" `@ 0 @ m"?%7.  @ 뀦6    㿀  `9#\#`!͚ ༔" " %"   @ @(" 2  a0@B耢  `" #\#`͚`༔" ^" B`  `0<0@qU$ ܐ`$@ g# r 0#  @ А"*o J? /7d"0@C 㿘`͐ "` ͓2  : "@ @"" 4"`N7 ؝㿘7b؀ ?"b`` `J@"`J` ""` 4 㿘  !" ! `Ԁ  "   `  ͐?$ `ؐ "` ̀   ؀` Ԑ?@㿘Ǹ Т `Ѐ  *`: N 㿘  #Mb @ `  , * ? b   ͒ " " l" "  㿐1C % ͒"@ '  "@   $*  "`v"`    a  㿘!`U 0 䀢 7@p-?@#N   " '?8NN "N? N   "`'N   " ' :0SN*`:    " '+Ͱ N $N"N N     "`'N*`:    " ' N ?`"N"N N     "`'N.. 㿘@ U㿘@  L㿘@ C㿘 ` 0j??d  MIGb  @  *`:  _ $ L b@  ` *`b@  ⬓*`@ `*, b@   U*`:  _ $ U b@   *`b@  `*`@ `*2 ?? ː  㿘 耢  ` %͢ ܀ N`  " ͒ "  ȁsubstitute㿘 '0#a@4@$$ $a@-x ! x@8c$a0ݒ`!t@H㿈 ?!!0 э`''`@ ' !0 '''" '@   a0$< , ', ''"@`'"@0  㿈!0 L@'' '@U":  7"!0v`㿈!0 -@'' '@6" :   07"@Œ!0P`expand(NULL)%S%s: bad substitution%s: is read only%s: %sparameter null or not set  ' y@}aȀ @j Ҵ  DJ` 2J` 2J` 2@ '!!0 `''@ ' '(@ ''Ԩ'?$@@?`y#p.` d|N  y#, D\l Nް Nڰ  ȶ ƶ   $,@` (,@N`?$@@>,@ N `4 )@`2@  ' # $,@` (,@`,@N`?$@@>,@ N ` ),@`,@r`"' '/ g@1 @Q  @eL [?$@@>X ,@ L `I @3  ؒ@ @a   @y @`5,,y@!2 @E  a0 ʒ`" " %  `5$@5 5 `% 5  ` %" = #   ? !  ,@`?,@`""( ߴ@a4 ۰ ,@U  U   %  = #" ,@K  ?"5U E ,@` ),@,`U   @e=@ U@"' $"U y!@x  @la0 O`@@e @e '؀2 @ @ @̒y"yb @O| N '   ' | '| )k 쀤@ge J n'f   J d'؀W䀢 2 'ؐ `P'7# W䀢 ? HW䀢 F C `ܦ ''`  ?"` `  "`@J    `'` ܦ @J'@GW䀢 '@!"` 2耤2@-` * Қa@ ` * Қa@ m2,@`h,@`$@`@ @ $@ @@ ? `@7 `   a0$< , ' , '' " '   a0$< , ʔ' , '' @Ȓ"@`' (@ ' 'a0 `!''@ '耤π`g * Қa@ ^ \ -߀`]|!*` ltttttttttlttttttttttttttttttttttttttttttttttttttttttltlttttttttttttttttttttttttttttttA[`@9` @@3{`@0` ,@*`(`$ '  " `('@8  @ 2  ``'@ ,@ 2,@`,@`,@` %s: parameter not set㿈N@ $N@ #b N` _N 2?`@m [ % *O  * @ *O  ] * @i@a @2 # 2 2 @!0  @a@b7"@ @j9J W  2 &`2&} @&@; a0@;`$( N  N : ҔN  J  Ғa * @  @@2`?N  J ` `2&N ?&'N@ * @# ` %? = #!0 `   @7"$ @  ``$` $`z$@ [ x `O  * @r `O  ]n ` %? = #!!0 ``'' '@hJ@a # " 0$< , Ҕ', ''@b"@`'2"@ :  7"$O  @  !0b`5 `@  a0, ̤',  ' '" '$$ $O   @`?4 = @a* @ D? A@`@a$$  `Ґ!,  @2 `"J 7"@ + = - ?J WҰ J W 7"@Ґ! *` @2}  +} @Ԓfunny $() command: %s%R%s: cannot open $() input㿐!0 @.`"!!@R0" $! 2T@N .` )` $`    "   ~H!~@[ˠ#0@   @Cx 0 2!6 ~#P@@ @C  @  @ @g@ 2 @’@= 6 &  㿘@} %2#0Q@0L@8J @<. A. (;*7 @<. ..?:(*$@< Ұ?a0&@9;@ @W"@㿀@`$< !'!0!`ʥ''' '耠` @ @`&> &.@U@2}     2Z  @6B"  @  L / '<% @(@ @68 ? @   2. @ (*L /%< @(@2   @58  ? @ @<  2 /,@`,@ a0$< , ʪ&, && a0$@@8W"@`&@ /,@`N /?$@@8P,@N /`@. /  , @g+@; 2,@$ @" $@8)@d@g@&@;Q @#@ F  @  <L  .  O   .2OO  O .N .@;  @fِ  @"@@7@f@?&@@ @  â@2,*+?@! 㿘@  -$@ @eL@ " @% (`2 @`L@  @8@ ` 2 @ @ ,  ",, , `L@  @,@㿈 '!0 `*'' 'L 2"*L / `:"*?"@7d  @*L `L@ / @*   @-6 N "&@?$@7; 2, , N  &HOMEPWDOLDPWD㿘N  +@]u"@^2 NN  2 N@]h"@^ - N  @]["@^@ 7"" 㿘!@P!@Q0 2 @8    @6`$ `$ 㿘 @  +N {" N  `N { }   ,?2 "N  # b$0b   a0$< , Ô& , && "@`I& 0?; "& 2N { }+  ,? ,2% 2"`&!0`@du@dp@@dk,i2㿘 @* %sPS4%s%scoprocess already exists%s is read only%s: %sX'D'H'D +H H  DR HD@N?@4 # @Rڐ DR ODD "` *`:`J`e'䀢`5 0"Ң`!@\,"@]Qƒ @Dk Ҳ"%7#7  ``c@DS  @@  @P D  !DR DR  !0 @8` !0 @@d" D %D  #Ҳ %'7@ 6 ' o$a  kg@/ D?* : `Y"*` Xp\x\\HHD@06DH `00H `'HH 'H@+!!0` 2@!0  R@  @ !0` D2`R !!Ҡ@M @ DH @W` @ @OH 'HD 'DDR !!0 R @ !0H  `@D@82H`H "'0DH Ē aD 'DDR HD a0ː ҒaL@cz !0 2@n  " Ґ @cl @3k@2 `  ` @t"@  @!!0`  2@ !0` 2`@Ԑ @ @b3` $ `$   @x  @  @n&` $ $  $  @c$ !0 2@H` ?'HDH @b0bDH  G`0ZD B!'D  DR@@  `?@DH , a0?H!'H0<D #!5`? D'`'b\'cx'c'`(ݴ'0  'D  "D - 0!0   '!0 2@!0 @m͐  !0  ?  @2@28'0'DR %# !D@Z@ $" D @"'@[DH  a' 0@  "Đ 'D@Z @$ D @b@[DH  a'0!0 2@!0 @mk  !0  ?  @2L@1֐'0'D x!DR@@  `?@DH i a'0D  xD ^! D H D H P a0cD  D`'DD`YDR TD  @6n  ' D 'DD݀ DH  a0.DH  a0(D D@|HDذxD @^'@P@2DD`@  # !D@@"@͒'@1"aH @17  H! J I @1( @Ob _builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not found㿈'H'P'Ғ DJ`  J`     2 #( "@\M @Zs?H [ ^#^#4P##'H  OH  `X@ 'HH 9#@H   2P 'P$H & `(@7`(@8 耢 p?   J [  =`(*  "@Ȓ 'HH  "( H H!  " 'H쀦@W=H H   H(  JD 2  @?D'ҪȨ"@/ M!`'`2 @X$"@YI @@bb   7"7#@@T   @<Ȑ  @[   @ ˢ``g H J [  @ x /  `@t# @2'HH    0E 0@H@<'H EH   H   ~'H!   `HH  @-   # 'H!`@ p @*0 @J@i  @   `H @'0'H,'H("&",!0 "  ` !!0H"@(`  "` !X"(!X ", "0 "4 "8 "<  υ"@Ғ`DJ`!'HH2  *`!!0 "'H  " @j3  HP   a"aHH* e@ = "H &$"a,H  HH ?"` H@T`H"` ̓*`      !! c!@/G@.ѐ@/C `@̔0WH #H   ~'H!  @ @_0@ `@Y 9' @Rc 2' DL   #(  @Z2 H@XW` P @)P "!7L  !7#`@N|  @Ny ͒ 2!h!hH" ` ?" P@" 'P "!@.j EXECSHELL/bin/sh%s: %s: %s㿘@Vt"@W L `, @ L 2 "  "?& " @@͔ # ! @"Ȗ@shcomexec: %s㿘#Ңc@I@I  @c@㿘!0    @Iݔ  L 2 L"  L@I&& &  㿘 @IQԔ  2 "",  ?$$   @S$`2`@J`?@R^ $ `$V` h$ 㿘 N = * a +@ @  !@I #@I`" " " FPATH㿘@H J`^@ 1 /` oҐ#@IW ` @2 .`Y   @Uw!@V7"@& &  @ &   ` @2  ` 2 % `0 ! Ґ!8@I  #`   @e     ?& Ē` ?&  `  R N`L `  ` 2 Ґ!8@I Ͱ! &  &`  ,!4  @~ ͐! @.~`& &  &`@T!@V7"@  @] Ͱa & "a& 㿐@Ia8#@I  ` ` J /` $ L` ?$8 @+%?@ϒ ` #  < @ 2?`I ?    "&㿈2&@  / Ɣ XV M"@P@]  '!0 `'' '耦`:@ : @\@$" @-@\ /, "@@-ے@[z N@ ɲ`Dz  㿘  '%@!$$ $$@8#Ґ $cҐ (@3o  @@8$c$$$$%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %s ?    `  J f  ' ' ' `'''J`e!`'"!@S @TP   @OS@ `V"<*` .T.d...\.I G" J Q B&  @?@* <  30.."  @͒ `'L -  L2 #     @ x   Ȗ!@N" @ ?J [  " `@ Ԕ?@*C! !Ҁ2z?`  Ѐ``    @d#  @ _?!0 *R@   @  !0` *2@ "@Z@ =@   `  Ȗ!@N! @0#  @ {`+?@Z'?`@Z` ` ^#4@   @ 0@ O  @6Ȱ here document missingherein: yylexerror writing %s: %s㿐 ` @ 5a?v  '@5 0' r?@*ؐ !0 @e  ! @7@*"![?!0 @ `"! @" ! @ Ta@6'!te !0@ =`!0@$@"@`'  ` @)Y   # !` @"@ @: @6?@Y' # !` @u!@ '@*0 @)/ ?4P4H4@REPLY-rreadPS3㿘  # ,  2 #` @R`@@S)J 2@>@Q X@S@ 0 PD ђ`,  @Q`@@S J@ ײ @ 47* ?7"%*d) %s㿘.` x @:`㿈  @ZL@&      @P 4 '''Ґ Ȓ@2P 㿐  `;`?J "J`? (  J   : * *J *҄`   ѐ"*`  @9`?   $ 㿘`   "`17 "耢   8㿘ҁdbteste_error: %s (offset %d)㿘` &@  ++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():x"''ܐؒ@&@x'D'L'''' @('!0 @c  􀢠 *@"@(  L 1 7@"@(U@m (2ܐ '@E""@ @M`(  @C D"@R 0@Qq @QD@( end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %s㿐`L .` <=P=d=x==  ' &"  *  ( )"    @Q  # //* @*` X@ c cؐ c  `  `8 ``@Q@' missing )zero divisormissing :㿘 @Y ߀ #@ @! : 6& " `?.& 2-  (& @ϒ  `$ c @p @    @c  M  `T@ @T0L  D X ,*  9@=@' @     t@耢    $  ؐ * B,BDD0A0ADAXAlA|AAB\BlB|AAAB AABBA0ADAXAlA|B\BlB|CpD0 @L  @N/  @=   @  "@  *@  :@  @&    @$    @4    @6     ~`?   x@   t @  p@  l@ 2  % Ғ@m  @ @ `U  "  % @S  2     8 ?3%  @   %   ?%   % &@5  % ~  ?% "  $ @"@P@P2&   đ,missing ]㿘 M"M `  2 `&  (Ғ! `* @ 3  `[ M `* @ 2 `[2  @U 2 ” "  @& @@ "!!0%@'Y@M& !0M`T & 4`_"? `* @ 2M`#2?M`_ ? !!0%@'7@~&  }" "  "  @P !0 {`" '&   X @* :  @2   @ ,  L`2&  )& & 㿘@@K` ` & "@O @O6"& 㿘N 2@@2  .`*X $  .`*X 㿘!!0 m`""" " !0`" * 㿘N  @" @b"@Op 2 "$   @ @N&W  *@&$ e:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %s( #7Ҵ((@+(Ѐ C8* LLLLLLLLLLJJJJJS(JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJLJLtJJJJL|JLJJJLL4aH@  `@T 0@%@aP `@4}!X@!`  (`* Q @ @2 2"@!x~ `J@ `@d =  !0@%U`$ @ ,@   2  @`!`U  @ @G  F@}A` `@@!5 2 22  @*!`  `! @ @    @ !@ 2   @ @  @`@   `?`<!!Ѐ *'53/$a":@3l" @   ؔ$@3`a@3Y" ?ހ@/  !!0@ߐ !0@$@"@` # !` @5!@  ! @3(!" ?@/V?  # !@"@vk J \  "0@K{ @Li` %Ҁ "8@! $S`   @.  2 ` @P"PE @J   !' $'' '@1"@  " $" @$!& $@.,@+$@ !` @"p@@. 㿘@  )!)' @  @, L " @@  ! "@ǔ @w 2,`!!@!$!substitution failed㿈`!0@#`0S@R@R  '!0 ``'' '@   $@"  @#@Q@Q@  @Ru "@@#|@Q$l%s: not in history%s: invalid range㿐@&B -􀢠 ! a"* !*@!`,@S0!`!@.%" !L ?   !1! " : ?@w '!@ !* @no history (yet)㿘!!@  2Ҁ@ @# !?!㿘!!@@# 㿘!!! #a%7  "`!a?`$!$́́ " 8  * @  㿘!`!?"@:` @Q Ұ. @@ ! 'ҡ,`ᘀ@ @@ " ! !@@Ȓ !!&@> @@ᘰ?㿘 '%#a"@ : a . @R?"@ a. $a$,  $㿘! !! " @x  ! "`$!@p!㿘!!  Ӑ "`"ϒ`$!Ґ?"a㿘!#a% * @ @`a @Q*a* ?@@!ߒ`@P$@ J "*"!㿘!@P@Pא J? "!Ғ@`!!`"@ ,@`@O,@HISTFILEr㻐J L M͒ "!)%!@H (@I6 J@  :"!@!`"a@T`8 /    $@Җ,@@@u   $ ! `# $ @ڤ`?@ w%s%c㿘a  ."a!!`" :  *`" ! @a a'  @)N  (@ e㿘'H'L'P'T'X"#Ґ "aN "@ !Ҡ Ȑ@0H @.@,` @X 㿘'L'P'T'X@q!Ҡ Ȑ@/L @.@,J%s: 㿘'H'L'P'T'X"#Ґ "aN @P  $!Ґ @/cH!Ҡ Ȑ@/ԔH @.@, !$@ J Y a" $@ internal error: 㿘'L'P'T'X@ !Ҡ Ȑ@/T`8@/L @.@+ @ %s[%d]: 㿘 ! "  !,@ː  a, JcH- @/$b 1!       @/ !" 㿘'H'L'P'T'X!Ā  !Ҡ Ȑ@/QH@+shl_stdout not valid㿘'H'L'P'T#Ȁ 'X aҐ @/4H8@F   <   ` 㿘  !Ҡ @*  @*  0 @*?͐ "aātoo many files open in shell㿘@   # ː"㿘  @R  ` #  ?"@M鲐㿘 `@+  Ȁ`Ŕ @Mcan't create pipe - try again㿘@yY 6  &  & 㿘@M@M bad file descriptorfd not open for readingfd not open for writingillegal file descriptor name㿘M"@  ",NN  2(N*`: ?А @ڔ `+( (  %` `  2  Ѐ p N  @K &?҆ ?  "   㿘! `  @@MH ?$ 㿘Ҡ`   `` @M6?$ 㿘Ҡ   @M'?$ no coprocess  `"@?㿘  Ґ`  ` 1   @L?&   &@L?$ Ұ   @L?& /tmp%s/sh%05u.%03x㿘!T` @M<h, & & -+%) a $@-`.@!  @(  & # " " !&& i`iPi(argument must be %job or process idambiguousno such job㿘͐ P"a"aP aP@M "aL8!`@a ! .8`h#@```@{ #` 8#@Ғ`@>H  @HX `(8#@b``` @4# b `Ԑ  ?@ $`"` A``@qE  ;` *# `a ` $` 8#@Ғ`@>  ! !8#@#@*a   # #@a!@"8 ? @H !@"`J  ! ` 7$` @ @G You have %s%s%s jobs stopped and running㿘!̖ @ &Ҙ D! ` 2K ` "K "@K  2@ 2 @` 2@` "@`2`"""""""r   jobs㿐  ҒaL@G~  @e ` @Gn *` #B !̀``    !# !  @ @2` ?   "$  2 !̀  # "@;c 2  @G$  notify㿐 ҒaL@G!̀ Ҥ D#L "    @ @` ? 8 "$  2L !̀ % "@`2 @#z Ȑ @F 㿐 ҒaL@Fڔ!Ԁ` ` "` @FΔ !؁asyncj_async: job not startedj_async: bad nzombie (%d)zombie㿘!Ԁ`"  ` !!2  @b  ͐ .b0D!! ,  ":"!#͠  a̖ !Ԁ "!" " @6   ! !!܀  !c &!@qc8!!䀢@á㿘  ( & @ 2@耢 & ,"!@E~ j_waitj: tcsetpgrp(%d, %d) failed: %s㿘``$`$J P "` 2!@p!P#  " ?$@4P $`" @4" 2^ 怎`•  `$ $J P 6! 38 /8  188@ #@ $`($18#@#@a 6  # #@!a@à!    84#@ @;$8#@`&), 2 2$  @;`,  ?R$Ғ` 8#@ ` @;  2, ;$,J`P`  `   7# *@` `@3O `$"!x "!J P    !Ҡ @[@"  J P `@pp!̠  # !͔   2  2R"耣 2 @Rw?@  E @Rn!̀  ( "    2  2 (  ?'' $Ԓ"@  # $ " @# ؚ ܀`?''$  `"  $ @ ?"# check_job: job started (flags 0x%x)checkjob㿘 2 ( ob@0 @ "  ,`  4@`2` ,&  ``"  &  : &   &  ? 8 #Ҡ` 2 0 $  0`"  @2   ? $ `  @& Ҡ DL 9`8 2L @ L  -   '!0  `"R``2 2 !!@  !@\ @!!    @saJ P  ` !Ԁ` a& ?a&  "a@Tbh%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%sH /`  ! , @#0   ?` & !!(!̀2 +2 ( -/ ( р /7    `0?# `0:!06?7  ,: `"// :  !8!8 '"/ @@#@`  2 ` 7`2     2  /  *  @d`` ( aP @#`a`@#z`` @#rah`2O $` !xp@#_    `!x@#I   ; 7 7"!7"! *``   #\#\@#"2  @#  "  27  7@#c㿘 !* '*@劐à  , "  2 ,!̀ `  "  2 `:  %` &@L`?"ԓ*` L!!̀ X` T`0V@à K  L 2 B`!̢ 9`  ( " @ " ``2.&@-    2 (`@Ba̢   (@` 2`` 2 (`` &@ 㿘a "a d` ̀`"& ` `@`2``"& 㿘a "a @`remove_job: job not found (%s)㿘!̀` !̀@" `@@ lb00*" ("   "@" !  a aܐ?"a!&Ѐ "!"aԀ""aԁ̀ ̀`"`0" ̀  2"2 ""㿘 (   "@@  2 %T㿘R  2' 2ǒ `  ".@A4@@Ɣ&@`. `.@4Pno closing quote ?'x'|x'p't @'h!0 H`'l'dh '`"b̀""M   , E%  ,8  #Ҡ aJ@  \" `"@  a " # #b!͐ "baJ@  \" `"@   ab?"b@ !`  ?"` J Y "%%-/Ͳ 5͸  J@  \ `"@  Ѐ``  ` * Ҙ! `?$`@` #-` (D0P䀦 [: *`7 *,d@=( "k,@\  ,,\`?$`@, , L !0\` $@+ \" "" " 8<% @ + ? ! 'J` `\  "@ % ( ,<,@ '"   \ "+ \076 \J@  \ `"@  I ,, & tp@ 6%5  , tp@ (  \  ` $"5,%t,J@  \ `"@ $  \ "` ? `` ,?$`@ ,J@  \ `"@ (: {J@  \ `"@ (t 2 p@ % % d$%  @? t p@ %% % ,P  ,,`@CJ@   \ `"@@ : #,,J@   \ `"@) # %@ t2E p@a? @ t28 p@T2 * Ҙ! 2 X ,,`?$`@D,J@   \ `"@ * Ҙ! `, , X!, `?$`@ , X,,, ,,, $,@  p@ %,% J Y p "% @ 2@@ ``֔~ ' p?2p@Ғ ,?&q, " \p?2p@y  `@ *` 8H8l ("  ) " ' +  \"&% %  !%  ?%  % %   ?%  " \ % " %    '2 % ?&  2,$p ( )  % 2, ?  % J` `\  "@ )p?2p@G,9@d  `@?$ , (,% % % } *p?2p@$ , } |p?2p@ ,̀ (0π ` \,2,J@  \ `"@ $", \ " 0  ` ,  2,  \, ) (  ?f% J` `\  "@o )"] 0NP '  L%  \ 'J@  \ `"@R  I, "t 2%p@%  , &23, %E  " \ ,Q 2$,J@  \ `"@ $", \ " ` , \,,,K ) | ,?pp@G; ( ,5 * , , tp@# %!`?$`@` @! " <d >` L@ | `!*` t!0 ` L`?А >`?$!J` `\ "  "@ <+ & >( &  >  $ 26$!J` `\ "  "@b - $ > <  $$   > $ | @$@$$ dwl"!t!2l,`2i,dkl )"ݰ ) ; & ( 4080 |!J` `\ "  "@  | ; | &!,!!!( &&!@? J \ !J` `\ "  "@ (!@0{dlN$!$!t (q!@Ӣ <`@@ !tJ@ ` @,@`@ ` Ӡ}@;$ 2,?L? P? N!@&Ґ!@&  ` !  } !0!t`1` -Ӑ 0Ӓ`<@& &!@ "!!8 " !! $@G ` !""" "8!0$!!t`!?!㿘(` Ӣ @)`(  Ӑ "`(cannot create temporary file %s - %s here document `%s' unclosed error saving here document `%s': %s 㿐'D Ò !!0'` 햐 " "펐!0@""@ D#`'  ! #  @!(@@ ސ !0 @E   D@ @ @ o` %b "b1'D` J` `\"  #@ `  L  L L J@~ @2$ J` `\"  #@ @KP  @ `?"`* "  @ D`?"`* "@( ! $@@!p@@ R@sD` b?"b㿘'H'L'Pa'T ?  'X  8`? " a!7""@Ґ Ȓ@gH:㿘 <$ 7"$$ $ $ $ $ $ 8?  $ $!$ 0$ 4  0$ , $ ( ( @:Q 㿘aJ  $"7"7#7" Ҧ   s$* LL0$z @z` $$  $  V$   2$$$ M$ $  I$  "   8 $a ` M$  J@  @ܒ ?M"@ ` "  8 8 $a 8$  8 $a ` "   , , $ $ a`$ $ 8"$aa$  @!0 ` 8$a`2 $ $$  " @֒@J  v$㿘J L  ,  `? " ( @  (<$ (@ ,&` & !H7 "c @aԐ `Ғ DJ`  J` J`  `$ & ,D!D@ ?  & ?#' ( @j"@  `$  ` `"@''  ("  J "   ,$ ("  (@ +Ӡ? @i Ҁ` "!!H 7"# @an  ,& & @$ ,    23&@ /&-#  J   ! " JJ  *` *`J # 2  ,   &  @  PS1%dPS2㿐Ҁ "# R0V@0 @1?@8'*   B@XK`"  J !J ! 'K @z' `" ` @7K  @'!!0 `@('!0 @CJ  # "!Dr @ Y"aD@(@/̐ @0"aD㿘!Ҡ @@missing ] 㿐 )'"\Ҥ!!J  \  "@`e.`@tؑ, :  # T  *  N  K  H F  *  A`, :  [; @O 2.!@?&@  . L  !0`!J  \   "@  *  ` `2@. , @[: 0 ?&@͒.w 㿈  '!0 (`h'' ')'!J  \  "@V?$@,,`:  [  ]",`:   !, $&`?㿘b ?"b!7@"!Ҁ`!@` "@`$ * *  "!" " 8$!!㿘"  !@J  :"@ 2"! "J@ `*"&!J@ `" \!J "`  ͐ "b㿘!0!`" &!&  㿘`~&`& a0ޒ`!tMAILCHECKMAILPATHMAIL0@.;#@0F L@ `"" >"@.%# "   "@.#   ͠" $%<#   "$ @ 2$  2$ Ȁ    @$  2 8͠"   " r`  "k`@\`$  $ @͒  <  $ ""㿘#@>b$b@;` 4Ҧ D@; : , @3 % N? \ @61?  @7#  L  @ ? . @ "$㿘 #Ӡ  `` 8 `$$ $ @\ 2 $ <  2$ $ _%s you have mail in $_㿘#x@- @.  `## Ғ n@1 IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }KSH_VERSION@80( @0@@ʰʠʐx`H8 ɸɰɨɠɘɐɈɀxph`XPH@80(whovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUnewgrp=exec newgrplogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliasTMOUT=0SECONDS=0RANDOMMAILCHECK=600OPTIND=1PPID-i-rHOMEPATHSHELL-xtypesetpdksh/usr/bin:/bin:/usr/X11R6/bin:/usr/local/bin/sh-shPWD.$ # PS1-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENV@(H00@@ !7#  @3"a, @4 D7+@*"!0t@+@'@!NLҐ!8@S Ӑ 0@N Ґ!@I @Ґ#@B @^#@  X    X"D@      3%#P$4  @\   ` @[$4@+#(@-J4Ғ`D *`!!,@40*`c!,?@t !,@na8 !,@hc  Ґ *`\ "   #`  @.   2`@3"a"`     @.   @+Z#@,L /@OP #@I  P@2 T@ @ ֐#cJ@ @ s cJ@ 7"@,ϐ@]@+!#@-@+"@ @) ` @) @-@+ 0@,bp <` <Ő   @k"a( ###"@@*# !( @,@j # 2#@,|@]J Da(   @]s@]", ,Ҡ D ,  @ 6L @3x  !0 `,`@`$ $#,`@`U"!,R`@(L  $!0 ˒`,``  @ 0@ $ $ Ґ "a # !@Խ#Д)"!, D ,!0 `#$ѐ   @ $ @(  @(    ,",   $ @ "@$ @*J  <  2@  Ҡ DL ,  i@ L   g ғ,`0@ &" a,"_#L L , #, J  L   ⢒cҠ DL    @W L    Û   @K J Z "  0@) H@+É J@    @4 @@ 2  @)ڐ#0@*@ ` `ӎ LҐ *`[Ґ *`IҒ DJ`  ᡐ@b*`@  include: %d㿀'D'H'L'P'  @  0 '?L  !0  ` ''''! '@!0 @<  >L􀢠"a@  @쀢  !0"`"`?`#(*` H|H|Tׄׄ|C !P ! 9 @2 a/L !0`" `H" 3a0 s`'Da0" @`"`@/ ` @ "a@|쀢 a0"`"` 㿘!0 J`"" @ shell: %dUse `exit' to leave ksh 㿈'D'HDJ L  @ ' 'H@ '@/ 쀢 "" !0 @?D7Db"/" !*   ٠ ٠٠쀢  27#J K D   D  "`@@@ `ᇔҠ D 3# @" D 8 L  D`  D` ?"` 쀢  >DT D@^ AV -  L  ?' ᚐ D"  `    D&`"`H &@*   L  D ǒ "a  V  쀢 ` 2&`@@z!㿘 7J I    7#, 7 # J I   !8# @ !!Ҥ D#7# !0R .* 4$$$ݬ$$!0@;R L X@# a?   .  @[  @/U@0a@!0㿘#a0 D`44  a0`$a0$ $ $ $ @㿘!0` 2 @0`!`@"` @&`  ` , R@`" R  $` ` R   @ s@:0 "0`㿘!0`!0` "` ` , R@  @/ $` ``2` !0" 㿘!0 @ @  @#㿘!!0@ @!0" @n 㿘  ! !@2@)  2 㿘@ / 2 @ڬ r@ a8@ alloc: %s㿘 `h7x"`Ҕ 0Ḅ0J Ҕ(  2J 0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|㿘 aҒbz@z 2@` AҒb:@Z 2@`!(Җྒ 2!8 !H !P !X !` @!h!0123456789ABCDEF㿘!͠"3,"`?@ @ @%., 2?㿘   @/  @㿘` `*@1 㿘   *`@ &  -` &  & &@aceiklXmCnxfph`bXuH@0p rshvxxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacsbgnicebraceexpandallexport㿘 #.  " @z   ". ?%-*s %sonoff㿘.`` DJ x `""@ ВCurrent option settings set -o %sx "(޷"'ؤ #ؑ,  "  @-$`$``؀ 'ؠ  ", Ґ ؔ@ 0ޒ# Ұ D##N "  , `" ށc  "(N7z#pД Қ D#K   K@ "*" *!0`㿘Ґ DJ  *`6 5 1     &Ґ D* * *  * ` @WT!@V$!(@B!(@W~@V@Wz@V   * E    ! @* fo:A:o;s%s: bad optionparse_args: `%c'%s: is not an identifierx K"47"4 aؒa `+"4 `, @-$,  aa `+"Z `"Z,  `,  `,  `, @-, #J    ,"`*``",*`J@ -  D @ / ",` J  -2,`  ,` "4"Z@ Ҵ D#@?\耤 A2   o ?P`0- `0*?  ߐx `N֐`,`R Ȑh!  s  `#J`2`R`@2``"``# aʔi? !ؑ*  J`-`+J  `- Ғ DJ` *`!*`ؐ '؀ 2&耊 2  ؑ*  "& &M @(X J "D?0"ؑ,` 2`,*`@$@ ؒ*@*Ӕ ؐ 'ؑ*  ؁K- +Ҙ  *   ** ( : *@I- "@K `  %s: bad number㿘ǒ #ߒX `+ @+@+@@$ $ @!0 e`@ `?@l*+?@! 㿘 W P  * ? [G  ]`2C      !"   26   ]"1 0  `"+ 22 %  @T  `  | )`"  2 `  2 * @`?㿘 0   @퀦   ?" ` [ * nπ # 4 Ȑb`"̰ @̐ €Ű K? B   @ "   ? 2 @ % "  2 "  {  x @Ӑ@̔ "j   ?^ 2] @ K "  B ɠ @K@ B?? @   2 @ 2       @* `?    !`?2        " (2 `[: 8  - 2  ]      2  " 4 @4   2 ]2   㿘& #   ) |?? |2  2 `"  `@ԧ ` 2  * 㿘.` @㿘&@: 2 @:` [* ƀ ?$$$@ƀ `@$@$2 `$ @$$@$$̤ݦ2$:`&@: @``?$$$㿘@~ "" " " " * %s%s-%c: unknown option: %s%s-`%c' requires argument㿘`  @* ?J `> @*    `-&`K  - K   &`@?``&@ &` *`: `-" K ` `+2&`K   &`?@`-` &@ &`  &``. : ?`&`: ; , #@Ӷ 2J N :2` .``L&` "h"` 23`:`;;`,@`+`?J M  `;&``F&@2NB&` :2` .``&`M : ""` "" . j; ` 7{"1 ? `#@`* ? 2%. @`+`?K  Ґ!*`  &`&`   !*` `&`&@&`. > %s'\''㿘 L  Җ!*!2L L  L  ֐"80/L ' "A%Ұ `'`ǐ$ 2 H  `L@   &  * &  L  `ا"H%-*s%*s㿘'P!0 `7@ " @?@` $@7"@v $  ,75/7  @6 P@ @K 6 @B @ @t&ݠ !0}`㿘`' @ ! L "  @& "$@ @(S* ,$㿘 @'M6@&~.㿘 % @&%    # @  $$  㿘 @쑔  ?  @쇔 ?  㿘  !0$$Ò`@w `  @& 0>!0`㿘  @7"N@ / .'r 2N` .``*`:  / 2    L  J@ :" "@`J@  :J@"@  `&  L /"" "N "@&"@@%˔@J? / /,  $'" @%J? / /,  @&k "@r@% "&JW/`? 2   . /J/"J .@2A*@*@`=*@+@J"/".!@J/@ @ @"*@*@`*@`*@`  /"Δ@ 8J@Ȕ"J*@`JJ/ *@J`㿘    7"@%| @  "|!#,$##@% 7"!0ϒ`㿈@%ΐ 'a0 `''@'@  @2*@ /*@`*@`"@㻘?&bN /"N Z@Њ / $@@%``N ."H`2 N . N . (:?N /4 8?1 /.&  `" p@$. @$8# 6 , #  O /  " 2N㿘@   4` @ꖔ @$I ` 2@  shf_fdopen: missing read/write㿘`"`` @i   "`  `0`0```  5bȀ   !0`&  d & !00` 0& b& & & & !0`  & ,& & & & && $`& (shf_reopen: missing read/writeshf_reopen: bad shf/buf/bsize㿘`"`` @   "`  `0`0```  ϒ`@       (6&  ``& & & &  `& & & & & $` &&8shf_sopen: flags 0x%x㿘   ÒaԖ  !0 0`!0   & ,B B ?`$ @?& & & & & & @& & && $& (㿘  & @h@#2 &?"$ ,  ,㿘  @K@# &?& &  ?& & 㿘   ` &  @Ē & * & " ,Ȑ㿘  &@"$ ,  ,shf_flush: no fd㿘! 2 0? 6 `Hh? $  "# @ *@ $  :  @#&  $ $ @ @  shf_emptybuf: no fd㿘@!  ` 6@ ӰaH@h ?`$v"# @ `p @*@$@@a%`K d@$@2`?```,*````"@  $``$``"  `$`@  $`*`$`@ $` *`>$`@7``"@ '' ` @! 6 `2$`$@  $`$@$``(  $@ @#`$`?$ 4` `" `$`` @$`*@`$`$`@ $@shf_fillbuf: no fd㿘!2J  6 c@h  $ "# @ R ?1 -?1   $$   l   $ # 2  "   6 $ ? # h$ $ $$  $ 㿘  6  "c U?h?$ N"# @  ?2C?@+2' 6  " : `42 8  : 2 (   "@$ $$ $ + $@!ٖ    # ?$$($shf_read: flags %xshf_read: bsize %d㿘 ebp` Œb^`"@ 2  +?@ @ 4@!-&@` @&"& @$@( ?shf_getse: flags %x㿘 #c`4  2?"+  2,# ! @ " $@ 4@ &@` @&"& `2 ,shf_getchar: flags %x㿘2  ْ` 2  ? ? 2 0 ?$ @`$ shf_ungetc: flags %x㿘@2@ ѴaH@(2;??"8?``@2@` 2/?@@ ?"%?``@2@`@&`@a` ??*@`&@`  &`*@`&@&`*`  &` shf_putchar: flags %xshf_putchar: no fd㿐@? ab?"??@ "*`` / Rb@( ?`$+"# ! ` @Ɣ  # 6` # `2&`$@ "` &`$@?(&@ 2 `p ?2`?`?&`*@`&`㿘 " ?@ ǐ@shf_write: flags %xshf_write: nbytes %d㿘 ``6 ǒ`( 4@є$@@&"&`;! ?25?@ %`@&@ &@%  @I 6 `2&$  &$&?(&$ 4 ` @&"@&㿘'L'P'T'X@NLshf_snprintf: buf %lx, bsize %dh'P'T 'X`4  ǒaЀ ٖ@*P<h'H'L'P'T'X  BĖ@H(0123456789ABCDEF0123456789abcdef(null %s)P @a@,`W`Ƕ#:``%   2  ͒C?& *@`& <N@`Җ!* :  Ln* !0!!! !!!!!!!X!(!!x!L!!8!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!A?=":@9N@5 06/N@ +) ' *  &,: @?Б, `Ҕ!,-* :` @?Б, ` "N@ f` & ,  ۤ ۑ* : `SȐ"*` &&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&%#&&&&#&&&&&##&&%&#&&# Ϥ* : `iɐ (*` $|%%%%$|%%%%%% %D%%%%$%%%D   @y  0,@@ 2,:  u8 -3 +., )  04  ,@ 0'"ǒ" 4  @ ,@  X x,@ 0,@'? $ @`Ǣ#@F   // @@ @c_%@ @"@? L@ + -  0 `)#L@3 0 ` 0 ` &  @* & `?  @ x 0 `*:  ` &  @* & `?@  0` %,  2 < Ȓ`?& *@`& `,    `? `L@ ` &  @* & ` ?`$@,  2 < ?& *@`& `4 @,``(?㿘!! $" @`?" "b $"  "b"` ` !" ` @ $"`@? 㿘 @+.b""b "b |@   @   @h  @b $ b ""b "b㿘ɐ #%# b$ۭ $b!!  !@   @1  "b㿘 +)b`"%bۂ %"  `@! `瀦 0`) &! ; &   @ 2   @ @ $͐ "btoo many <<'s 㿘b 2 ͐ "b3̀!"b"!& #at"" ! `` `?@, at& J <   & (Ӑ (@*"@ 8`"(& 㿘b " "b0 ̀"b@9 㿐@T  @ @r too many redirections let%s: bad identifier forselectP !!0 ~`!0 @~`'' @'!0 @~`''ؐ @'b ""bڢ ,"baaa xЀaa `{ a`(  . sa  03$! aaa  " Ѐa ͐ "b!!0֒`!0Ғ`!0Β` !͐ $"@ 3Ҵ D#)T耠 ` " :  @ $b 2b %b:&b!"! (a!0b`!,% ֦%bؐ" :  " :  2 @ < "4" :  N @at  !0$< , ~'ܡ, 'ؐ'at"@`' !0$< , ~', ''at"@`'!0>`" : ؐ" :   ؐ" :  "%b@  ) ޒ ""  ( )٤ { }Ԥ@W "" a0$< , ~M', ''#a0!@M`"@`'!  a0$< , ~/', ''at" '@ "" ''ѐ",'Ґ 'Ґ!|'Ґ!'e!" @!F @!t@.   Ӏa ""˒" ( a0 <듒`$А@͒@J@$0$@Ēa   @ @$ $@Ȑ ! at! @$@$@!@ j @$$! @$!  @5  @~     @s  !ג !t @!  ,߻!% ,!0~+` $ %a0,}m$ T  =! a0$< , }Z', ''"@`'"@#a0 }I$ a0$< , }='ܡ, 'ؐ'"@`'ܒ"@a0 }- $!0}ے`!0}ג`㿘b ""bY "b! {! }@  H 㿘!B @   & @ @& 㿘b ""b' ,"b!!    @b @̐  & & "b 㿘b ""b "ba`{!  }@>  'ͨ %─  $ $ @ 2$ & Ӓ 㿈!0 @{`'' @'@z `""׸ "b (͐ "b)'%#͐!  !0$< , |[', ''t" ' b$׌ $b |ސ!#ͤ $b*a0$< , |4', ''"@`'"@0 |#&  )d А b` & $bZ ̀"b0 "!N %s: invalid function name 㿘@ ZL Җ! *`! `= "J 2 @ސ & `6  {  ͐ "b!!0 2Q  ,& @Ɛ & !0 {9` "`!0 {3` `"@   *@   :*`  *  !0 @{" "`  "`!0` ?2`㿈!0 @{`'' @'b ""bː "b! ;>͐ ;"b#1'%b "$bֵ &"! 0$< , {c', ''t"@`'耢  ;@ߐ "@ :   !0 {` @  a0, {:',  ' '"@`'"@0 {)㿘@" " " APAHA@A8A0A( A  . .  A AAA@@@@{@}@@@@@@@@ newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenif㿘!Ґ!Ӓ`@: #`# T` "@!@" `"T@"  `unexpectedunmatchedsyntax error: unexpected EOF %S%R?%dsyntax error: `%s' %s 㿐 а!""" %#!#" "!`а""܅"t 0t Д8@ ` #R " 2R  // @А"HU⌔""  "   㿘!0 yt`22 " " " " " " 㿘"""" Ӑ "`("!"aliasexportreadonlytypeset㿘J Y *`:   a)   @̒`"  e r@’`  r t@͹`  t2 @Ͱ`   "  2   2 8  2  ||&&!()EEEEF]]<>㿘b  "b` @ AԶ "b" aJ <@ ``Ha`Da `A!t9b `7`(3`) (`a!t   @" "(!0 @ 9`d<  !t !tђb@`? /̀`,""`2 !0.`@ `@`*`$a0< , x"``, "@@"`@" "@㿘b 2 ͐ "b @"b"!% "" @`* `$a0< , x” "` `, "@ @"` !t"@`"17" 㿘` &͐ "b !".`" ?  "!t!J@  @`*(8J@  @*  * " *  *  㿘"" 2 2 @㿘 .`V wנ ,  $@6 .`@ В 6 5&  6/, `"& @ "`V  * @` @2V *  " ?6 2 xܐ ב, xՐ㿘T  $? * @ @N N@@2   @  2   2T *  2N  㿘T 2 T?* @ @N N@@2  @ے +@2T* @@ 2N T Tٓ*`@y w/ &&  & & & @?4$@"R`"`"      㿘 @ˎ`㿘 T`a0 * v`T`` "@  2`T` &"@: y, &Error handlerERRUser defined signal 2USR2User defined signal 1USR1Information requestINFOWindow size changeWINCHProfiling timer expiredPROFVirtual timer expiredVTALRMFile size limit exceededXFSZCPU time limit exceededXCPUI/O possibleIOStopped (tty output)TTOUStopped (tty input)TTINChild exitedCHLDContinuedCONTStoppedTSTPStopped (signal)STOPUrgent I/O conditionURGTerminatedTERMAlarm clockALRMBroken pipePIPEBad system callSYSMemory faultSEGVBus errorBUSKilledKILLFloating point exceptionFPEEMT trapEMTAbortABRTTrace trapTRAPIllegal instructionILLQuitQUITInterruptINTHangupHUPSignal 0EXIT㿘 ,!87#  2 *`"J@ 2" """?" "?"""#`#բa4""!7#  @ T #` t$ T! $ t@ 4$!""$ 4 @$" `@ !@  @ 㿘7c aԐa"aԒc|@ )㿘#7c @;C  $c "!0@;9SIG㿐 @!*` 淒 H E 4D * 17# ?7#  'Ԡ  "2 `@ .@ (% @  2 @` @ے @ ( @ɩ  2 @ɒ`  ˰  㿘. 7# @ ""# `@# "!""  2"#"!` @ "# 㿘! @?"@7   " @    7   "` "@H2@@`   timed out waiting for input㿘7c  "c  bM "c "# @"!""#7#  `   "   "   2 @ ` 㿘  &  " @Ґ"a *Ґ"a L " ! & ! >& !!$!  !u` &  & 㿘"#"!"#7#   $ ` "` @ " ` J "` @ `  㿘7#   `0"2` `@j  㿘 "u[`L`&  `! & N@ !4    "@& `2 !4 J L  π`&  &  & @( 㿘8      @   @    @  㿘 8  @ 㿈`<` ";     ͒b@ϔ耢  ``&  &     J L  @!"&  & !4  & '''@  setexecsig: unset signal %d(%s)㿘  2    ` ``  & ` `  0`2   & %S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %Tcan't open %s - %s%s㻘 ?* : `א"*` ^___` ` `d`a`abcpcpbdcd4dTd_d   #א`@   @   V#א`@  K C ` @Ӕ<   @ V    ט! @ @z @  #נ @a     @(V 2   @8  @w@   #א`@l  @cH` @]PX @R` `"'פ!x@Hp ` )  |@=  2 ``@2```ה !%#@    @!H` @ `" R@   @!H` a   @H` @VV` !!ז! @@۔` @Ք8X` @ʔ- @(  @  V  "ה"(  @  @0  ה8@ `S @"  @@``@  @ = @   1`  ".@ W   1 $H A   # @ הb@)  @LX@ 2@  &< <<- << >> >| > <> <&>&%s 㿘 ````` `4   @"`    0`>ِ#*` g4gggHgtgȐ,( %0!8@ @HP X `ٔh@`2   !"pה @㿘 `2    ^ $숒   @ 2   ^ $| ?y㿘 ڤ!N  , ki8iPiijXjdjpjjjkN˰ NN`   " ` $ \KN $C (@N *`: N  ) $0 (- (*N *`: N  ) )  + " ( " $N {  {N  pN  NN }   }N  ( | )wN㿘'P'T'X@P h'P'T'X   B蔖 @P`N`ڤ#`% Nŀ :* mnnnnnnnnnnnnnnnnnnmnnnnpm,mnnnnnnnnnnnnnnlmDnnnnnnnnnnnnnnlnmDlL h  *`: hL  ^NXN`d 2 `2 C `? -,L B  *`: BL  8N#1N! `;2(  ;,#  '`  !?  $N ?   NN N`H㿘  c nʒ66 T @X& &  &   $n ?& ` @: $@ `$@ 2&   $n ?& ` @ $@ `$@ " @ߒ& & & & 㿘@  "na@ ܔ ܔJ  (qq\q\ppppq q8qXqdqdJ J JJߐ J J` Jΐ J?@  2JÆh  Ȕ Bܢ!N  * @r rrr4r|qqrs4sLspsxY^N" N $ ( *`: N B ) $  ( ( *`: N  )# ) $N {  {N  N  NN }  }Nְ  (ӒN | )̒N㿘  & ?m @& m$@$`$ `$ ` $ ` "`  $ ` "$   - &㿘 7  " n  " n   n  " n   ny " @  ϒ ̒nj㿘   "n_n\  㿘@Ȓ㿘 @5/dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s㿘!8#@  @ ;?$#@!$#ݐ! @؀   $## !@! ` @ @    b01 @Y %8  $@ # !@"8 ے   !# @"` ˒@@?$@@n`@㿘!8#@ @?$#@㿘!!0 Ple`l@$` !0` 2 $` H$`` $`$`D$`H`g `c !0`$`L"`㿘!0``L`"`T`?,` `@!"?@ސ`@  @?@u?<` `("!X`,!X" `0" `4" `8" `<" `@" k!0mH`{ {{zzzz z z z zzzzzxzpTMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS㿘!͐#Ӓ`ɔ ޒ!@   @=`"`@`" %s: subscript out of range㿐&@@ @0L@ [,@Z ' &@@3a0پ’ a0l`a0$@ٱu #(&ސ#~a0l`bad substitution㿐'0ILa *` `} Y b$"b0&  & .  "L  *   ** * :`  * `?`{*`@@i0u s&"b߀`?*`ߐ! ~t~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~ F&  A& = =!:& `7&  =^&1& - =@_*0 `/  0`L "`J`@A`@& !&㿐'0 *` ` Ͱb$"b0&  @& `' $L @ `ܔ `L``b  &""& &  @`@& !&0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyz㿘!"@`b7U" O@@ ! Ͱ"@  & `" ?.?@ @Q. 2?`  #?.?@ ` .@ ?.@ 0 0? -.0@@%s: bad number㿐@|?2 !"ؒ֐setstr: %s=%s: assigning to self㿘"28 "&  @ @ @@  c( * j & ` ? &@@͒ @p ׭  &  &  !&@㿘"2& ͒""""" a0" `*"  !&@㿘! @ N" "R?""  &@J  @ 7" L@ :`Ҩ! - #/ ( % $4-? " *` M"@    ? ??ɠ?  6? @ ?L@ ̢`2 &@㿐2    j& `& & "!&@^%0*s%.*s%*s%.*s%-*.*s㿐@@0 ` "$``!0h`0@ U 2@ M"   "`8 `"@ #@ @ @@@ @!*` "# 7`"#\v" &@@Mb@  2`@@@ N@N@ 0"``W @@Ŕ @@N 0MG "@  "⬓*`@ `*J 2 0@N MI "@  "ഓ*`@ `*J 2 㿘    @J@G`` g&& @r =,  " @g&   i$ENVSHELL%s: restricted%s: is read only㿘@1 " L [ =@ @"  @ 6 Ҙ! *  ڒ`@ &  L = $0@˰  J [ @"b @bx @b h"h6` `%.@@@\$ …2""z!0h`@] [   @2 2   b ""      ?$"2b ?$ $b* $ p$ p@2$ "  W`"  h;   "" D 4& = b    `7  "Ȑ㿘 " h  @` `"&  ` g  g`2& `! @ a&!@㿘 "!*`   N*` ` N ` N [@V 2J1 (* J ` (2 `J [ J@ `(8[`]2J@2J@ 㿘ɒ J`? 㿘 @  J@ J` =`? 㿈!!0!f `''!'!0 NT E >  2: L   p " L@ ?"@ L  " Ɛ A& a0$< , fk', '' "@`'袄<L2T a0$< , fM', ''"@`'"@0 f<㿘@Ӛ㿘!# 2 㿘  ""  "0% 0  ~@&c "  >@l&? * ` & >&!\ !&8 ?` *`  0|$H,XTh! , f`u`$ , 0 L7"# ~k&ri  Ҕ 0p#aT f^`$aTL /b@  ]@м X<  R8`M$aT ~9&7ː" 9L$!7 /$# ,$#ˢ˞ ~&@ ~@c&͠$"c ! &" `& "!H 㿘 ?`@#d*` HH(4HHHHHHHH@1 , eϒ`!4ҿ`& ,a 0#0- 7 "c1!T e` &!T9 0c 0"!H㿘`@ @$@5$`      2       @``d? ! @`@ >$`$ `$ `$ $ $$  J@`][["J "  㿘@L [ a0"L㿘$`"#   @  @(#)PD KSH v5.2.13.7 99/01/15 AAA  Q AA A QB㿘d$@@, =#Ҡ#c̀  ` $c `$c@0 4#Ȁ`' @ @2 @ @  R D  @ `  #d c@Ԑ ?@* ~c~ ~ ~3?cd@"  @cd  . cd" ` /?㿘#Ȁ` !*` <hD L(!#- А "cȰ ^@c " ?@#Ȁ  ##d @ n"Ѐ@ i@ Ѐ  "<͐?π "c@?"c@А "c͐#*  "<@ Ѐ "c@ #d /" "    @ p Ұ?@ 6 #Ȁ n@ !#d"t"`@"` @ Y 0"  #d @  @7#d*@ "@  rM"    @*` * ?8"@<͒c*@ L"<͐?π "cD?"cDА "c<* `Jh"<"  04M"    D*` * ?"D!#@#D#D@ $#@<* `J:"<"  @a"cА "cȀ "#<͐#* `"<  @ #x  J#  @ "#Ȓc*@@ݐ#А "ccЀcЀ 2`#x`"#x͐#@K cd "@" "@"#@ V Ѐ2 `"#xcd  " @ H" >#x ͖#M"?   ` ? ?͖# Mb ?   " #x? #ͤ#@ cd? "@" #d"cx  x`'͐#* ` "xJ b #d  M* `#d"    -* `"  #d  ^* `#d"   @* " #d *@ " #d`  @ "`` Ȁ " "  R 0T  0Q#@@c "  ?7 0C: : 0>#`"#t @ @ 5 #@`""##c!@#@ "܀ 0# L#`s`c`Cc @ @@ r   @ n  "@ 㿘"#?А "c"c"cВ "#"#l"#t"#p@w"t@    .        㿘cЀcЀ 2@`# !#d#h @@3 0 ct ?"ct?" &  ?"  *@ #d` t ?"t`` `?"`"`   " @82`!#d "ct  @" #d` `" "` "`'!#d  8@  #d@ @ @" #d ""@" t"@"@"t"t#d" #l  "#p `!D.  hXq 8l "cdt "l#p "tА a*cА "cJ# s c C #?@J@  F #d@  @ J c !ΐ @ K6 !#d   ,?ΐ#lt#* `c "t#d@ @ @" #d`  "` #d*@ c` "#d`` "` 8"#d ^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --㿘  @" ` @" @b  @ @v #d @΀`2#dd"  2@#̀ 2@#cd!#h`"@@ "##hcd# #  @# @?* : `y.! *` Tl@tx(@tT,ppPx|XXl@t,TxXD@  #8ch!` 0,`!N``? #̀ @ޒ  J  JN`@ ?@ c̠ c``""@  Ӧ`^~ @`,@Р #̀` #̐@@_,@ ,@ В#"`"#M"`И "###d `"# "<"#Р "#Đ @"#d "#+" c@8cd @"В "#"###N@N``c  c@#d; " ` }`@   &?N@ cN` w W#dMb      Δ   2#d     N` %  N@ c@@N@ y@#d" N@ cВ "#"#l#А "c##d `"# "#!Аc|#|@H !ΰ? c|А "cĠ %##"#|c|@1  ?   #d` ?"` n?0}#d "c "!#d`@'` #d`@?` #d` S?Q"` #   ! c""@!#İ?@ $#6"#В "#"##Р "#Đc@5"cd""`!##c@@ #$cĐ$#!##c@"@ #$cĐ"$##d |А "c#"#N` `@ *@А "cА "c##d [Р "##"#  4"@  @"##d` B #Ā `* ! #d "` ##!"@  " #d   ## ٱ#d@ $  !#d А "c#"#  4"@  @D#d @\t!#d А "c#Ѐ"# "@+ #d @C"@#d`"W"`h#d"#dP"h#cĀ !@"# W?$c#A"#c  ?" "#xN@8"#`8#`  ?N@`? N`?%#c@.㌠ 6 $Ā(?@@ 0"$c"#? &? OK  M"@  2 ` 2K K  K 2 Mb?-` @  2Kb*:  "K K    * K@  2 ` 2K K  K  K 9 Р L M" @  2  `  "    K 2 # #d"`` "##`K  M "  K   @  ` 7" @# 2 ?@  ?  #d` ?"` ["ccd ՘ SР 'MІ %G#I#d      c#  c# `*  * #d` `? "`#d#!#dw *#d(" #d@Y J cJ d "? @@ #  #d` @" 㿘 @?* : `t"4*` @@@@@@@@@@@@@@@@@@@@@@@@@@,L@@@@@@@@@@@@@@@@@@@@@@@@@8@@@@@@@@@@@@@@@@@l@@@@@@¤@@@@@h@@@@@@@@@@@@@4@@@@#d   ?@ݐ #d  ?@  #d``   ?@  #d``   ?@ϐ #d &ְ 0N@8"#\N`"#8#\ ɀ f F8 8#\ aN@4  ,Ѐ`?# @ `2 0#d  #d    #d``   6?#d `  4 0 #d``   |?@ x #d``   n?@ j#d`  ?b`M"   Y  U #d  4 2I?0G#d  2A0?cd  6cd #d @gJ #d  #dcd %  ` d  d??,? @GJ@@ "? 耤``4 0?㿘 ?%#!#l` ct@`? ? ?#d` ?"`"# 㿘Д&@ "#|#d`#|@x@ ["  { ( ) 0"  } ]  0   0 ???㿘#cd !  @Ncd " , 㿘#d "``"` @<`㿘 !Ӡ X X$` $`@  $`  $`$@㿘 `@;` ` & `& @@&㿘 !Ӡ ZZ㿐Β#P"#d"`"`8H"h" " "` " "`"H##P!!Dtْ###$c!DВ"@7#? "$cА""c"##"#1#`7#?@" #Ӣ`7#!В#Y&#$## #Y$  !##c@ؠ# c@Ԓ "#А *cѐ "`" 7#cА" ?"㿘`2 #d 6)? 4" !!#d  &?@@ @|# #d` "` !#d  @p#d` "`㿘!#d " @@^@#d &@"@ " d ?" ?  2?,?H 򀢠" ?d W҂ M"O(@  6* (" 0 @ 2(@2Ҕ  2  (   "  ΐ  @ d d LMҚ??D? >  ? 4 0 (@ ?,& (@"  ?, (@2 Ғ 2  ? (@"  ?d JMҖB  6  @ "  & @ & @("  6? @("? 2?  6 ?( ?d d 6Mb??0 2 b 6   @   b  ΐ  @ d ј?d 0Mb)?    ?< &   2 cdb?,  `"?  ؖd 2M??,  6  @ "  & @ ΐ 6 ? " ?d ՘?grabhist: bad history array㿘`#@40?@% ("#`  `?1#d@[#d$  " #d`` @F"##d " 㿘`"E?#?@"=?"`N ^    `  ѐ @j !?Ͱ 0?aY3cd@ cd$  " cd`` @cd" 㿘#c* @c@ q; q9 @ А *c#"#؁㿘  " @ "@4Д#c $ * *` @wc$$c㿘d @    #d  @S #d ` #耢6  㿘 cd /Ь $@2  : d  @'d ` $@2  : )Π #d  @#$@2  : #d#d"㿘 `@`@ 㿘 dZ@ Є ҆ D#d @Q@#dcܦ#d   ,@ -` 2,@)#dH   M,@ ` -,@`  耤#d  2 ,@ ^,@ `@,@` #d @ 耦cܐ?耤`#d @#ܦc耤6   ,@c `  ,@#д#%L@N@@ ؀@<pL@ؐ $آ`` #d    +#d  <   >%L@c#ܒ @ oc, "c#؀@㿘!#؀ * "@oɐ @ #ܐ`@+$#N@o`#ؒ @$#!Ѐ$#زo cؒ?@&c$##܀" @N@o`#ؒ @$#"#؁㿀 !#8cd 2 #H!#H@ #d$#H^$cd#H 1$#H#d  #\#`s @^?0F)?#d$#H8 "d#d "`'7. @@V   M ۀ#H  "@ #d`"`В "#"#"#c "c㿀  !8#d  #L @ $#d!#8cd 2#L!#L`#d$#L$cd #L `$#L`  #d  #\#`r `@Ӱ?0z:@@˰?ps 0i  .`s"  @@@@"`,`s @@ `@@0.`@@W  @r8 "cd`?!#d"cL#d #  `?8` "#d@J? /7"  rВ "#"#"#c 9"c㿀    #\#`q  or  @=?   Hb     M-㿘J b   n:#x   n  ^ @n㿘Ҁ !D##f 㿘@n n㿘#̀` # S` @ｔ 㿘@㿐@΢ !@  @;b@5 ?=@l @&*  @@b@@"@!M `."@  ,`@Q,`* @?в`@ @ .20'.@`}x!1M@`"@  2@@3@@䩐?Ф`@ 4@@`"'!M"@  `@@`"'`'􀤠@o @Q usage: sleep seconds 㿘M H@4b@A 㿘@ 㿘@if%s: destination pathname too long8@,'%#Ӡ @™? f i$$`$`$@= @&*  @@@䁐 "`. ?@6  <   $@@@@`@@?#(? @@Œc@~5@M? / /, ?= @ /@E 2L  2  L / ?:L0 /" ?:L @} ##@@l3  `@e@5 2 `?2@@overwrite %s? override %s%s%s/%s for %s? cannot resolve %s: %scannot rename a mount pointrename %s to %scan't remove %s%s  s@ m   M Ha@>1` *@  %@| 2! @@6 @b M HO` !!!#\ @` `.L`? "`@w   " ` `y%L`y ? $ @a  $` `y`Y2h @Z  ` #  @  !В@kiN @ @Ԁ  @kY!> "@k_8 @ <   @   @ " @ܒ "(@k7 0<  @(@%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set times㿈 @6"(&@! 6  "(@j@E @H  #  ?@F* ` #@@"`Ӏ "`@jА n #)+` @  `@ɔ`b("(@j@M !@j@@G @ l "# !@j 3 6 2!@j@ "@j' ''@'쀢 "@ju@ː "( @  !@jb /bin/cpmv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf㿐'D@2'H 2! `DH@A "(@j)@- @0ה ?  @j`H  @j`? :!5`@ 2!!0`8D@AȘ "(@i@ @0 ?  @ia0  @ia0  : !a0@iհ usage: mv [-fi] source target mv [-fi] source ... directory 㿘!M H@ b@c@ 㿘@Д㿘@[  2" @B " 㿘@N   @{l &  @B{  &㿘 @_ @]2   '"@% J -`?@2J M * (?Ѕ*8J `2 "@ 㿐   ɒ  @ $ $ %d㿘 @   @B   @P && 㿘  `?J "  Ɛ"  |&=<>+-*/%:()㿘`  3  *"`L`&L   ="@ "L  `<" `>`! 0 0     3"`Ӑ "`syntax error㿘 @c 㿘1     @ `  0%sh`` N QO`@K " @<! c@  @D Ȁ ؀  *@ @"    #ǐŐ@ non-numeric argumentdivision by zero㿘`0, ܐ  א   @ga02` @߬`& `  @YaH@ & @ & } р π 㿘`!    ` @)a0    " & N ``㿐Ң Ð C => 8?` v#|*` 88888888$@4_  0\@6Y  0V@&S  0P@$M  0J? A HF?` ; h*`  88888888$ @ 4"  0 @: 2  @2  @ $  0  @}`? @w@ ` p m k i g e㿘[`   Q   d ` 㿘`  А d`` %d %s 㿘@D` @c" А `` @ `""@@㿘@._msgbufpM:N:dmesgkvm_nlist: %s%s: msgbufp not foundnamelistkvm_read: %s: (0x%lx)kvm_read: %s (%0lx)magic number incorrect%s@ '# @Z㈒ `M"c,`N"c,@  @@@@   @h# @趐 @@ @@9al@?2 `!@# @   ##@ | `?@:   !@#Д `@ k?@(  !@{# @ X@9 a@? @ L`# /8' /  )L@ / @@ "L`>3 0 `<`( `%` `? @G N` #`L@?"`` #*  %#@x  @2Ơ  L`?"` * "@x֐ @ usage: dmesg [-M core] [-N system] 㿘M H@c@ 㿘@xph` XPH@ 8 0(    !"#$x%p&)(-o-a!-ef-ot-nt-lt-le-gt-ge-ne-eq><!==-S-L-G-O-h-n-z-t-s-k-g-u-p-b-c-d-f-e-x-w-r[]missing ]unknown operand㿘@?@@Pb 2??. @@Gb "&@ @ b?`R*`#X lt[ `%J`J@ !?!J` 2<``4J`J@ !J` /!@4` Ȁ (!R  %`@"`̀2`?`J@ !!J` `@`  Ȁ !R   `Ӑ`@"`̀@ !Ӑ`$ @`@' ̀@`?  `$ ` @bȁ%s: %s%s㿘  J  @ ` `@  㿘@!! ̢$ @ $  ̐`$ `@˰ 2  @ ?$ ́㿘@! ̢$ @ #  ̐`$ `@ @ ?$ ́㿘 ""@  ̒" @`?argument expectedclosing paren expected㿘  % b %2! ̐`$ @l` ̰$ @d &O pb0J Ȁ2R .! ̒ $    [b     ̀ "' @$`? @^@v @ @&  Ȁ " R  @  @@ 㿘!  $ @   ̐`$ `Ӏ` b ?* : `y *`  t       ( @ X l     $ L@]`?@W@ @R2 @ 4L  0I@@A`?@@8@ @ߐ@ܐ60  0-@Ր@Ґ4&  0#@ː@Ȑ$  0@@&  0@ @@8`  @ s f(@r j `Z#*`  p          h  h    h h h < L@u B@p =@k 8@f 3, *(&$"0'(%$#"Ȱ 4" ̀ @;@@ `?  <  `? @ 㿘   0"  "  0 @ѐ "T   2" Ȱ '%s: out of range%s: bad number㿐! $# @ # ` a(@ tMb     '    J  a@@ X ؠ @ @8X@4  ؠ @ @8X@&  ؠ @}@x8 8@< `?㿘@&-lillegal signal number: %s%s -soption requires an argument -- s0illegal process id: %s%s㿐@   @2?`@@c( 2<@? `@# /L@Mb   @@@U @J   @c04?? (@  ,  @F#P@㽐 @#@㹐 @ԒcX 2@? `@a?#`@@@Ēc 3 @a@ 6/?*@J@ -+ `&@ `Mb   @L 6?@ @ J@` @@ac0 (?@@V?`  @#'%@@ܔ @J`J  @`   @ ?2?@@` ?`@Esig㿘b@/  "   . @@   . ?unknown signal %s; valid signals:㿘# @`M@  H@  㿘 ) %#,  @#  xc@  , usage: kill [-s signal_name] pid ... kill -l [exit_status] kill -signal_name pid ... kill -signal_number pid ... 㿘!M H@c@` @`@@`h@ⷐ 㿘@ssethostnamegethostname%s 㾘@ #@a? s @@= @&*  @@5@` @T@b  @9a@!   @8a  @5 . 2*!0@@_ usage: hostname [-s] [name-of-host] 㿘M H@>bH@K /etc/fbtabr /dev/%o%s: bad entry: %s(null):㻐"@’b e""-$@ W@ # 2,@  b@  ! @ y L 0b@J ` a   @ a ` " @`@ @ J蠒 @% @ >蠒 @֐/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...㻘@ @@Ò .@ ֓2`   #  `@_Ɩ@  ; # 7 `Ƞ@h$,@K  - `@_0 +#@(  @ @a @D%0@$RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs%s%sr%s/dev/%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label㹠@  `m#@^t < @@ `0"@$/@ $@  @?@u @@? a ,@`;#@^6Q @   # `@g?,@@Ӓ `#@^$3 #@^, e`e@N  `#@^@d @`. :  :` ` @]  9#*` J@ 2 %sr%s%c/dev/%sr%s㿘&@ 6) # 2 L /-%Ӥ#b!@" a!@@i #  !Ӡ @?,@VӐ &  # L /Ӡ А!@b@9&$Id: logwtmp.c,v 1.3 1996/06/17 07:46:03 downsj Exp $/var/log/wtmp @ @ "@p А@ ؒ@ @ @@b $ $  @@ީ$Id: logout.c,v 1.4 1998/07/13 02:11:13 millert Exp $/var/run/utmpp!8 @۔ *  А@L $ $O؀ @{  @ @ @??@ @ $ް @b$Id: login_tty.c,v 1.3 1996/06/17 07:46:02 downsj Exp $㿘@w`a@* ??@6  @6  @6  $ @8 㿈 ' ' '  @_ ?㿈 ' ' '  @K ?㿘 # "? l x, @% 2 `J +, ?㿘 # "? m", @  2  ` , R &?0 &, ?㿘 # "? n#, @  !, ? 㿐 @?3 1 #` 8 ! ` @ʒ``? , %# `8"f4! #!` @*# L` "#&4` "#@@m#  ? " @O *  @ ` # 2 D # !? " @8 *  @ ` # 2 F #f(?   `Ȁ? " "f("  #耢? " 쀢`  ? " ","! #` ?2B`!`  " , )  @A `?, ) #  8? " @ *  @+ ` # 2 H # "? @˒ *  @ ` # 2 J㿘 # "   #`,  @ؔ  2 `J + 㿘 # "?  !t,  @  2  ` , R ? &?㿘 # "   #L, @   ! 㿘@*JJ " J`?{%d}^%c\%03o㿐?  !@H 8  @A !!А *  !Ԁ( "!@ސ $!"  @ +M'Ӯд ' \.`: `%r` `~mb@J  hФ* ' L 'L\  `~b@J  L '2  Вa@nCФ@נ L {2 b  -'@~ `"J@ }Ѐ~4 \b @J`  Ѐ`'* * * * z w ``* n 0`\* f E` ` L ^*6 ` `,`! * E s`,`:`^2 `*  `~b@J  `,`: `!`^``^*D ` `  @O  ` L ` *   r2  * А n*@#  ~b  `\"     aД`@@mq   aД@mi  ` a*aЁ㿘 # ` ?`  @:j;a@Э` 2* ? 1p1h1`1X1P1H1@18101(1 111100000000000000000x0p0h0`0X0P0H0@08000(0 0xrptNLMTncnsbsYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoulhzxtesosmsmidbdainhskmhcgneoxnxsxbambw3H3@38303(3 333322222222222222222x2p2h2`2X2P2H2@28202(2 2kndTdBdNdCugYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWmalwlhNlwsvtpbsglmliitcoFFFFFxFpFhF`FXFPFHF@F8F0F(F FFFFEEEEEEEEEEEEEEEEExEpEhE`EXEPEHE@E8E0E(E EEEEDDDDDDDDDDDDDDDDDxDpDhD`DXDPDHD@D8D0D(D DDDDCCCCCCCCCCCCCCCCCxCpChC`CXCPCHC@C8C0C(C CCCCBBBBBBBBBBBBBBBBBxBpBhB`BXBPBHB@B8B0B(B BBBBAAAAAAAAAAAAAAAAAxApAhA`AXAPAHA@A8A0A(A AAAA@@@@@@@@@@@@@@@@@x@p@h@`@X@P@H@@@8@0@(@ @@@@?????????????????x?p?h?`?X?P?H?@?8?0?(? ????>>>>>>>>>>>>>>>>>x>p>h>`>X>P>H>@>8>0>(> >>>>=================x=p=h=`=X=P=H=@=8=0=(= ====<<<<<<<<<<<<<<<< 00;;;;:::::::::::::::::x:p:h:`:X:P:H:@:82:0:(: ::::9999999bxmumlGCGVGHGDGUGLGRG4G1G3G2kobcnlrsi2sLsAXvXtXrXoXlXhS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXys3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcocopu9u8u7u6u5u4u3u2u1u0WAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXFXNRASARXSXkBpnacrPpOK5K4K2K3K1iPhuuctstawistsasrsfsccvrcrfr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbipalicifi3isi1fsffvbueseeiedtemeaeecussomrmpmkimmhdmtimdmbashddsdldcvsupllndveCMlevihodocmCCchcdceclctcscrblbt:  ਝ㿐 V`@6?k! #  `": " #@K # " ! # ` " :@=` :# " : ! #   R "t ""  "b #`" `"!" ,`" (`"!" L`"!``"`0 # R  `` ` "?@ڒa@?v !;3 !`R` R"v@$!?`$!f !; # R   `!;!@"`!;!V"@V"`@-V #`  ##!` `?""d`b "ab 2 aĀ   a  `Ԁ  # a 2  a 2 `X 2 @7c" !;!@" ,@R@2. #PDD "P ?H"D @,"H@ΐ !㿘 ?` TT@8 @1J@.~ 㿘 5? @%TT  ) (: * @*`.  (:   +`S @T * @ $ 3   3 " ("* T :  ۰ @.D  **8?? S S   S( ((* "S 퀢 ?㿘 D!;!" ? @2" ?V  @ @2 a"R  ) " ;ab 2;b`, @ `@2 ?@[ F  1@T 1 '@P;a"R  ۀ 㿘!;!"  M@w ! "E?" @"  #"`  R   "    #2 ;!R`"@ɟ "   ;!4 " " R`; !`  ; "   !" !;!2"R @& !"`` "!;R`R`* @`!"`  `ĤR @*  ,`"R` `@"`R    @ "R  @ @&  *` "R `@ " 5;!bR*``*` &@2  :  $  R @   ,` " R ``2 R `@& " [;W;) ;!R R @&@? $   @6D; ,` " R ` R `@&.;6!;;!R R @ʐ&@?2  :  $   @6; ,` " R ``2 R `@&;" *@" " !;!" "; "!@!"  "!@!@"!?"";! b""b㿘;" ?* " *@"S @㿘 ??RR@* :  *` (* @ T ,`: @$T 4 T .: @`4 `2  " @.,`@ : . *`:`@ : "@ 㿘;!V  @ R"N  J "DV  J : #` R  4 @60 `"L@ݒ`@1'    @`@0 ;! "  " "   "`     @0) ;!  "` * V `@ . #` R   N  `"t"p@0㿘1;! "?"`2J` ? 2   !"@4 㿘1;! "?"`2J` ? 2  n !"@4\ p#;aRbb ( ` ''А @, a` 2+  @ * "@   `@6  2  ;! @Ʊ2b 㿘! #J` 28J`  ~21;? `1;!"h ? !@[ ! ` ?"`` @* "@@bǐ ;!x c "x`"D @0)b\ E b` "A @0# J   ~21;? `1;!"h ? !@ ! ` ?"`` @* "@@b ;!x! # "x`"D "#@/# @/"\0a# `| "``  ;`Ѐ ;a P;!"hR  R  ?  # J  !;@ː !;!btbx@!"bt@"bx!"hR  R  ? !; # J  !@ !;!btbx@Ɩ !;"tR"x+  (* R ?* @ ͐? H;? x tH;t x tx x㿘  ` `a䀢 ׀`-);S  R!Rt?@ cRx?@cݐ 7! J   ~! ? `!"h ? !@< ! ` ?"`` @* "@@a !bxc "bx"D "!@/ !R "x  `4`O!Rt?@ cRx?@c7! J   ` ~!  `!"h ? !@ ! ` ?"`` @* "@@aT !xc "x`"D "!@.!R "x  2  c,c,c G!""@ BcJ   ? @  c7 ,@ 1c!"h  c@ c  @L@.w6L !"h"x"t   c J  !@q !btbx@!""t""xc !䀢 t!$q xR 6  h  c@K c  `!@ @.4!x"xRt?@ cR?c8! J   ~! ? `!"h ? !@ !  ?" `  * " @` !xc "x`"D "!@-!R "x ],dY, @U,!,`Rt?  Rx?@cg 8!c J   ~! ? `!"h ? !@Ő ! ` ?"`` @* "@@`1 !bxc "bx"D "!@-!R "x `@!,&@`[  @6W %; ,`Rt?  Rx?@ 8 J   ~ ? `"h ? @f  ` ?"`` @* "@@_Ґ x "x`"D "@-6R "x `@ 㿘;#"@ 7' 30  )' , @@!.@$ "@"h    J  @ btbx@!""t""x  ؑ, .@'`㿘;!Rt?@  Rx?@ j:;# J   ~!;? `!;!"h? !@Ȑ ! ` ?"`` @* "@@_4;!x c "x`"D ";@,;!R "x 㿘@  ;Rb b2bbd Jet !;@.#!;!"d 1;@$@B@ !%T@!""d!J  ';J  @!* ;!T*  *  2!;!R R @  @#@ 9;?` a*   a (R ?! (R ?a@:`aR`4 !`(2 `(2 !R` `(2 `(2 а ;!R`; ?, * ( 2 (  2 R` ;!R`; ?, * ( 2 (  2 R` ;!J` 2'!;;!`2@;!R2*`"h :`  # J  !;@ !;!btbx@ۖ!""t""x!;!"h "!@ !@ ;!;!` @ " 㿘 # J  ;`!  ?# @` ;!;!RR` @ @ @ @ 㿘;a"xR  ; a"t*` (* @* a"  aR a m!;!"h? !@J !R "x"ܔ" X[' Rt?@ Rx?@7 J   ~ ? `"h ? @  ` ?"`` @* "@@] x "x`"D "@*R "x d 0 # @* 㿘#;a"h? "a@ې a #bt FR`D @*ɒ"@abxR`6;;! , * `( *"@R&`(;aR  ;! , * P ; ( *"@R&(;aR  ` 㿘;!;!RR` @ . * ( c ?, ``?J  ?  @-@ }#a؀`!܀Ӑ @}, $a!؀lӒ @"!ܑ*``@"? , %/;-;* `(@@J  `(@@B 2??A # ` ;d4 7;!"h@ `  # J  !;@ !;!btbx@1 !"bt&"bx!e| e R`  |倓,  " R &|㿘;.`!@ (*` ;!;!(|  倀 .` "  #`J   `  ;!R  ,  ?@2  , 6;!"h@ @  # J !;@ !;!btbx@! #"bt"bx J    ;!?`# @`  !R L?;!R 6;,@; ,;!R  #`$4 ;`J  ?  @*@ ;!R  @6 ;*`;`@ *`;!R  @6 ;,`;`@ ,`;!@ @e;R@+;܀ ';h@ `  # J  !;@ !;!btbx@2 !""t""x"h ? " @  # ( !"h@ `  # J  !;@  !;!btbx@ !""t""x"h ?  @ ސ  # $4@(;,%;!R I;! #R`* J`` ??   ;@!- :;!R ?@ ,`@@@,`@;!"h@ `  # J  !;@  !;!btbx@!#btK#bx,  $@!R ? ;,;,;!R ?@ ,`@@,`@w@;!ܐ$@p@h@ `  # J  !;@ C !;!btbx@_!,"t"xR?@  R?  <; # J   ~#; ? `#;a"h ? a@  a ` ?"`` @* "@@Z| ;!x c "x`"D ";@';!R "x LW J,`,@;!J%A  ;@!*  9,`;!"h@ `  # J  !;@  !;!btbx@ܖ!""t"""x$  w !"h`@g;,@`  ,`,@`@";!"h@ `  # J  !;@ n !;!btbx@!#bt)#bxb6;!"h@ ``  # J  !;@ F !;!btbx@b! #"t"x a &"`|  `  @ " -` #  Ѐ  ;!"@" -`А"? -``Θv; @9$@p;m;!"h@ ``  # J  2!;@  !;!btbx@! #"t"x ܀``"  T  @" /;"?+;` ;!"h@ ` !; # J  !@  !;!btbx@–!""t""x( ;!"h ? @  @$;!R ,  "@>*㿘# c` !;!"h? c@ q c @&^ !""x""t` ,;!?""x""t"h@ ` !;J  !@ S !;!bt bx@o !""t""x"h?  @ B  # @&. T;` q; ?""xR  ,""t) ?"h   J  a@  abtbx@: a""t"h@""x@  @% a R ܖ;!"h@ `  # J  !;@  !;!bt bx@ !""t""x;aR   ;!P ; ( *"@R&(;aR  ` 㿘! # a "E`|@F@%D`֤#; J   ~a ? `a"h ? a@  a ` ?"`` @* "@@X  ax "x`"D "@%pʰ 0R`` N`@%c `C#; J   ~a ? `a"h ? a@ Z a ` ?"`` @* "@@WƐ ax "x`"D "@%*  ؀ "@%"°  # @% 0HG# %;c @% c J   ~ ? `"h ? @   ` ?"`` @* "@@Wy xc "x`"D "c@$c  ؀ "@$  㿘 c ! " ?@F@$ʔD0 ?  # @$ T??#㿘;! "L #@Wؒ@㿘 6 #" /@. + ;!"h@ ` !;J  !@  !;!btbx@  !""t""x"h" @  #  F" 3 # X ,+ ;!"h@ ` !;J  !@ a !;!btbx@ } !""t""x"h" @ P #  Fh X #! .@- 2+#;!"h@ ` !;J  !@ - !;!btbx@ I !""t""x"h" @  # 1! #! 21 ;!"h@ ` !;J  !@ !;!btbx@  !""t""x"h @ # !@ F@#ڔD~  #" :@9 27#;!"h@ ` !;J  !@Ð !;!btbx@ ߖ !""t""x"h @ 6M 5 3F  `D"@# ?  # X 726?;!"h@ ` !;J  !@ !;!btbx@  !""t""x"h @v 6 5 3F  `D X@#b  ?㿘 6 #" /@. + ;!"h@ ` !;J  !@B !;!btbx@ ^ !""t""x"h" @1 #  F" 3 # Ԁ ,+ ;!"h@ ` !;J  !@ !;!btbx@ + !""t""x"h" @ #  Fh  #!Ā .@- 2+#;!"h@ ` !;J  !@ې !;!btbx@  !""t""x"h" @ʐ # 1! #! 21 ;!"h@ ` !;J  !@ !;!btbx@ ǖ !""t""x"h @ # !@W F@"D~  #" :@9 27#;!"h@ ` !;J  !@q !;!btbx@  !""t""x"h @` 6M 5 3F  `D"@"L ?  # Ԁ 726?;!"h@ ` !;J  !@5 !;!btbx@ Q !""t""x"h @$ 6 5 3F  `D @"  ?㿘 # a 2a`X "?a ;`Ԁ ;?!"h@ `  # J  !;@ !;!btbx@  !""t""x"h  @ؐ    #  X    c !   @ F@!D;; 3Fc  `D X@! c;!"h@ `  # J  !;@ !;!btbx@  !""t""x"h @    #  Ԁ    c !   @= F@!nD 6  3Fc  `D @!` c 㿘 # J  ;`!  ?# @`     J`   J` (`' ##;' a"h   J  a@+ abtbx@ H a "bt"bx a d?^ # ` W 2ab ;a ;!"t@@2#  # "` # !    F@ D# c  @ FD@ ֔ c  !@ Δ;!?"bx"bt c` @  F@ D;!?"bx"bt?׀?;!J%@ А&ɔ #`J  J WV 2% `  ;!"h@ ` !;J !@ !;!btbx@  ! "bt"bx1  c   ) 6'%;- "h @  c J  @X bt bx@ t  "bt"bx  ?S #  L`;!"t@@# ` #     F@ D# c  @ޔ FD@  c  !@  ;!?"bx"bt  c` @  F@D;!?"bx"bt??;!J%@  `Ӗ?;!.`:.:@w@ ?㿘;""h;! *`"l  !  # $ "#@# ` ` "#@#  "#@#  ! @! #  #@#"\ "`` J  2 @q 㿘㿘;!"h @p p@͐ @@'Ԑ Ԓ@ @ ` 'Ԓ@ @`''Ԑ @ '' ' @@@  @ @@ @m 㿈?  '''@w ;!  !;@U@!""d%x @ 㿈 @\耢 2  耢 2 @Q  㿘#a ..   !Ӑ "a a@=0!! ! Ӓa@3 0&  & ' l$! ʒ ǒ&#P$!   $a㿘!;! @!$! ! X` ;"`$;"`(;"c( "c0 "dc@@]"㿘  @㿘;!` !@2ex%x" ex@ @ $@ ( , 0#$ "#,@#, "%|@%| "%@% @@! @;a ;"!;"!;"! "# ""d"a   NCURSES_NO_PADDING㿘 @̒%#;$a ب;ἒ #%x@"% '#a? "`2`2`2`"bt"bx"b|"b"b"b2b\"bd"`@"bpa@ "b "eD'#"eH'#"eL'#"eP'#"eT'#"eX"e\"ed"eh"el R  @ a"< "8` 2 `""H@ `Xa"@#@. : .`:`a*Aa *@a #%p#%|@D#%3; q&a @; ; h"aa "`$"` 1!"e`*:* Ӓ""="  8` -@   aR @" <"a @ /"a`2`a`"2` "  &:Ӑ""`- :` !;! R  @#"t;`"!!@" (@ʰ 0? : ӄ<  " ?㿘   ?㿘;!  "dX@ @I@ @@㿈 ;!h:"  # R` ?8.?#:R`  ) h` " @"   .`: ܘ ?# 2 .*?` . ;!  "l   2    0 @  < !: @ #    @ *@$ !:   #   @?  @$ ;! "l wu ?# @2 2U@IL # " `N2M`6  "#; #\6  #`6  #d6  #h 6  `6  6 6 6   @  ` @G:? @";! "l 1/: ?# @2 2@  0  @    #   @,  #   @,@  #   @@,  #    @?` :@ ";! "l : ?# @2 2@  @ @ @  #  d  @@  #  h  @@  #  l  @@  #  x  @@  #   @@@  #   @u@@  #   @i @  #   @]@  #   @Q@  # &  @E@  # &  @9@  # &  @-@  # &  @!@  # &  @@  # &  @  ;! ":""h"  㿘F`D `d`h`  `l`x``@`@` `;l?A 㿈 'H1Y"@+N O+3M`$@;N  <<; >@g?耢 4+ N >+b@   *`: ?''":  . * N?' : ȅ#D2 H" N >';!"" N &'㿘А"@;!" @?㿘 #   ;! R` @ @.㿘 #  p @";!?"bxbp "bt@"bp㿘 # p;`!W@Z#!; !;!$bb #  "bc  J !c"b 0C !c"b H< !c"b 85 !c"b D. !c"b ,' !c"b L  !c"b | !c"c  !"cc"c   ؀ "c !"c c `( !`<" @{  !c"b!@r  !c"b!@i  !c"b!@` ݒ !c"b!@W Ԓ !c"b @N ˒ !c"b!@E ’ !c"b  !c"b  !c"b$4  !c"b T !c"b  !c"b!@  !c"b!@  !c"b @  !c"b !@ ڒ !" @ Ғ !c"c @ ɒ !c"`   @  #$#  0;`!@   #$#  H;`!@  # c$# "` p  @I c "b "!㿘!;!?R` @!"p? @S  #  @@ 㽘 . # !  b@ ";@v@I;!"ԀS # !`&!;!"Ȁ #  @\@I!"# c  , !;!"@i6Ѐ 2.c!`" `,@@ @O@!e@I b`^@Ih`V# !Ȁ`&@!;!" #  @ @IN!"# c  L 9!;!"@63Ѐ 2.c!`" `L@@ @@!@ ` @I`Ц"@А"@ r @x #   b@ ";@@H;!"Ѐ # !`'!;!"Ā6   @@HӐ!" #  D ٦ /`/@ ;!.`$`(* @. Mb  2/`  /`;!bh.`$`(* @ * @ ?  /` !@ ;.* ! $  ( *` , ,;!"@K* # ;!`D"@@ݐ@8!@2` @HS ?Ф"@WЀ @HBO# !`&!;!"6   @@H,!" # 8 2;!/ 8b@@@!@` ?@H ?Ц"@ Ѐ @GА"@㽘#;@a aR  @@ӒaT`@ &N%;@`T`& "@ @%F' #L !  @D?c` ?"`c* $c@I ?`     @D c` ?"``c* $c@H  %;R`?44 Т"@c@-@?@Gm?" ?R ? ?, ,  Ѐ? { А"@?  ? #    b А"@ ;!" 6   #  0  G А"@ ;!" 6   #  H  %;R` )А"@ " 6   #J@ ( J` $ !  8  ?%;R А"@ bb  @    a  V   #  @F ;! #C  #  0@F  ;! #0` #  H@F ;! cR`/ #  @X1 #  8@X+@?;R А"@@ F@CD ?㿘  X +$a$a$a$a$a$a$a$aܔ -$aĐ |$a$a ~$a _$a$a :$a '$a #$a o$a <$` >$` v$` ^$`$a$a$`$a$a$a$a *$a !$a f% $a "l "@ "H .@  ("HJ a ~ `6 + . 0"  4  f&  "HJ*`   #@   *㿘;a*%taR R S " R  S @` %p <   S S   .`S  a &@3 aR "@a "R  &R a 2aR  @ 2 @ ",? 2  ` !;!2 2` 2!2 e| "2`@ !"%|!% " @!"% &""t " а x2d2d2dJ2d<2d,2d2d   1* 㿘 #   @ @㿘 #  ې @ @㿘 # d d  @ 㿘* :    !F DҒ # c` R :?1;!"#0 ` ""dR`@j !`"#,'2@c R ! $#*` !* "( @"l!`"#$?c J   1#c1#c* @e* 㿘. : .`:  , .@:  &. :  &, : . : @ǒ 76K7@* :  1 &@*` *  *  *` *  * 'В"@"@@7@- : . :  2,,:`,: "@*`" * , :`@"  x:  ",:`"@ *`" * , :`@"   *`" * , :`@~" !h* : @?!h6㿐. : `& "d@6?;!#4 .` & . & , c:   2?, c:   ;?: ` #@ 6?.:   6?;. !:`#,*@ *  @ =;a R @7*?#a R   (  ;!* 2P" S ?3  3 6S 3 43  P$`;@ ݐ;aR `@д ;!. #,:` #2 $ ", J  1#1# # $,: * @*` ,: * P @S +`S  R`P #\R`#`. @=:`@h 㿘 # $ . : ` #@6E?.`2#.: ` c4:?.: $ 1?J  :;+` $+   ;+`!@ $*`2 $ 2 $ 2  # $  , :`,`:,:,@; @  H@  ` P P`一"伀2 圀"堀2 䴀2 * :   `"? ;* $(2@ ;* $(2 ;* $(2 * :   d`?;,* 02@;,* 2 㿐  # d 2 d    |> # $ "*`@O @03: .` 77W W Wn* :  W W OW W 4W "WBW (Out of memory㿘ӓ. "#p!@dw#l $#l4@c#%d`'H'L'P'T'XHӀ "#t N5 J@ %2w`J` r `ۑ* :  N8m`* 8888888888444444444488888888888888888888888888888888888888888448888888888884`$ `` `ϐ 8 `*: ?Ѐ4```J@  %@"@@ @`!"D@c"@ $"D` 4   Ӷ*" Ӏ"#h,NИӄ##h*`@*` `##h#hN ;%#5#5Ӹ#*`: `% " ct      '"D*N 3M?* :  Xn* ِِِِِِِِِِِ|dِِِِِِِِِِِpِِِِِِِِِِِِِِِِِِِِِِِِِِِِِPِِِِِِِِِِPPِِِِِِِِِِPِِِPِِِِP **"  $ 2 b   + @ *`Б*:  @(@*`Б*: @*  N `"m@ * $?ߑ* : `]6"d*` \,,,,,,0d,߼,,,,,,,,,,,,,4,,T,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,p,,,܄,ݘ,,,,,,,,ct %p  ctctcl* `'cth`*`&h Ӏ`"D ct`p@ clcl;h`*`&h: @5ctp`@   clct"h`*`&h: "D@x 4ct`p@ clclct@Aclct@a@ct@''ct ϐ  *`: h?   *`: h`?*`&h " *`: h`?*`&h Ӑ"H*"    *`: Ӓbh\@ ޑ*`: ӒbHh|P@h `N*`'`&h̰    *.`@*`: @АА ( h`4N*`]'h`*`&h h`*`&h hBh`*`&h h`*`&h h" 4N*'&hh`*`&h h`*`&h  @ h h`*`&h h`*`&h @I hh`*`&h h`*`&h @ hܔh @ *`&h  h`*`&h 2 hh @ *`&h 2 h`*`&h h hh`*`&h h`*`&h h h`*`&h h`*`&h hzh`*`&h h`*`&h hdh`*`&h h`*`&h  hL`?h`*`&h h`*`&h &  3hh`*`&h h`*`&h 4  hh`*`&h h `?h`*`&h h: `4\N*`'`V&hА 'В`P'h`*`&h 2EN N ?`%2N N ? ; e$0N2N")NN 2 N 0  N `%2N N ? ;N  2 N N !Ӱ N E!#l  Ӑ @7 $#l l#t*@l㿘 u s,?V @V "    8 (@> 2 (`@4  (,`*  (@`@  (`*@ @_*` F& ( @,`*  ("  ( 2  ( 2  "`V V * @*` * ( "@ `@ @_̐ @H ( 227   @_W*` ("@ ( G? V * @V *` * @" (R`&2` (2 , ?" 2  (2  `@$ (6 6 V ,.`: @46 ,V .V  2V 6 .V V @ 6 VV @ 6 ;P   @` 4@   H   ;? ;P`  `4 㿈 ;!R @  : ؑ,`?2;`@ ,`;aR @19:7;5;,` ؚ;"@R `@ 6R ,` ?@ @"2 ;`@ `@?";R @ ' ؒ,`?;`@ ,`;R @' ؑ,`@&''`#@k6`'@,`,`* ;%%|@-  @SK   "-  (`(, H@,ᴐ`(* @`(=@耠 (J  (`(,@ ᴑ,`(* 6@,`(* @(,@*` 6  *   ` ؀@"?` @6n@,`,`* ;%%|@-  @V`4  J   "-  (`(, @,ᴐ`(* @`(@  (  (`(@ ᴑ,`(* @,`(* @(,@*` 6  *   ` ` ؀@" `@;R @֑,`㿘!;!R #:`Ԁ@ %:Ѐ "!@q!R `*` @C*   $!%| "!@`!$`Y"%|!R $`;!e| -!;e ) R`@w! ;! ;! (@R ? S   @+  們+`"@P`@ S!;!e| 2 eR`@ !"e|!e 2!R`@~ !"e!e|  e  R`@2!;  ;! ;!S `(`  +  %"S (`  +   %|`"T @چ!;! R #:* `@;*!R` @6; %|+`   ""  ""  "S `@;aR` @%: !:: ؞?  `   ""  ""`; "a#R @ :  : ؒ 2   @* # `;aR @Y  : آ? S@6 S!R ?2S`@  S@ B " `@  ?+`!R`"  #@ `@  ?" #@ &  :``4   ;a  ;  *;aR @&S<;|;P * ((@  `*;|*  㿘!;!%|W &  ?"@)* .`. @ &@@D;!!.`* P (`   +  .`|@" 0&.` . @"@&@@;!!.`* P (`   +  ` .``|@" 㿘#;aR %:܀  !: @[~*` aR $ $ aR C;':R ;!R ?  `R  '"  `?,  "    `?" ?R 樖R ;!R ? 5%:,  1@? ? %@"? @?,  @"  ? @?" ;: R$  m 㿘 # @R   ?㿘 # R @   ?㿘1 #  # ?`  `"""㿘1 #͐ D 2?#`H ?"`H㿘 # ?ɐ D;! ;! " ;J ;@K ;!`  `@6  㿘 # 1;! " @3 !@ !`  `@  # ?㿘|#x㿘#xNCURSES_NO_SETBUF㿘?@ &@d;!.`:  "`  ` "t@`**!;! ` @ !"@Jڔ`?㿘 ;!.`  @"*  2   #  ".  . ,e@ ?㿘 ;!.`  @* @ . ,%A㿘? ?@0 ;! "b  *`8?" $" $ ? 2* ?  2" $㿘 2. ?.`@}: 㿘;!.`:   "b # !  .`   # ! @v 㿘;!  "p) "   ;!2; #   P#  @ #  4  ?@L;!`@"bp? ;  㿘`2`    @2  ` 㿘;! ,㿘.   # !d  .  1; # !` " !@1;;!@E ! 4 @D! "`4   Ѐ ᰀ  |਀  T2 ᤀ2   Ԁ2XḀ X2 ᨀ2 㿘: ` %;#   c`*  @  ,   2㿘`z@ v!;L! r. o 2  @"   "    ` 2     0`  `@ "J6  "$@ܰ@ & @ @ &   1,!; -*a@.  `. 6 @ "!6 #;  @ג & 2 @,a@e20 .  `. 6 @  6 㿘N  "N @ՐN  @d㿘 "T? 8 "P? 0 4G$`" V   T  @46? `V   T  @4'?0"?@*& 0& 4  6 .`@`+     (*` * (. " ?V  .`  2* ?  5 81R @'8 (S `&R40 ( ((R@S  $R2R6R2R`@ނ` 882R㿘 7 8 3V  ,  4 * @ (*` R`&V  0R`"@ (@  V 4R`? $R`2`R`? 6V 2`V  ؚ` 㿘  8  V 4V  0@ @-  8 2 8㿘 V T`T`T`T`  @` 2`J 6 @6`6 `6 `6 ` 6 `H6 H` ?6 `& `&  `.  `.  `.  ` . `$& $ `.  `. & 0& 4& 8`,6 ,`. V 6 .T`  *  (`(@@`( ( @2``( ( @2`V  㿘 D;!%p >%;';);24 `2;!"ep"@@  V  @ (  @ՠ V `@$ (@ (@̐"$ᰀ"$!"%!02㿘&# !` `;!R " ;!R " ;!S @ 3 S  .@  & " .` @}  ( "@ (@ @: "@ ( ` @*"@ 㿘-  * (`&$T @49 T @43 `"2 ?" 2 T T @, 2& 4 & 0  &  & /  .*  (  ("@   & 8㿘R R & ' 㿘  ` @}o   @}j L  @}e & (@l 6 6?6 6 6 ;!6 6 H6 &   & R R@`?. . .  . . . . ?& $. . & 0& 4& 86 ,6 .6 <6 >6 @6 D6 B 6 F@  ( 2  ( 2 ` !;!R ;   6 R;!`6 ;!R  ;  6 ;!ep$@$`"ep㿘`V  9* .: .: "&,.* * (@ *` @,: &`.* V  4   ( *"@V $ (  `5,: ,: "4,.* * (@ *` @Ķ ,: &.* V  4   ( *"@V $ (?,:`,:" @ 㿘 "?N  `" V .V ,$@@ 4?   ?@USe 㿘;!`  "b"bP*dD ~"P ="D*`e D?㿘; ! "b P* d D ~" P " D`" P*eԐ D㿘 # PD* "P㿘;!"b #"bPDD"Pb "D㿘;! #"bPDD"Pa"D㿘 # PD@ "P㿘.`` #P *@#P  "P # D ?H+ ?H-㿘 # ?R @o ;!`?2b\2b^2b` ;   |;  | ?P`P@ 00   0 ?;   ;  㿘 # ` ?`  @;a@ `㿘 ?` @D@``@To?? 㿘   >?6 V  @`@ V ,:`" 4"&*: * @*` (,`  @:.T ?$T 4 T  ,: ?@?4 B㿘 # J   @Z0)@ P@6 @c cĀ  "c#;! L#a@? L#;!F D@ ;! "L #@k 㿘;! "L #`? "`` . :  @* "@@2 㿘F @D㿘?  ?# 2 ( ` `!  ! #`J   ` R ;! " " 2  @< P#` R` & M"  9   *,`* ?: `` ,`.*  M"  Б*: @   " N    2 N *;@x ;"!N %M*`:  $  N <"  ƀ $N z`ƀmN@  `.@K > 2ƀ $ƀ <]N   M" *+  * ?: `` +  N`.*    ?Б*: @    M"   2 N  *2  @ N *"N /"N   ` "N@R N ` N {` ;@= ;F D"a ;* :  LINESCOLUMNS㿐;! 2 &@ c R &c Rh&@&G@p!X 4&G@j!` 4&@ ! @ 4(! #@R    "# #`hR @7 # 2  4@&@ 4&@ $ @ 4  R `$ R $& R&@  @   & P&@ #  2` `2@ # R  ""  "b㿐z;! %`€㻘@ k @  `J &* ``+$` `*` ?"" `a$`TERMTERM environment variable not set. TERM environment must be <= %d characters. Not enough memory to create terminal structure. terminals database is inaccessible '%s': unknown terminal type. CC'%s': I need something more specific. '%s': I can't handle hardcopy terminals. 㿘 H@ X N  ?M HH@xg``@t @F" ?M HH`@xX"@e  @xF t 2 ~?M HH@xH`@U U`@ @$`$ `$ ` $ ` $ `?d&M HH@x#`@0  2>&M HHa@x@$ @ #  $  H@)!8  @C  c#@@m~!` @  "  "t! # `j2 &# J` M&? HHa@@wڔ@ J` M & ? HHah@wɔ@֐  㿘H@ߐ!8  c   $ J *@ J*`:  "*J  㿐@A#'@#* "*"@ *`@*`'@_  㿘! # $#@c p# `"Pa   *#㿘 " ?@ѐ@ c""c 22KKnn,,XX ` `%%KK@  ? I( ((    I ``㿘! #@k D "`P#`2"`p㿐'@ @D  "?J ?㿘;! ϯ. 0@  N  ;! *`Ϡ. 㿘 "? " ?#;a  @   V  @Aa "`a "   H ?6 V  NV a? ) T:  E, : * @*` ( *P` (* `,@P`4 $(: @+`:`*` # P?@0 06P0@40* : `0`0` * V :   N  ;. ! *`N  ; ; H@ Ḑ 2   2;!  *`   "@@ J3 MJ\J* # b"J 2J: b "  * @ "@"J J2J  2 J@$`M\2J@  @" "J@ ` @2` J@2*  J@`TERMCAP/etc/termcap /usr/share/misc/termcapTERMPATHHOME.termcap /etc/termcap /usr/share/misc/termcapx"#K@ː 0@ K/`8KL /&K@ ` K!@ p "@r! @m@+ /, K`x$ "" 1"@j $L$*`:   :2 ,  L*`:  "  :2L L  L  $ ՠ L   $L / ?@ ?f??!tx@c D?!l'  ?!p 9'   ?!@ -  J*J@ J`J@"  *`2,`$` ?" "  : ?, , Ґ?!t !@t#  @n  $#. x@+c $#&@|: ?#%Ӓ!Ӕ## @L" @! # $?&@ &` &` &`   &`$ @#  #L@`( 2!$ 2 @#Out of memory㿘@Ő  L@L3!@b`"$"( "b`"!$㿘 % #   "!$@!$@"$b`"$b` 2 㻈@F7 | @iӔ"a8! |, `, @F# | @i"a8! |, `, @F | $@F | $@2`@` `  terminal names must start with letter or digith.  b\ *b\Ȑ @!,@1M3L@ >?"    @Kc *  V "``  a( "!(!(`" *"\Name collision between %s %s|resolution of use=%s failed㻀  #B'M+M)M # %`(!$D*  "!$`` `@pH@s`X`$ !$@gH@s x!$ ဤ`$!$H` ?"`H* $H@+V !$ 2    # ?\"c7M  6R!$@5@J #  " !$@9 "!$%  !$ `# @5 @ `@!, 2L@Jݐ!@&& & &  & & &!$$`2   ""M @J$ !$ 2   # K  $D!$  `  9  `@K   " ?*  @ ? $ @  " @] " @W  "@Q$$ $ $ $  !$ 2   # (;?  J ?"* ``+$   *`R ?"2 ``&$   *` ?"" `a$ !$ 2ߒ ;Ȁ   #? "c%  ! @T$@Iaȟ@!$ 2!  exit_standout_mode but no enter_standout_modeenter_standout_mode but no exit_standout_modeexit_underline_mode but no enter_underline_modeenter_underline_mode but no exit_underline_modeexit_alt_charset_mode but no enter_alt_charset_modeenter_alt_charset_mode but no exit_alt_charset_modeenter_alt_charset_mode but no acs_charsexit_alt_charset_mode but no acs_charsenter_blink_mode but no exit_attribute_modeenter_bold_mode but no exit_attribute_modeenter_ca_mode but no exit_ca_modeexit_ca_mode but no enter_ca_modeexit_delete_mode but no enter_delete_modeenter_delete_mode but no exit_delete_modeenter_dim_mode but no exit_attribute_modeexit_insert_mode but no enter_insert_modeenter_insert_mode but no exit_insert_modeenter_secure_mode but no exit_attribute_modeenter_protected_mode but no exit_attribute_modeenter_reverse_mode but no exit_attribute_modeto_status_line but no from_status_linefrom_status_line but no to_status_linemeta_on but no meta_offmeta_off but no meta_onprtr_off but no prtr_onprtr_on but no prtr_offrestore_cursor but no save_cursorsave_cursor but no restore_cursorexit_xon_mode but no enter_xon_modeenter_xon_mode but no exit_xon_modeexit_am_mode but no enter_am_modeenter_am_mode but no exit_am_modelabel_off but no label_onremove_clock but no display_clockdisplay_clock but no remove_clockset_color_pair but no initialize_pair㿘 ` ?2C``  ?"  ` ?2 N@HR! `  ?"  ` ?2 N@HB! `  ?"  ` ?2 N@H2"( `  ?"  ` ?2 N@H""X `  ?"  `d ?2 N@H" `d  ?"  ` ?2 N@H" `d  ?"  bH ?2 N@G" `  ?"  bH ?2 N@G#  `h  ?"  ` ?2 N@GҐ#H `l  ?"  ` ?2 N@G#x `p  ?"  ` ?2 N@G# `  ?"  `p ?2 N@G# `  ?"  `t ?2 N@G# `t  ?"  ` ?2 O@G ( `x  ?"  ` ?2 O@Gr X `  ?"  `| ?2 O@Gb  `|  ?"  ` ?2 O@GR  `  ?"  ` ?2 O@GB  `  ?"  ` ?2 O@G2! `  ?"  ` ?2 O@G"!H b  ?"  ` ?2 O@G!x `  ?"  b ?2 O@G! a  ?"  a ?2 O@F! a  ?"  a ?2 O@F! a܀  ?"  a ?2 O@FҐ! a  ?"  a܀ ?2 O@F" a  ?"  b ?2 O@F"( b  ?"  a ?2 O@F"P bX  ?"  bT ?2 O@F"x bT  ?"  bX ?2 O@F" b`  ?"  b\ ?2 O@Fr" b\  ?"  b` ?2 O@Fb" bt  ?"  bp ?2 O@FR# dP  ?"  dL ?2 O@FB#8 dL  ?"  dP ?2 O@F2#` $  ? $ ?O@F"# "?R @4?`*` ?  ((P8@  " R  4  (R       `&&?R @@  ?@ 6 ?*` (R @ ( 00 (  00`@   /usr/share/terminfoTERMINFO㿘;J!р ; 2"!;J!Ѐ ;@% 2;R@P"X ;; *a;!ԁ㿘ݐ; *aс ??  2 2@ 2 2@ (2@`  㿘 @6? "&@ 2 &@(&@&@@ H(H8&@``@ϰ ?c@ 2а ?#* @a2ǰ @ * @??#c * @`??#c * @??#c *@ * |@y`wu &  ,/4 @ܐ &`  a"?#@6/@H @mU  S&@@#Ȓb ~:   @ۖ , ,@m@  >&`@8@ @  `' '@m+  )&` -`@2H `  !@m  &`,@20 `@ߔ' ``+4 `* +$`&4 ?*` &2   *`"  㿘@   @  @b)    @ )@͐%s/%s㿘@# T`p@$ђ 㿘 @#2@0 'RN  :2 ` .@Ӗ 퀤   @%c/%.*sTERMINFO_DIRSp@b 7АTa` N@$;J!Ѐ  '  "5 @P R@|"X   "! @     @/ 2 RT@Z!h R"@TERMINFOHOME%s/.terminfo/usr/share/misc/terminfo㷈@耢 T@4"Ȗ   @a$#'@ 2TT@ "ؖ  $T@Xs#T$ T"$$ 耢 @? 2 @aa$   㻘@aR$@鶒 / . @鯒 / *@ |primary name may be too longalias `%s' may be too longx'''@{ @Δ @@=u : '*@"& &䀢 ~ @@ a@B܀` :*@@`"@_ | '*!U@ @Q'܀ U@Bސ !U @  '@B  @Bΐ   l x . @ @K : **  + m". @ @@ 6  2 2@  &` n#. @܀ 6""@ ! @1䀢 @`?Entry does not start with terminal names in column one|primary name may be too longalias `%s' may be too longusetc%s (%s termcap extension) ignored%s (%s termcap extension) aliased to %s%s (%s terminfo extension) ignored%s (%s terminfo extension) aliased to %sunknown capability '%s'maMTbooleanstringnumericunknownwrong type used for %s capability '%s'unknown token type㽐@V?W@A @n #&! # #&!&!  "L  | * @&@%& @@@^Ĕ"@( | 2,!W@ 8@ W@@ @#W @8  @   ``@@ @& >.) "- 73: 5"W@G<` "W@G6` @O *` "`  "*` "`  &  "da@  S '!`J!'W@G " 2  "@ ߒd 9`8` @@@1`  +`!l` !l'W@F" 2  "@ a `` @@`  ``@7"` `"W@@!80S`N"W!P@F  @?@  "W!X@F  @? @  @ '`` ` w` "W  W !xW !xW!`W!h!pW"@?!0["*T` `0F'C`` "T`  "T`0D" T`0A ?>*@ ? ? * 6"T`  1*@  * ,2  UT`P*`R "@ @KT` *`" W@?l 0W@?g 0 2W@?a!  , :@  @̀@ @@?, $ #  @9 + "   `@9 + "   `@E0@@  `N`2JQ J$2J@J<2J@M 2(8."*"/">"J@$2JJ`<2JM` @2`(8."`*"`/"`>"`J2JJ@2J  J@"`gggggggggggggggggxgpghg`gXgPgHg@g8g0g(g ggggfffffkcuu1uptakhtsstkentnlkcuf1ndkcub1lekICimkich1ickhomehokrmireikcud1dokdl1dlkdch1dctbcctkclrclkelcekedcdkcbtbtkil1al  %s$<%d>hardware tabs with a width other than 8: %dhardware tabs with a non-^I tab string %s,unknown capability `%s' in ko stringko translation table is invalid, I give upno value for ko capability %s%s (%s) already has an explicit value %s, ignoring koacsc string synthesized from XENIX capabilities``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~.` .` `Ȁ 2 af( "a@ "` a쀢 2  f, " @ "a   2  R D Z` Z@zZ @ "` `8 2"  R H Z` Z@b@u  J % 2f4Z@k   ?" "`8 `, 2! f0 ?2"`, J ) "  R F Z` Z@3Z @B "`, b 2(  J & "# f0 ?" "`, J ) "  R F Z` Z@ Z @ "b  D.` J ) 2 R F Z` Z@-Z* `"   ? @[#  b  `".` , ?@[  `,@[7 @ "a.` 2;  J`+ " J`'  "  " 2  R J Z` Z@Z @ "b R`?2   J * 2  2`   2 Z@ ( "` J * 2.  R `Z@< 0#  " Z`  !Z "@   L  >0* L  *@ؐV` *`"  Z@` Y "  a4 2  c " "a4 "#  J  2!   ܀ 2 Z@  "` !< 2 Z@  "a<  2 Z@  "` f@ ???fD ?9?fH ?3?fL ?-?fP ?'?fT ?!?fX ??f\ ??f` ??fd ? ? &h ڀ??" bH`@n@ &@ " J  2   l, &@  ,  &D " J  2   m, &D  ,  &H " J  2   k, &H  ,  &L " J  2   j, &L  ,  &P " J  2   t, &P  ,  &T " J  2   u, &T  ,  &X " J  2   v, &X  ,  &\ " J  2   w, &\  ,  &` " J  2   q, &`  ,  &d " J  2   x, &d  ,  &h  n, &h@ ?"@)?"@@ , "bHZ@:!H0 bH `d  ` Z@ r!x "bHacsc string synthesized from AIX capabilities㻘 ft ?bH`@s@ &tJ   l, &t  ,  &tJ    q, &t  ,  &tJ    k, &t  ,  &tJ    x, &t  ,  &tJ    j, &t  ,  &tJ    m, &t  ,  &tJ    w, &t  ,  &tJ    u, &t  ,  &tJ    v, &t  ,  &tJ   t, &t  ,  &tJ   n, &t  ,  @ , "bH]@9" "&t㿘?nl2 s. "#l  @" @@u 2 @8  2 V   2 V 2 0 `Ȥ Ӓ ( (8|"ӆ( Ӑ#*:  H@J*8  `H@ @ J   J J(82 J `  J 2 "JH@2J  " JĂ  HOMEOut of memory%s/.terminfo㿘!;" 2;_@ܐ @ ";@ $8;@@ $" _@9Z H_`X@ܔ;" 㿘  "@& "@  @ @%&*!#Illegal character (expected alphanumeric or %s) - %spremature EOFempty longname fieldolder tic versions may treat the description field as an aliaswhitespace in name or alias fieldslashes aren't allowed in names or aliases$[]!*?dubious character `%c' in name or alias fieldSeparator inconsistent with syntaxMissing separator after `%s', have %sno value given for `%s'Missing separatorIllegal character - %s@#à?  !@8d!А?$a,!@*  ?@@I` ` `  \ @=   ?J!ɀ : `.`:`.@*`.  @#`.` ` tM" `  _!H,`@2:` Ԑ!_@7v!P@8/@J!0  "#?*!ɠ!*!J!Ȁ   "# ?"c  "'_ "# "% "#@` "`:@8?`,@ ,Ԁ`,&#,ɀ \2 @   ,ܠ , c?  "cِ :*aԠ?L "? "? ,"?, ԰!Ȑ@20 | 2L@2L@7,,@- |  L@ 2_!@7!8@7"4_@7"P/@2  `_!@7`!Ԡ!@Ԡ!Ȁ1M%_ "@  _*`: `/_@1H 2L * Ԡ! "" 1M% @@" `@ ` 2 , `;`_2,, ,`: `=`#7 `,y y `  u `^`@ o `J!ɀ@ _@7s"Ԑ!"bh @Jaɢ@  `!_"#@6iaȔ@7" Ԑ!"bQ %M@ `@ ` ",  N,@- @_"@6aJ _J!ɀ@_@6" Ԑ!"bb"` @N* Jaɣ: @ _@6ݐ" Ԑ!"bb"`  ?!_@6#@6͐ ;Premature EOFIllegal ^ character - %sNon-octal digit `%c' in \ sequenceIllegal character %s in \ sequenceVery long string found. Missing separator?㿘 3 +a/M5a@bJaɠ ?c  ^  ^% \%" \@M? @6b@ ⌒@J`  ?@5 a@6gP ?2  ."ݠ .р @+?2 ?@6b@, @:  ! @??@6}b@  ⌒ @ ` p@67,``?Ѐ" .?`jb ȓ*`  ttȐ 4. 1. .. +. (. %. ". . \. ^. ,. :.@4Ր a@5 .2 .c 2. . "X "X a@5w"0., > 㿘"!@5T!Ё㿘. > @6?ل? (        㿘1@#Ԓ?M#"   . > 2  㿘c܀ #J 1 P " "`I""Ԁ  J A٢ + !)1 '  @#c%b!c@b$ %#"$ &"$L!Ȁ #퀢`2J0?#Ԓ"#J "ـ 1@T#Ԕ#ԒJ  J *#Ԑ*?c# @`?+!Ȑ "J@`#cԁCan't backspace off beginning of line㿘#؀@2c@5""H"*㿘#܀ "@ #Ԁ #& ܀" 0 Ԑ H`?㿘N  *`N :` * @N  @jc#㿘* @ @;  V `*`  o* @㿘#L:  2  @:  *  Out of memory㿘1 @ ܐ!@"`D& @ @ 2*d@4[  @㿘! @@& @D   *  @@>"D $ @d@4B @@ostring too complex to convert㿘`$d@3!X0 "`$ (c*"@I'm confused㿘 $` `( 2"`(d@3ѐ! " $ې#*` " (`8 "`8㿘N \ ^"/ 0 N 3% 06 M %4  $6 2 \"     *` А  @  M    M" @  `,`'`\`:< % '* "<* "<*  "<*  /"<1 < `c %, & < {,  & <@xߒ d 0,  & <`   <@xՒ @h  0, & < <@h  0, & < }, & <string may not be optimal㿘 4    " ! () `e@3 p< %* "< P* "< a*  v"< % g <* "<* "<*  "<0d$ (ܚ % p 0<* "<* "<*  "< 0 !  < % {* "<* "< 9*  "< 6*  "< }*  "<*  "< ^*  "< , $ "< % {* "<* "< 1*  "< 2*  "< 7*  "< }*  "<*  "< ^*  "<saw %%r twice in %ssaw %%m twice in %ssaw %%n twice in %sunknown %% code %s in %s㿘" $" (" ," 0" 4ܐ "`8ِ# @"`<e#M@b  "N@ `@@  2`*`:  *"` ."`N@ @!ܢ %%ܦ +)ܑ*`: % <` <*@?ۑ* : `N`f *` ,,,,,l,,,,D,,, ,,,,,,,,, ,,,,,,,,,,,,,,,,,,,,,,,,,,,P,,,,x,,,$H,,, <*`4  "`4e#`,  "`,e # `0  "`0e#8@1N@ < i* x$ <8~  < {*@`$ <*@`$ < 6*``$ < }*``$ <*``$ < **``$ <*``$ <!*`8_  < {*@`$ <*@`$ < 2*``$ < }*``$ <*``$ < **``$ <*``$ < -*``:$ <8=  < ?*@`$ <*@`$ <@ < >*$ <*$ <*$ < t*$ < <@*@`$ <*@`$ <*``$ < ;*`` $ N@`* $ * "< <1ٰ#*%%?%%{%d}%%>%%t%%{%d}%%+%%;%%>%s%s%%?%%{%d}%%>%%t%%'%c'%%+%%;%%>%s%c%%?%%'%c'%%>%%t%%{%d}%%+%%;%%>%c%c%%?%%'%c'%%>%%t%%'%c'%%+%%;%{6}%*%+%%B%%{%d}%%+%%c%%'%c'%%+%%c\%03o%{2}%*%-%%D%{96}%^%%n%{127}%^%%mnumeric prefix is missing trailing d in %s㾀'D'L' /v/@@J >D'J /2AN@M" @  @  2?*`:  ."? *"?L <2 ?L $"'  'M⌐@  %*`  N, ⌒ ``*:  ." *N@ @'٨ %䀦@ ݀`\2N@N` ^ ,2N@`@, $2N@N` <2N@M"`@@  2`*`:  ."` *"` /"` >"` %@L 4,haX@ @)n ;@8@8hax@ha@ږ @)U ;@8hO@aiha@Ė @)? ;Oh@aȐUhaД@ @)+ ;OhO@~aȐAha@5H   `h@ob2hb@  hb@ 5@) + "/ ,w +,sO`'  M `"@J  , 2 @8  @ hh@.b(hb0@4   `h@b@hbH@4     ڲ`h@ bPВhbX@4ה  2 `Ȳ`h@bh@?ۑ* : `Nj *` DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDLDDDDDDDD,_,@M" `` `,@" ``N@ dh`D@-"p>,3 d,- .,' s`N@ 1 2 $' 2耣 2N@`2N@,r r,n $N@ ,c i,^N@ ܲ`N@ #@ @㿘  2 @yS ,&  2 @yL N&    @yE&x&   * +$  ?* &2  * " " H㿘 @U!, @{ؔ!,@-ے㿘! H@| H @/ ܐ H@@  H$ H1ܰ HOut of memory?c ??ܐ H? "  + @ ?"" "" !  #?ܖ H?#@ " "@"@`  #@x`H $ k@- !`H@{q`H ?  ?$+ @   " 2  "   "@  !+   ?#@+ @2 " "   `H  ( 2 ( +$` ?` *P  0 " 0 &$`  `*   "  $`.㻘@W 6 ` # 2?@ @@Һ / "@*k#7@; ?xph`XPH@80( xph`XPH@80OTxrOTptOTNLOTMTOTncOTnsOTbslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambwhP8(hP@(hX@0 pX@return_does_clr_eolhas_hardware_tabslinefeed_is_newlinegnu_has_meta_keyno_correctly_working_crcrt_no_scrollingbackspaces_with_bslpi_changes_rescpi_changes_ressemi_auto_right_marginrow_addr_glitchhas_print_wheelcr_cancels_micro_modecol_addr_glitchhue_lightness_saturationback_color_erasecan_changenon_dest_scroll_regionno_pad_charnon_rev_rmcuphard_cursorprtr_silentneeds_xon_xoffxon_xofftransparent_underlinetilde_glitchdest_tabs_magic_smsostatus_line_esc_okover_strikemove_standout_modemove_insert_modememory_belowmemory_aboveinsert_null_glitchhas_status_linehas_meta_keyhard_copygeneric_typeerase_overstrikeeat_newline_glitchceol_standout_glitchno_esc_ctlcauto_right_marginauto_left_marginxph`XPH@80( xph`OTknOTdTOTdBOTdNOTdCOTugbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcolsp`P@0 xhXH8 xhP8number_of_function_keyshorizontal_tab_delaybackspace_delaynew_line_delaycarriage_return_delaymagic_cookie_glitch_ulbit_image_typebit_image_entwiningbuttonswide_char_sizeprint_rateoutput_res_vert_inchoutput_res_horz_inchoutput_res_lineoutput_res_charnumber_of_pinsmicro_line_sizemicro_col_sizemax_micro_jumpmax_micro_addressdot_horz_spacingdot_vert_spacingbuffer_capacityno_color_videomax_pairsmax_colorsmaximum_windowsmax_attributeslabel_widthlabel_heightnum_labelswidth_status_linevirtual_terminalpadding_baud_ratemagic_cookie_glitchlines_of_memoryinit_tabscolumnsh`XPH@80( θΰΨΠΘΐΈ΀xph`XPH@80( ͸Ͱ͈ͨ͐̀͘͠xph`XPH@80( ̸̨̰̠̘̐̈̀xph`XPH@80( ˸˰˨ˠ˘ːˈˀxph`XPH@80( ʸʰʨʠʘʐʈʀxph`XPH@80( ɸɰɨɠɘɐɈɀxph`XPH@80( ȸȰȨȠȘȐȈȀxph`XPH@80( ǸǰǨǠǘǐLjǀxph`XPH@80( ƸưƨƠƘƐƈƀxph`XPH@80( ŸŰŨŠŘŐňŀxph`XPH@80( ĸİĨĠĘĐĈĀxph`XPH@80( øðàØÐÈÀxph`XPH@80( ¸°¨ ˜ˆ€xbox1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTmaOTkoOTbcOTnlOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtp`PH@0xhX@0 hP8 pXH8 xh`XH@80( ph`PH8( x`P@(p`P@0 ph`XPH8(phXH8(p`P@0 ph`P@0 xhXH8(xph`XPH@80( xph`XPH8(߰ߨߘ߈ƘƐxhXPH@80( ްޠސx`P@0ݸݘ݀hP8 ܰܘ܀hP@0 ۰۠ېx`H0 ڸڠڈxhXH8(ٸ٨٘وxhX@(ظبؘ؀hP8(װט׀hP@0 ָ֨֘ֈxhXH8(box_chars_1memory_unlockmemory_lockacs_plusacs_vlineacs_hlineacs_tteeacs_bteeacs_rteeacs_lteeacs_lrcorneracs_urcorneracs_llcorneracs_ulcornerarrow_key_mapother_non_function_keysbackspace_if_not_bslinefeed_if_not_lftermcap_resettermcap_init2set_pglen_inchset_a_attributesenter_vertical_hl_modeenter_top_hl_modeenter_right_hl_modeenter_low_hl_modeenter_left_hl_modeenter_horizontal_hl_modealt_scancode_escscancode_escapepc_term_optionsexit_scancode_modeenter_scancode_modeexit_pc_charset_modeenter_pc_charset_modedisplay_pc_charset_page_lengthset_color_bandend_bit_image_regiondefine_bit_image_regioncolor_namesbit_image_carriage_returnbit_image_newlinebit_image_repeatset_tb_marginset_lr_marginset3_des_seqset2_des_seqset1_des_seqset0_des_seqcode_set_initdevice_typepkey_plabset_a_backgroundset_a_foregroundget_mousereq_mouse_posmouse_infokey_mousechar_set_nameszero_motionthese_cause_crsuperscript_characterssubscript_charactersstop_char_set_defstop_bit_imagestart_char_set_defstart_bit_imageset_top_margin_parmset_top_marginset_right_margin_parmset_left_margin_parmset_bottom_margin_parmset_bottom_marginselect_char_setparm_up_microparm_right_microparm_left_microparm_down_microorder_of_pinsmicro_upmicro_row_addressmicro_rightmicro_leftmicro_downmicro_column_addressexit_upward_modeexit_superscript_modeexit_subscript_modeexit_shadow_modeexit_micro_modeexit_leftward_modeexit_italics_modeexit_doublewide_modeenter_upward_modeenter_superscript_modeenter_subscript_modeenter_shadow_modeenter_normal_qualityenter_near_letter_qualityenter_micro_modeenter_leftward_modeenter_italics_modeenter_draft_qualityenter_doublewide_modedefine_charchange_res_vertchange_res_horzchange_line_pitchchange_char_pitchset_backgroundset_foregroundset_color_pairinitialize_pairinitialize_colororig_colorsorig_pairuser9user8user7user6user5user4user3user2user1user0wait_tonefixed_pauseflash_hookquick_dialdial_phonehangupgoto_windowcreate_windowremove_clockdisplay_clockset_clocklabel_formatset_right_marginset_left_marginclear_marginsclr_bolkey_f63key_f62key_f61key_f60key_f59key_f58key_f57key_f56key_f55key_f54key_f53key_f52key_f51key_f50key_f49key_f48key_f47key_f46key_f45key_f44key_f43key_f42key_f41key_f40key_f39key_f38key_f37key_f36key_f35key_f34key_f33key_f32key_f31key_f30key_f29key_f28key_f27key_f26key_f25key_f24key_f23key_f22key_f21key_f20key_f19key_f18key_f17key_f16key_f15key_f14key_f13key_f12key_f11req_for_inputkey_sundokey_ssuspendkey_ssavekey_srsumekey_srightkey_sreplacekey_sredokey_sprintkey_spreviouskey_soptionskey_snextkey_smovekey_smessagekey_sleftkey_sickey_shomekey_shelpkey_sfindkey_sexitkey_seolkey_sendkey_selectkey_sdlkey_sdckey_screatekey_scopykey_scommandkey_scancelkey_sbegkey_undokey_suspendkey_savekey_resumekey_restartkey_replacekey_refreshkey_referencekey_redokey_printkey_previouskey_optionskey_openkey_nextkey_movekey_messagekey_markkey_helpkey_findkey_exitkey_enterkey_endkey_createkey_copykey_commandkey_closekey_cancelkey_beglabel_offlabel_onena_acsxoff_characterxon_characterexit_am_modeenter_am_modeexit_xon_modeenter_xon_modekey_btabplab_normacs_charschar_paddingprtr_nonkey_c3key_c1key_b2key_a3key_a1init_progup_half_lineunderline_charto_status_linetabset_windowset_tabset_attributesscroll_reversescroll_forwardsave_cursorrow_addressrestore_cursorreset_filereset_3stringreset_2stringreset_1stringrepeat_charprtr_onprtr_offprint_screenpkey_xmitpkey_localpkey_keyparm_up_cursorparm_rindexparm_right_cursorparm_left_cursorparm_insert_lineparm_indexparm_ichparm_down_cursorparm_delete_lineparm_dchpad_charnewlinemeta_onmeta_offlab_f9lab_f8lab_f7lab_f6lab_f5lab_f4lab_f3lab_f2lab_f10lab_f1lab_f0keypad_xmitkeypad_localkey_upkey_stabkey_srkey_sfkey_rightkey_ppagekey_npagekey_llkey_leftkey_ilkey_ickey_homekey_f9key_f8key_f7key_f6key_f5key_f4key_f3key_f2key_f10key_f1key_f0key_eoskey_eolkey_eickey_downkey_dlkey_dckey_ctabkey_clearkey_catabkey_backspaceinsert_paddinginsert_lineinsert_characterinit_fileinit_3stringinit_2stringinit_1stringfrom_status_lineform_feedflash_screenexit_underline_modeexit_standout_modeexit_insert_modeexit_delete_modeexit_ca_modeexit_attribute_modeexit_alt_charset_modeerase_charsenter_underline_modeenter_standout_modeenter_reverse_modeenter_protected_modeenter_secure_modeenter_insert_modeenter_dim_modeenter_delete_modeenter_ca_modeenter_bold_modeenter_blink_modeenter_alt_charset_modedown_half_linedis_status_linedelete_linedelete_charactercursor_visiblecursor_upcursor_to_llcursor_rightcursor_normalcursor_mem_addresscursor_leftcursor_invisiblecursor_homecursor_downcursor_addresscommand_charactercolumn_addressclr_eosclr_eolclear_screenclear_all_tabschange_scroll_regioncarriage_returnbellback_tabxph`XPH@ 8 0 (   !x"p#h$`XPH@80(      .xph` DXPH@80(   I   xph`X P!H"@#8$0%(& '()*+,-./01;2L3456789b:;x<p=h>`?X@PAHB@C8D0E(F G=HIJKLMNOPQRST7UiVWQXYZ[x\p]h^!`_X`PaHb@c^8d0e(f ghijklmnopqrs3tuvwxyz{x|~p}h~`XPH@80( xph`XPH@680( F          P       xe p h ` X P H @ 8 0 (    H                   x p+ h ` X P H @  8! 0" (# $ % &  ( ) * + , - . / 0  2 3 4 5 6 7 8 x9 p: h `< X= P> H? @@ 8A 0B (C D   F  G  H  I    O L     %       x p h ` X  P! H" @# 8$ 0% (& ' ( ) * + , - .E / 0 1 2 3 4 5 6 7 8 9 : ; x<N p= h> `? X@ PA HB @C 8Dp 0E (F G H I J K5LM/NOPQRSTUVWXYZ[Xx\p]h^|`_X`PaHb[@c8d0e(fW ghijklmnmopqrstuvwxytzx{p|h}R`~XPH@80( !%&'"# ()$%&x*p+h`XPH@80( <ybox1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTxrOTptOTmaOTkoOTknOTdTOTdBOTNLOTMTOTbcOTnlOTdNOTdCOTncOTnsOTbsOTugOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcolslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambw|P `X,(L0tT\@@xdp|$p<DX4<0$H4hx`8D |T@`Dh0THT<Xt h8t``0d |0 PH(T(`@hXPd8ttl8(L,H44d< xPL4d  lTL4`|,4tdDh$X(8\<T , DLH0xPl(d|$pxp $(X0\(@lxX<4Lpp$|J`JXJP`XPH@ 8 0 ( JH J@J8J0J(J JJJJIIIIII I!I"I#I$IXIHI80II   I Ix IpIhI`IXIPIHI@I8I0I(I IIIIHHHH HHHHHHHHHH H H H Hx HpHhH`HXHPHHH@H8H0H(H HHHHG G!G"G#G$G%G&G'G( )G*G+G,G-.G/G0fG1Gx23Gp4Gh56G`7GX8GP9GH:G@;G8<G0=G(>G ?G@GAGBGCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFxTFpUFhVF`WFXXFPYFHZF@[F8\#F0]F(^F _F`FaFbFcEdEeEfxEgEhEiEjEkElEmEnEoEpoEqErEsExtEpuEhvE`wEXxEPyEHzE@{E8|p}h~E0XE(E EEEEDDDDDDDDD%DDDDuDDDDxDp~DhD`DXDPDHD@D8D0D(D DDDtDCaCmCCCdC CCvC`CCWCCCCCCxCpChC`CXCPCHC@C8C0C(C CCCCBBBBBBBBBBBBzBBBBBx.Bp'BhB`BXXBP(BHB@B8/B0B(B BB5B6B7A8A9A:A;A<A=A>A?A@AAABADAEAAAAxApAhA`AXAPAHA@A8A0^A(A AAAA@ @ @ @ @ @@@@@@@@@@@@x@p@h@`@X@P ` X  P! H" @# 8$ 0% (& ' ( ) *@H+@@,@8-@0.@(/@ 0@1@2@3@4?50?6?7?8?9?:?;?<?=?>???@?A?B?C?Dg?xE?pFh?hG?`H?XI?PJ?HK?@L?8M?0N?(O? P?Q?R?S?T>U>V>W>X>Y>Z>[>\>]>^>_>`>a>b>c>d>xe>pf>hg>`h>Xi>Pj>Hk>@l>8mC>0n>(o@pU> q>r>s>t>u=v=w=x=y=z={=|=}e=~f=g=h=i=====x=p=h=`=X=P=H!=@%=8&=0'=("= #==> (=)=$<%<&<{<*<+<<<<<<<<<<<=<;:9876543210/.-,+*)('&%$#"! ^_^^^]^\^[^Z^Y^X^W^V^U^T^S^R^Q^P^O^N^M^L^K^J^I^H^G^F^E^D^C^B^A^@ * $OpenBSD: kvm_file.c,v 1.2 1996/05/05 14:56:58 deraadt Exp $can't read fileheadcan't read kfpinconsistant nfiles`(0 ((@   )((?Ģ`"@Ā` 0( @@ m 0 0?В`0@` 0   @ kvm_getprocskvm_getfiles_filehead_nfiles%s: no such symbolcan't read nfiles`( L '' '  Ę @E ?2(('(`2(0@̐ &((Ā :((@&((((  Ę Ě ((@E&(0?Ā8 ((8@xd '  Z@ X@ '`0!H'!X''@      2 @+`7 Д@ Ɩ  @x) ` *` *  ((`'Đ@a  &(((0 :((@&(((( Ē&(0 '&(($OpenBSD: kvm_proc.c,v 1.4 1997/02/26 16:46:33 niklas Exp $($ 2 ` ( @. J&($`  $@ r 8 8?Ȁ ̀Ѐ Ā1 ȢpԐ& @W @ P L L @  ? @? ( @*=$&($ _vm_page_buckets_vm_page_hash_maskp!'!''@ AЀ 2?ؔ(T@   2 ?(X@   ? h(T 2( ڐ 2A?( @:4 (X@ @ (T*`@  20?(  `@ ݖ ( (䀢    @C( ?2 ( 2( ?   ?($@B( ( ? BUG BUG BUG BUG: object %x offset %x pgoffset %x pager %x swpager %x osize %x bsize %x blocks %x nblocks %x sw_blocks[%d]: block %x mask %x X`(@   2~?䀢 2z?@ }  2r?`,Ĵ@9*` ̀Ȁ&/@C#`,`(#@;& @4#Ƞ 6M?3 ̓, @ M "`@ Ƞ 7?,  @ :  2/?Đ@)8*` ( @9n:@`2(    *      @B(?2(2( ?($@B!( ( ? can't read proc at %xnprocs corruptcan't read pgrp at %xcan't read session at %xcan't read tty at %xcan't read tpgrp at &xР 680@ז!!Pk@X@˖  `Xp@Ö P`t``0 0`\@ h?'P@  8xDH N'T'@7 D'X ,$`)8@ $'' @m   @°?0AH'?'?' @ 'ؐ`'`@K P@F 7'7Ԁ`7Ҁ`0X  0@)!P!@)!" H8cannot read allproccannot read zombproc㿐(@     @  @M?0. + #+ #+ @ '@ & kvm_getprocsproc size mismatch (%d total, %d chunks)_nprocs_allproc_zombproc%s: no such symbolcan't read nprocsP( "(@>}&(( < '' '''   @B ?@F &(  @B ? @] "@'  @Ԙ"O @7"G'#H'#P'#`''ܐ@     2 @p( @H  @ *@ *`"@ *`"@ *`@' &(̐ؒ'&(㿘( @=&(out of memory㿘@= @h㿘E?=#8 (4 2 (8` & &(8@*`&(4* &&(8(4Е*&(4 " (( 2 (,( @ &((( &(0(, 2 .( @~  &(,.(4@"((l  (4d`"`$( @ (,@є( (  @(,"'4 @' $ (0@ *&(0((r &(((4@ "@ "@`@*@  @?Ҕ@$ $ $ (4@& (42 $,$ *$(4"@ " "@ "㾐@B!! 0 @ O 2 N- " p!"x  ' ' 'ؐ ܖؘ @@ $"xN`- $"x @:  ԟЀ  h  a  㿘(㿘<invalid address (%lx)㿐 %L   @%  @'D&$OpenBSD: kvm.c,v 1.17 1998/10/28 19:47:00 marc Exp $ %s: 㿘'P'T'X`P!M H@ےcؐ@H @F0 (@: %s : %s㿘'P'T'X`P#M`H@cؐ@( # !@A P@0 (@Ö@? #  ($@ !@+ X@㿘@;   # @@Lseek㿘! $# @? ?  # p??Read㿘! $# @>* # exec file name too longbad flags arg/dev/mem/dev/drum%s%s: not physical memory device/dev/kmem/bsd/dev/ksyms8&(?&( &(&(&(@&(&( &($&((&(,&(4&(P&(T&(<&(@&(D  ` >(H@>#"H`?``"p"@ D #&( @69 <  T`@ bp  p`"@ #  &(``@   &(Q``"@?O` @  ?-&(`D"@  ?>&("Ȑ@  ?6&(@  ?&(`"@ ג ?&("Ȑ@ ϒ ? &( `@ @  ` @X'@: x(   ՘ ?"?(  2??###ʒ @2?2 # 2? }? &(<"@"`"` (  ?"X(<(   2Q(<## @@2J(<2` 2F(<&(@q ;&(D ( { ?2( "0(<( (D䀢 2'(< ( e ?"(<( y  2(<ؠ @2 (<2` 2(< >(H(< "(D@:M&(<(D @:F&(D&(@already has a dump headerdon't use on live kernelinvalid magic in cpu_hdrinvalid size in cpu_hdrinvalid dump offsetmissing header㿐(< ?( ?(  ?"}?(   2v??c##ʒ @2 #  mb &(@ L&(D( `D Ř ?2( "A(<( (Dؐ  1(@ ( `>`@ D >(H?   &(< 2`(< 2(< ""(<c@" 2 (< 8(< "(D@9&(<(D "?@9&(D&(@?clear_gap㿘   ? @M?  no valid dump header(s)kvm_dump_wrtheader㿐(<`(D   Ӕ8V?  @i' I(<`”??F##'  (@  ?@i' 2(<` ?"/?(D (@@h !(@ " ?##''  @h  (<` ? ?P?㿘@8(`  ".  @# @C' %s: %s 㿘@8(` 2" #M # `H!@Ơ"`@3  " 㿘( &(@;&( &(@; ( &(@;( &(@;( "(P @(P "(D@(D &(@@8(< "(@8( "($@8z($ "((@8t(( "(,@8n(, "(4@8h(4 @8b@8` %skvm_%s.db/var/db/file %s is incorrectly formattedinvalid argument to dbopen()unknown dbopen() errorVERSION_version@c?#$8@H   @ !&( # " O b XX??0M ' '(  2:( 5􀢨2@" ' '(   2"(` 2( @" ? @2 (@ 2( ( @&(?bad namelistsymbol too large㿐(  (@OԒ?O &0I C?@31`J@ ,$@:ِ ''$@(   2 `"  2  ` @"  @"   Ԣ` $* . . .  > &clearing dump on live kernel_dumpmagcannot invalidate dump - lseekcannot invalidate dump - writex( = ''y? /@c܀ +# $c ( @%   @: ?2'܀2 'c  '( @9    x?invalid address (%lx)kvm_readshort readno valid dump header㿐( /# $c    @9 ?2(2(c   D_?(@8   V0Q?O.@0I(< (D  P;? :p5$@40/$@,% @ʔ ƀ8@$  ( @9k ?2 ( 2(  א( @8 &֐"$@@ٲ@$@kvm_writeshort writekvm_write not implemented for dead kernels㿘( /1 &#    @90 ?2(2(#   ?(@8I   Ŕ`? p0?$OpenBSD: kvm_sparc.c,v 1.4 1997/06/11 10:32:16 grr Exp $_kvm_freevtop: internal error㿘(P s&(PUnsupported CPU type㿘(D;` ""L &(  "b ` &(   "bM(?( @/"b 㿘;"L? ;Ӑ ;?"L @@Zinvalid address (%x)㿘=#@:(D6`6` `??*  *    ,  ?&"@.+ ;bL` >` ?@>` * ?( *b@ *  &(  &  Pܖ cannot read pte for %x㿐=#@K(D6`6` `??*  *    >;"L?  >`  >` |@ @8 2( . (   @8 ?2(  ( @7L   `   ( * ?@&(  " P| 㿘(D     !   28@ B 8`2@ ` @ D` (H @F@ F@ f 0  P>??㿘;bP   "P $"P?"P "P㿘 "x "x`   `   "x, @?, @ a#㿘b  "b : :  :*2@    &  @      㿘  ?  b    =  b   S @ & F` @  & & `@ & :`  @-?   € @` €  ` : @ & F` @  & & `@ & :`w ?p #@? ?#   2@   @2 "@  T R . 3 + 6 . 6  .   @ "B ` @  ""€ `@ ":` ;  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@82        b 㿐;p? )@  0?@ `㿐;?;  0cB;7ąB'B' @      . @C ` 6`@ 6  @ @8@;?&';7ąB'B'   @ f0;7F'B'   @ F: #dd< B#dd B`<BD# 2  2*2@   㿐  ?  b      b   W $ D`  $ $ `$ : 8 @+^    @`  ` :  $ D`  $ $ `$ : ` ??#@? ?#   2@   @"@  ` d`a^. 2 @* 4 , 6 @.   "B `  ""€ `":  :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ `@`@ b` d, 6 @4 <@  b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@)@)㿘S @ & F` @  & & `@ & :`  @)   @ € #@ C@ `@ €  #@ #@ @ ` #@ :  @ & F` @  & & `@ & :`w ?p #@? ?#  !2@   @2 "@  T R . 3 + 6 . 6  .   @ "B ` @  ""€ `@ ":` ;  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@82     㿘  Ȕ@4 㿐' `v@2'㿐`w@2 ?㿐` ``   ' "c ? `@2㿘`^@1 " (" $ " ( " $ ? " "  ?g"  "  ( $$OpenBSD: swab.c,v 1.3 1998/02/10 02:19:48 deraadt Exp $2":J  *@ `*@`: DJ  *@ `*@J  `*@ `*@J  `*@ `*@J  `*@ `*@J  `*@ `*@J  `*@ `*@J  `*@ `*@J  `*@ `*@`$OpenBSD: strspn.c,v 1.2 1996/08/19 08:34:26 tholo Exp $  ( + 88 " ( "$OpenBSD: strsignal.c,v 1.2 1996/08/19 08:34:25 tholo Exp $㿘@]b$OpenBSD: strmode.c,v 1.3 1997/06/13 13:57:20 deraadt Exp $< 1 b(+ c" ?$*@ ?*@ l0  ?*@ 8  ? *@  d - s p w*@!` r -*@ ` w -*@ (@@` 0 @ 0  - x S s*@`  r -*@ ` w -*@ $` 0  0  - x S s*@`  r -*@ ` w -*@ " `"   *@ "   *@ - x T t*@` *@*`$OpenBSD: strlcpy.c,v 1.2 1998/11/06 04:33:16 wvdputte Exp $㿘@1^N@ "*@" *@` N *@&$OpenBSD: strlcat.c,v 1.1 1998/07/01 01:29:45 millert Exp $㿘 J  " J " 2 N@1# *N *&$OpenBSD: strcoll.c,v 1.2 1996/08/19 08:34:13 tholo Exp $㿘@H$OpenBSD: system.c,v 1.3 1996/09/15 09:31:52 tholo Exp $sh-c/bin/sh㿀#`'#h'' '5 '@Y@['?  @Yp$?@Yl b#p@@1 @/f  @/b @u/ @YV @/W @/T??$OpenBSD: strtoul.c,v 1.4 1996/08/19 08:33:52 tholo Exp $㿘M" @  ` - +L@ @ L@` 0 L@ x XL` `? 0  ?@&z?@< 3M/  "b    ? ?ɐ?8?  ?%  @% @ۢ`4  '$OpenBSD: realpath.c,v 1.4 1998/05/18 09:55:19 deraadt Exp $./8 !"@x ".@ `.`@#.c@ / @` "Ȓ@(*`J@ /"*`@ZU c @Z #< (@2   >K"c @.# &E .@@ @Z- :"А@:@$ 0 N@ / N``?O @/@/ $  ?"c @ՒbȐ@Ғ@Yː   # @.  # @Y@. "#  $OpenBSD: rand.c,v 1.6 1998/12/07 21:47:22 millert Exp $㿘q@$bm `9 &1 *㿘= $= $$OpenBSD: radixsort.c,v 1.3 1996/08/19 08:33:44 tholo Exp $㾘    +@  * $*        "c ?@B  㾘2  `* @ `* ``$*      "c ?`  @ @+i.`  ? @@+ ?@"@$ $  @%)/㐢 ?#@?#?    @M? *) %#@@ +  `  "@#&%# $*` *  ^?  㐑*$@&##* `   "  $ #?# "* @& ? $$@@"`"`   @ ` ` " @ +   & +  *  $ ?@ j??"$ $  %+/㘢 ?c@?#?     @? - %c.  *    "@" ?c&%c $?:*` *  e? ` ?c*$@%㘘. $%#c* ` @ "`@ $ ""@`  *#@$#@`? $$@@""##. #@@   ?@#.  @ *` $ "?:?@ `?㿘% "@ 2 `@ : @ @!@?`ۀ$OpenBSD: heapsort.c,v 1.2 1996/08/19 08:33:32 tholo Exp $㿘`  "c ?@) 6`?&-`8*@"s  @"d $ ,- ,ܐԪh`@"F @,` @"; @,`  " @"+  @" @,` ,4: @"@"   @,`  ` @,` ڦ`@)) $OpenBSD: getopt.c,v 1.2 1996/08/19 08:33:32 tholo Exp $%s: illegal option -- %c %s: option requires an argument -- %c 㿘 bX  == DJ %!== @ "bX*@="DJ@ -"J`=!X"`Dz? `"DJ` - !=# @!X"Dk?!= DJ# $`L `:$ D@ 2J `L- DW?J ==`@ "`@= < J ?N :FM H8.a` :   D"#,J@ 6 =`@ 0"`@ DJ@ " =`@ "`@!X$ DN := : <   8a`LM H@ ?* @ "#,=aX=@"D "@  L$OpenBSD: bsearch.c,v 1.2 1996/08/19 08:33:26 tholo Exp $㿘>@!@   $>>> $OpenBSD: atol.c,v 1.2 1996/08/19 08:33:26 tholo Exp $㿘 @( $OpenBSD: atexit.c,v 1.2 1996/08/19 08:33:22 tholo Exp $㿘1 "􀢠2# $ @' " ?""&" *`" `"㿘L#@ה㿘 @? @͎㿘  @͆  x@+1''b8' ' '' 'L#@o耢  ?㿘'L'P'T'X@L㿐@  @= # 2V @V   6  ?`" @ V  @  " @ @L!  # ?逢     @ @:! # @"  @  "& @'` & & && &  0` &  @@"& 0@'Q & 0 D & 4@'J& D`& H6  "# &  @ @ &6 @)6 6 &  & $!4& ,!& (!`&   @( 㿘` ` 2 `@   "c ?`?` &``@ , :   @ * &@@J㿘`? "`@  "@@ʐ $OpenBSD: getrpcent.c,v 1.8 1997/09/22 05:11:07 millert Exp $㿘1 #̀  @,$&#́㿘  @3 @[  @?㿘@" @J @B   @7   0@r㿘  ="@̓c$@ $ 㿘  `   @ $㿘     ="@hc$   @V# " @)@# 㿘j  R @Ԙ$.$ ,N #@ʜ`  .@@ʕ`Ȳ 2.@6`& N@ "` "`@˨&  & #@{`Ȳ "$.@``"$ N@    $ @d`Ȳ .@``2N@$ $OpenBSD: auth_unix.c,v 1.11 1998/12/20 23:45:41 millert Exp $authunix_create: out of memory Т@% ( KM@%! E="$& & $ #$ # $   $ &  H&   & @$ '''''0PH!'@W @H 24@&6 @$  $@%^ $ @(& &  @& 0M H@bx @'!?! @/@Rޢ @R    x* #@ x㿘  $ a`㿀@(` $`@   "@%)$  @أ "' & &   @ؗ$ & &  & @f `$ @2 8  $ ''   @׺@ @ђ 'ؐ'€ @   $ $ @1"  '@ `@㿘 $@$   @$@$ $  @$@$auth_none.c - Fatal marshalling problem㿀 $! @d`@  @ 2 @d"  @$a  `@`    $   @@ @'ʐ@: <  " ` &@  :>(` :`?? @ D8 >` >  >>  `` "`@#`  @#~㿘+>/-#;$ . @@  @   ,@ >$,@ ,@ , .@ @Ƥ @" @" @'@"@;@"]@"@@@@ @@?@ a[@ޘ@ט?@˘  5@@? .@ ?@" .@ .@  "  &  :+  :  &  :+  :& 㿘 >% # #M"$ё. @"6@@"@ @ @ @B @ @ @"@" &@D(@"g  ~, N@: @`| u` * n@  `j @2   "~ @:_ N @   "p@ :R N@ 2N  eH  @2    @:  N 2  2  @(1 @  2+ `_"(  @:$ %@@   @ :  N@ 2  2  @:  @@  2 `_"  @( @  `_` . .@  `1`2@ް ܰ .@> @P@"Y@>0@"U 0@>@>0@[0, , @`?2 ` ?"  ,    "@ &@ @+@ 2  . @. 2@ƶ 2{>,  /`` " /` @" >, &  2^c ? %$ #" 2I .@ <.@ .@ ", "@; , ;e 2!  :, "@; , ;M "   : 㿘 @ N *   @<-M  @ N@"   2       ,    `    `   0  "` ` @? `  @ ` _  @ ` 2 _    `_{`    {_  { @ 2  @ @`s& 2  `㿘  0@ N *   -M@ @ N@   2       ,    `    `   0  "` ` @U? `  @ ` _  @ ` 2 _    `_{`    {_  { @ 2 2 @s`㿘 ډ( >)' %#!$+@ @"&@"i @J((@J@N?~@ @V @@@n@ (@_@ꀠ@@   @["@q&@(@ v82rm  2kf8fa 2a\2]X4YT (Q `"KF(10>"<  6((/(()("((@   5>3$@(@2(((@ ((5) `    $   @@ @!ΐ@: <    ` &@  :>(` :`?? @ D8 >` >  >>  `` "`@[` @U@S`$ 㿘+>/-#;$ . @@  @   ,@ >$,@ ,@ , .@ @Ƥ @" @" @'@"@;@"]@"@@@@ @@?@ a[@@?@  5@ט@И? .@ ?@" .@ .@  "  &  :+  :  &  :+  :& 㿘 >% # #M"$ё. @"6@@"@ @ @ @B @ @ @"@" &@D(@"g  ~, N@: @`| u` * n@  `j @2   "~ @:_ N @   "p@ :R N@ 2N  eH  @2    @:  N 2  2  @(1 @  2+ `_"(  @:$ %@@   @ :  N@ 2  2  @:  @@  2 `_"  @( @  `_` . .@  `1`2@ް ܰ .@> @P@"Y@>0@"U 0@>@>0@[0, , @`?2 ` ?"  ,    "@ &@ @@ 2  . @. 2@ƶ 2{>,  /`` " /` @" >, &  2^c ? %$ #" 2I .@ <.@ .@ ", "@; , ;e 2!  :, "@; , ;M "   : 㿘  ( , 0@ N  @5M , @m `@ @ N@`@; "   2       ,     `     `   0  "`` @"? `  @ ` _   @ ` 2 _    `_{`    { _  {  @ L @@i``@c@Ța& L  `㿘  ( 4 0@ N  @5M ,  @ @ N@   2       ,     `     `   0  "`` @f? `  @ ` _   @ ` 2 _    `_{`    { _  {  @$ L 2`@ @@``@a㿘>'% !#$+@ "@&"s J.`(ԞLR?~˞Ä@ b @ "y@ @p@ꀠ @  k"@&(# 82@  2@z8z@s 2s@l2m@f4g@`@(]  "W@P @@ @. @@O@ E/@("B = @. @@@@2/@O@"/(@   5> $@(@@@ @. @( "@@@/@@@(`㿘<"e@  @4"E@2 `( "`    "  j a*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x` >@3 ="` " !   !" @ݐ@a(@M @Z*?0%d㿘="` " @  "  2 @yb1Ͱ"0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL(    " @]@ې!S 4u *`  $`@Б* $` $`@g $`$@@$`$`$` " " H``  !$ $ $ $ $ $ ($ ,$ 0$ <$ @$ D $ 4 $ 8 P @;!$ H@  `?$ @:  @f @v @  `@ H$ $@ @ @ r$ L4"E$< D"e& & & ( @ؒ ` "`@EH`㿘  @  @: " @H @:  @`|*` 2@  @&J@ |!` &  "@ P  @ 1" @ o" " @ &   @ a"  $@ "㿘   &?ܑ* : `X А!(*` CDDDBDCCDDDDDDDDDDDDDDDDDDDCDDDDDDDDDDDDDDDDDDDDDDDDDDDDHDXDC|DDDDDDDDDDDDDDDDDDDDDDDDDDDDDC @ @   D`" D  D ,  " @ @J@ ) ) ,  " H@} J`)^&@Ւ Z@k  `( "`( `, K"`,@]  `( "`( `0 >"`0@ :@ 5   @, @> '@# @ @  @`& @  @Mb  @ , @:` @  @?֐ , :  ? {ϐ`  `Mb  ` &@X , :  +"% ? * ) {G "@ @ה" "@   "@ @"i "@Ҕ  @" @" "@   @$@ I@  J ,& Mb   !@@@ @8 @J@ }2 `&@ J@ }`@ & @ @ @  @  @?֐ , :  ? {`   `Mb  @ 㿘 @ @ @& *J㿘   @ J@ ^2@&@ `("`( `,"`,  `    JJ `@!   `  @&  `( "`( `0 "`0 @: 㿘J@ ``\ & @ @*  a &a)xa{`." `[`*`0 a(&0 a}a9a1 ~a?Z0|  @Dx @ s@?o@ k  D`" D  D ,  " @z @ `  J@ \J` ) \F ) ,  " H@\ @ ` J@ \ J` )`(&@ $, `H @;` `H@ `@2 @    "`H@ @ ~ @:"J@ *2`& "@+ @ " "@ @"v  @ n` l`$J@ \h`$J` {d`$`&@e  J , & Mb  !@N @2 !@ @ `  @ J@ \ @ J` }@ `(&:@  ` : J@ \2J` }"   @ & @ @ @  `$  㿘@ `  Mb     .  * J?а #@      @ [:<:]][:>:]]㿘@  @   Ӓc@ޔ 2&   Ӓc@Δ  2 (@.  & @: J@ ^2`& @:J@ ]2 `&@ ` ] *] ` ] @:"J@ -2`&@ ` - *- ` -,` `  J@ -J` ]"@ @ :J@ ]逢@  @:J@ -2 `&@ ` - *- ` -,` J`]&@$   r ` ,`?,"` %M@ `   "?@* :  @ `  * ` ,`?<@` @-  ?, @ ` @" * * `" * ` ?,`   " ` @ ` *@* `?,`` @@  @@ِ@+0@I@L 㿘 @ J@ - [    * @ 0*:  : ="40e   &@ J - ]@{ @ @ @q  @  `  J@ :J` ]3`@^ 0o   &@U J - ]@K @ @ @A  @ ` J@ = J` ]`A&@+ 0<@  J -@ :J ] @ &J -& -@, : *`: @@ @`  * `   .`㿘  M" @  `@ &>  `"@@ 2` @J "@` @ @ 2`@ 0  L@`  * ` .` L   `@@ L 㿘@L =@` @ + `@.`㿘 @ @  @ ` :J@ [2 J` .2`$J $@ . @ ` J@ . J` ]`$@Q . > 㿘 @ @  ` : J@2J` ]"   @ &   >  `"@@V 2`@J "N``@   @ 0L@M @IG* : *`H㿐 && / ]//1&& 㿘  ` 8M"`   ː* : ڒ0@c`   `4, "`4㿐 &&  ^/ / ]//&& 㿘     .2``@`א *` \]]]^^^^^^]^(^^^^^^^\^ $" p&  "@!`   @" @<" "@   @3$@ 0K "@  @ޔ" @""@Ք   @$@̔ `@   "@ה @"0@l0@b0@  "" (""  㿘   "    I `& 4 @Y ``@ t,   @ ,  "`   @ f "`@   "`  `,  @0:` `@$ ` "  ``%@ @Ԕ    `-  < @ `, %@$ *. . & & `  (  @(*@   *` 㿘     *` *`   2  "    @`  @ @ @    ݖ  &@>    @ ` @" * :       @ ` @2  㿘`@ @` &`@   @  2 &` ` "&` @ &`  0 ?@~``  *? ,  8  `      ,  8 `      㿘  *`8? 2!`Ē "``4`  &`4, 2  ǔ 2,   ``ܤ㿘  @`@ .` *  @ . $ 㿘      `2`@:`*`@B  @ *`" `& 㿘  $ ߐ   , `  "` `H "`H `.   @@"@.* "    (@> "@㿘   @ .` 2&  0& 㿘 &`  @ Г*` &`  &`㿘  u >1)'%##$`"  @ "2 @ )`@"- @ ") @  `@" `@" @*  @  2`( @   @`@$ &`@ @ @2`@ $@ ,  &`<&`@ &`(`@`> @  @ *`*  ! > `  4  2`("`(%02x:%02x:%02x:%02x:%02x:%02x㿐   !> ##\ #`@a㿐 Mb   2  %M@ޔ @ J@: @`@  2.@".@ .@``ݠ 㿘`8ǒ 2%x:%x:%x:%x:%x:%x/etc/ethersr+ ethers.byaddrX@````#\`b@<#`@ ڐ#@c Y?@ 0K@̒ I̐ J? '̀@ ڒc̔ , ̔$@, @dȀ ݐڒc Ж@eB ҐĒ@ @ Fǐ@ @  @Ȑ @Đ  "c ?ethers.byname㺀@ |ڐ#@7c X?@ 0J@y쒒 H J? '쀢@ ڒc , $@s, @d'耢 ݐےa@dך Ґ@" @ǐ@ @r @^ @Z  "c ? 㿘̒ "% N   M"   2 N @7b`@.   "c ?㿘     @,?  !$ 㿘 `` >@"`$OpenBSD: rcmd.c,v 1.31 1998/03/19 00:30:05 millert Exp $RSHshelltcprcmd: socket: All ports in use rcmd: socket: %s connect to address %s: Trying %s... %s: %s %drcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s X'D'L'P'T@ g @ ܐ @ `(@ .``2 @DLPT@b ܐ @ `( -`2 @ LDPT @9 @ ?D@>C  D@9s? % @+MD`H@3 #'Ĩ@fİ  #ܐ`H@`00U@`H@`P0M @`@Y  / ` /7`` @E@k  @`@  0 =Đ?'2 ``4`@ó.`   @'Ԕ@ܒ`h$ @4 ``$``` @@'Ԕ@ɒ`0 @T@`Hܒ`@㿔0ܒ`@ n '@Ē @'` 2 ݩ* @  ِ@4P Ȑ @@ | @ K@ u @ # #M`H!@ @ㄒ@˒' $ @6 *  *  ` % 6`* * %   @x  :   !M H#@`Д@PM H@I`y@4?*@ ` @ @@ < 6'@ !M H#@a(@)['ـ  Mڀ#! M H@a@D@ L L@Ɛ@ P P@@ T T@@͔   #M# `HD!@!p@O @   @ O @2b@a0Ā @@@T@͐@2O?㿈@  / /'  @ &?`7@#47@ڔ   # 0 7@耢?$@@?@< 2 *?(  . h "  @@    . h"@  .   @< ް  ". ?/etc/hosts.equivr/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than owner8`  ސ"@ɒb  `@d @4[ @0 2V?? <  `"N?@QMG@i@%b(@_@2S@b @2L`1 @K!"8<  "PT`@$ "p` @" ޠ"  " H@ڐ?㾐?@p!)M+I@ "?L # " J `  `*   *J   ՐJ  / * J "   J    "   J  J   򀢀 *J  @* L + -L   @4`5  @ + @W%L   @0? @  @W @M` @HL + -L  @"$  @W`L  @2  @Ww @    ?@`?`"! "?  `$  ?㿐'D@: D  @b     2DD@'@ϐ`?rcmd: address %s not listed for host %s㿐'DD @;ޔ  "0 ! @@| , @: 2 "   @@ @ @aђD "1  &   2@!D!@n' @ %x.0.%x%02x㿐 !!@  7 7@yb@@ `  @` @ @@ -  @`b   @b(@Y`@1L 2  @"0@M`@*L@- 2 @?b(@ 1!@ J N υ(858B ( *   J ` H* *`@@ 1/@w #  #@q .@m :  *  . : . , tt'4hh4`4`4`  4`@:4` @B ` * @. `@* h6`6 `6 `6 `6 ` 6 %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dx N -#\bP@2y#!#\#`b`@2b!˔#\#`bx@2Q!b@2C@!L@ h @ D 0ӑ* :  KY`* tt||  ,@  ,@L@  @`"+ N 0"""#N L@ `" 4 @  ?,@?   @1,@?@1!@㿘`! @@f` 4  @$@}@/ @/`@&/㿘` @`@ @E .` dА  ?*`: ?А *`: ? `*`: ?   2    % ,  ?,@` ".`,@`  ,  ,@` ,@`@*$@` @$@.`.@㿘!    @ @ƒ  ` :,@? .!",   @` ` ` :`,  ,  , @ 뀤,1!㿘!` @ "А *`: ?А *`: ? *`: ?ɀ`2    , @((,@`  ,  ,@`,@`@*! $@ *!   *` .?X  *@ ` 8*` *@` *@` * *@!%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u㿈      !? !#\+(* #` @ #d  (@#h@c`@@ 1/@ #  #@ .@ :  `*` . : .`,@` $$ ', ,  ,  ,  ,  ,  ,  ,  ,  ,  , @F, `@J  * @:  @6  . .  .  .  .  .  .  .  .  . . . %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dx N -#\b`@/u#!#\#`bp@/^!˔#\#`b@/M!b@/?@!L@ h @ T 0ӑ* :  KY`*   ,@  ,@L@  @`"+ N 0"""#N L@ `" 4 @  ?,@?   @.,@?@.!@㿘`! @@b` 4  @$@y@/ @/`@&/ 2 0  2 0 * ?*@?*  @ ?*  `  ? (0?# @㿘 "@0@0   `  @ܒ  "쀢 @0㿘 "@0@0 ! @Đ `  @   20怦`  @  "쀢 @0n㿘"0ǘ/ 㿘 "p@0@1  @    @y   0 "p @0㼘 "̠ ?# $ ` @$  @ `"@""@"0"  B >@% 7@1 1/@ /   *  *    2@ &f @. `$@`@  ' ĀN`$@` 1C"0b0"b0:" b0  "b0/ J .  L .  2  J 02 "` @ " @ ``@*@ ``֖ @x"b<1"0  &   "c bf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpap  耊  @? @ "ؒ@獔 O؀ 2 a@9  J j f"`4c  b2` `2]  ` * 2$ ")  $$@Ō$@Ń$ $#\@p  @`$ &  "  2& "& 2    & @   ذ 㷈  耊   @? @B>"@ O耢  a@  L ' f4   b2 @$/  @`$ & Z     @  Ƞ  $L 㿘 "@/@/  @[    @P   0 "耢 @/㿘 "@/@/      "耢 @/LC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLPATH_LOCALE/usr/share/localeLANGC㿘@ ! 2 J@*"耢 $  J  ""` ؀`   Ց. 1@ ԰#!@ b@W ` N@ F !@ . @@ J@ `@ J@ `@# J@ . #. 'Р@  |,  @ ` ,@@ "J@ А@ ,  c  . "Р@ W, @m / 2L` !"@~ ,  D / `L` /"`L` P"А$@  ,@_,,N@ /`N@ /"``L@`/"N@`L@  @N@ ܐ$@ ,"в@  @M @H 2  2   @ %s/%s/%s/%s/%s㿐#c!@ @~ -?`` @6 " #\#`c `@@w``1耤 1#POSIX%s/%s/%s㻘,`"Р@@ܰ@ @ #@ c @c @<0$@ ,` @?` `㿘 .  .  p tA x | P@ . (>?/@  P . .  .  @. ((@? @*?    @ @../?$@  @@/..@7 @./$ -   +` AX  / /' '  '  '  A @ @ `@.` @@('@ `@.`"@(#$ @ Ȑ  +` AX " ' '    `"`x@.` @.`@'@ &' *'  / `"`|@.` @.`@'@` ``T PA.$ AXAض . P @ @ .  @" @ @(&@$ @   $ A  `t t p    p "p*2`㿘  @ 3a3*3 c@3 +7`* #7`!7`#`.@  @ @  d  `+>)'~#!~ p (0 0 0 0.  ((( 0 ??@@@`0  .`@( 6 /@(  ( @@@  1 !2*2 c@2 * 6+!6c6# .@@   % @  @d,@   %㿈A!` yߐ/ / / / / / / /''.@.`.`.`.`.`.`.`㿘A!` 2C    .! . .! ."! ."!      &!  *! 0,0 a@ 0 (3 +3 a3 " $  &+  ( @ * !    "a@  , @@ b    j   .  /@x&.  , -'@5 -@5@ 2 a2 ! 2 *3 3 3  a +  /"@@$@ &@(*@ @@,.@ @$'@@"    l .  $&@ 㿐A!X*     *$ $*+㿐A!` jА  A ؚ #@    *  $  `` ?Ô A ؖ + +  * @ @ ,    㿘 s  s  .  .  .B  .   .A` . (>?/@   / .Ͷ . .  .  @. ((@? @*?     / /@A . @../?$@  .] . . A/..@7  .A0./$ - .   +` B / [ S/ Kန/ Cတ' '  '  '  B /@ @ @ `@.` @@('@ `@.`"@(#$ @ Ȑ  +` B . g c' '   .  `"`@.` @.`@'@ k' o'  / . `"`@.` @.`@'@` ``T  .B`.$  ?BB .  .͸ @ @ .  @" @ @(&@$ @   $ B   . .      "*2`㿘B! 2{    s! s s! s"! s"!   /!  /  k! /!@ o! cဧ0,0 a@ 0 (3 +3 a3 " $  &+  ( @ * !    ga@  , @@ b    j   .  /A &.  , -'@5 -@5@ 2 a2 ! 2 *3 3 3  a +  / /"@$@ &@(*@ @@,.@ @$'@@"    l .  $&@ 㿘   / /  / /@3 Ca3*3 c@3 +7`* #7`!7`#`.@  Kဒ@ @  d  `+>)'~#!~  .  ? /(0 0 0 0.  ((( 0 ??@@@`0  .`@( 6 /@(  ( @@@  1 S!2*2 c@2 * 6+!6c6# .@@   % [ဒ@  @d,@   %㿈B! "/ / / / / / / /''.@.`.`.`.`.`.`.`㿈N@ $BN` 1@9 @.! 2w * *  " ( 2 N@ _2iN`  N@ `z ``ŀ`Z  `@ˀ`9 `-4ґ*   N@ `z ``ŀ`Z  `@ˀ`9 `-4ґ* @N #! . ]   N   *` *"   2 N ! .!@ؔ , @7`z ``ŀ`Z  `@ ˀ`9`-  N@`z ``ŀ`Z  `@ˀ`9 `-4ґ*  @ .*N` `  *  +  C B2` 2`,2` ? 2`  `?,  , ?  ,1 .*  2 ?  ,2 ?  ,2 ?  , ?  ,!* 2 ?  ,2 ?  , ?  ,,  $OpenBSD: sigsetjmp.S,v 1.2 1996/08/19 08:17:45 tholo Exp $`O" (0 (`M0($OpenBSD: setjmp.S,v 1.2 1996/08/19 08:17:44 tholo Exp $  0 " 5H P """  """㿠   @" &  g @$OpenBSD: _setjmp.S,v 1.3 1996/08/19 08:17:25 tholo Exp $" " " @" `&"`@6 0`` M `2*` `  `  `  *`\ @*g` eЇ*`HHHHHḦ́͜TʹlHHHHHHHHHHHHHHHHHH \*  np* \*  rj* \*  bd* \*  a^* \*  vX* \*  tR* \*  fL* \*  sF* \*  0*Ѐ> * 9* ` @ \*  `00* 00*  `0"*` \*  M* M `   ^*`  ? *`@* -* * *㿘:`N@/@*``2`*"㿘 N@`N@8N@N@ *"㿈`2@ '`'''@̐㿘@㿘 s!   !  "#  /dev//var/run/dev.db@h @  Q# < I E " p.@p .` .`  x.`  .`   .`@ (P @ 7P'X '\X`'T`  2`d``@ "@``@  @@8@8 p   ,# @2( "@  `@ @[@ @@`@@ @  H @ D# c* ,  @麡, &c* ,  @鯡, & ?@Ւ (c* ,  @韡, & c* ,  @锡, & @X 2?c* .  @郱. ?ՐՈՀxph`XPH@80( Ը԰ԨԠԘUSR2USR1INFOWINCHPROFVTALRMXFSZXCPUIOTTOUTTINCHLDCONTTSTPSTOPURGTERMALRMPIPESYSSEGVBUSKILLFPEEMTABRTTRAPILLQUITINTHUPSignal 0 I @*`2``H@g" 8o-"G XI+"EF* >`B*  u2>*  !00  ?  **** ? *+`+`"  @  *"  * 2  `㿐M@ <?' @@  ,@2 < @  @\ $M @"@ ` .  @r  0`* M@2 ` @А `M@  @@  @u-  $@ ?@  =/,@3 0 !P, M@ g"8 o a"  @ u" @`M@ +` - =*`:` ="    @?* :  *  llllllllllllll0lllllll0ll0l($"Ъ`"ɪ` II@  - @ r$@ ?@ ?>@6` =" +@@  - @Ғ S$@ ?@ ? X@k6` @  - @ <$@ ?@ ?M@>@T6`C==" @  - @홒 $@ ?@ ?>@26`!@  - @큒  $@ "  @^ ?@ ? X@6`.`M@  ,2 @`,@@R`g"*`o`= -`X`+`-0=0:`u05*2 -2   +* '2  $2 *2 2* ?2  * 2 +-  =  *  㿘 - + X  @6` 6`<H@+-X `H@-+@8@X@8@@(@`` ..6 `..6 "H@..6Ȱ longjmp botch. 㿘 c@Ɣ 㿐 ' '   @A?2 㿘@@Ւ%u㿘 ?*  s"N  2" # tb @:  $b@9h 2$` 1 t" @F0 @@ .  㿘 ?*  t"N  2" # ub @   $b@  2$` 1 u" @0 @@ .  /bin/shsh-c㿈'D'HN@ r w HK`   "c g @ݐ '` @ @?` H;K@@i@g@I  u" " K@ @[R  2 HK@ r @P "@F  @F "@F  @=!8a@HD@D @  r2@R @MH@# ub#`#`#@"b㿐@/ u"     2  % ? @3Y ? " `2 u""$@@s???ch   @_???c@화 ~??@ ?# @!?7#a2?#@?@ ?# @!?&#a!?#@?@ ?# @! ?#a ?#@?@?# @ ̀`???# ` ?`` `?# ! ?#@?@ ?# @ ?W#`S??#@@?@ ?# @! 2 ?<@@! 7?#@? ?c @ ̀@2 ?&@ @ ̀@?#@? ?c @! @"  @ @! @2# #? L #@@?@ ?# @!  ?< @@! 6?#@? ?c @ ̀@ ?' @ @ ̀@?#@? ?c @! @"   @ @! @2    ?#````??# ! ?#@?@ ?# @ ?W#`S??#@@?@ ?# @! 2 ?<@@! 7?#@? ?c @ ̀@2 ?&@ @ ̀@?#@? ?c @! @"  @ @! @2# #? L #@@?@ ?# @!  ?< @@! 6?#@? ?c @ ̀@ ?' @ @ ̀@?#@? ?c @! @"   @ @! @2      @쀖 ???cԒ@뻔  ?   ?@j'    #\ @P@5   ? "# @딒 n?@ `@J  **2"@ ` @ ` @0 ?``L?J5 "@@b=&@7`@ ,? 2) @ "$ `@J@" M __"`@ 2` $  ,??4  ,` @   Ϊ` `@`?@ܐ0#@"SF ӄF @   "  ?b'H   @먖?ذ??cȢ@ @ 4 4ΰ?Ɛ ?ch@U@ °? .@C 0    #\@n?2 0?*` *   @     ( @ꭒ #\  @FH@ `@J  **2"@ ` @ ` n   @5 ?`?^7"@?#Ȯ@@dN%H `"?H@ ": `@J@ "3  `@ 2"` $   "       ,? ,? 2  24  ,?4 ? ,` @ ͠  @㿘 C!, @ €?  , 㿘 @ ?@*㿘! $#  @ #  ?@M㷐`"@`"`"`~"` "`"`@   `  2    \2 2   \? 2 *`2@0@㿐 {   }  @g { @ @ 㷐@@2@`@`  # [ {"  ]  "   }`2 `   • [` @M&@I@ [" { ,`;` }`5`"@`@ ] @ ") (`%``!@ ,"`2@ `  2@2@*  `^&``@(@& HOME㿘 ~; (7 .?  "* /" **  /*N @ @" @@3y ""  @2, 2 J @2@`@ 02@*  `@*2@㷐$@`c  [  !  -`?"A` `[`*A `N4K ``!"   [@B ] 2 4 [4`!9 7`! 4  `4 -  `] `4 4 `]` !&`   ]!&`   ?` a&` ?  *@"  *4 `4@- "@ @` 2 #"2?@  "@ ``+  - @ې  㿘@X@㷐 @ 8 !<#  06@@ " H  / @(@@    /6@6`@"`$  / 2 2@ `   / 6@ /` @㻘6@% $ @% 2   @\  € B? "> 0<; @  "Ā "& J` . ` . 4` @4`  @e 6@?Y  @ @0@E㿘``@` *  @ @ ` 4?@՞ 2&``` *`,&`??$&`  @ `"@@䓑:   @ڒ@` * $`&@``@  * $?㿘@e  ?  *  [  !  ]  -@ `@H"D"K ݔ "B   =  ,   @`?`2`@*2``  ]@ 2` 8 ``( `" @*2`` @  ˰ @*@`?㿘 ` * @ `@(??2@@" .㻘 !07@8` @2` @`0@㻘@( @@֒0$€㻘@ @@0(€    *@ (`㿘@@ @j @offonsecurelocalrtsctssoftcarmdmbufwindow㿘 u# 1 u@k 1 u# u%M"ؐc@ Ȁ E@ "c`? "`@w @  "@ 䀢c"   2 L "ՠ"؀ #"Ҡ" u*# u"b@ذb& L & & @͐& L &  @ u""` "`L  u#M b@    b   ?|& b@    b    j& b@    b    X& b@    b    F& b@x    b    4& b@f    b    "& b@T    b    & b@B   uL  =2  u@p& @'L o uJ# #" L #  u L "  "  u"& L "& @ 2, J A u"`6`2 J\2 J ""  `*'# *&*  2 ** J "   "   J "  "  " 0 Jŀ"*㿘@ =   /etc/ttysr㿘1 u#   @O`&#@ @Ds 㿘1 u#  @&#: @ /dev/ttyr+ `!8@)aH M HP 'Đ @T @ʒԦ   ?'T @@v@D4 u#  ? $ @А  $ ` : . .TaP@ Ԓ  'T @Ȑ @ߔ L#1 u@P1 u#㿘! v 4   v @"  $ 4 v 8` v 0@ v "`4. $ 8+  v4 v8* @ v% v  0 "`4@`4 * @^$ 8 $0 8@ $`4 8* @0 v 0& v 4㿘! v @@  "c L @  "c  㿘 #C c  v @@    # $c,  v @@䛐 @ @Β  "㿘@  C"#x '' 'ܐ ܘ @Ӛ  ?  @C`*`' *`F ’`@<㿘 v P  @[   @  㿘 v T㿘@E     @ v`d`@a  㿘 v`T㿘@%     @l v`d`@A  㿘 v`T/etc/groupr㿘1 v P "@B1 w w#`"#@ &#  #(@c8& P@ 㿘@ 㿘  v " d 㿘! v P @$ P w! w#`"#@_ $#㿘group.byname%ugroup.bygid: `'H ) w' w1 w9/ v㈲x# m㐀 #@;j㐀 `%#@. #  4U'##\#` P w@<ؠ@# &#В w&#. 㐒 P w w@:Ѐ @%##`@G P@;ؚР%#@ @#В@ʏ@%#', vP@$ 2' @ M vP`? "`@ @  "@ q vn# +uL :U  Q@: e`㐐 V%# @:㐀 O# @ݐ PH@t&``@А`h@;`Р 22#@ @g'̐В@<, &@<&@< "#H@B&@&@9Ő @<x` " @ߒ # %#@r2 @ $  #  4 4$  6 4 6 4 8  $ @J? /   /*@` & @@ࣔP$@P T 2?2  $@J "# $D *@T 2 2 6$! & 2/ @ #  $  @   ! @ޞ# $# @ޚ  2 $ 2  @  "  $  $$   4 4$ 2`8    㿘`@  E"c  "#  $@> 4  9 27   "@J@2  $& $ T 2   J / $ @&  В @ @& @ K 2 @&  㿈'H$   @   H =   c 5 47%  2$ `  ?`  0 '' H 2'@8 H 2' # % '  6  `@5 6 $ ' $ "@ J? /$B  /@*@ U 2 '@| $ L` .L` `?# ~ `@o`   `@$ `@  # @@@b ##  $" ? ` 4 $$ 4 2 ` ` 6 4 6  4 4$  4 4 7$  쀣 "$ `  " $$  @ $  #4 4$    @ &$ @ @$ @m  4 4* 2  *`2    $ %`k@@2$ @". &H 2+ U 2  $ @   @C   5 4 $ $$2  H    5 4 @v8 $ `<`6   @ݶ `84 ]  $ `@ 5 ` @  2 &`& G @   # &` @ݑ `:  < @((&`, N`@&`( `.6`0N`A  ?`@c  2`  `2``,"&@`R`2 6`(  @  @    㿘 ($  @*` 2 $   "$ @$ $   "    @  "`" 㿘 $ D@م  @ @* @ $ 26 & I ?& <6 & & & 6 6 6 8& & 㿘@ي  㿘  a@@٘&  2 &   "& @t&    " @""2  @" "R26㿘  @ܞ8  8 $ +  ` @ ?@ ?`,@ `(@  "c ?@! `# @ۈ$#  : xxswufsswap ,rwrqro㻘 !7 x9 ;  ! ! ! w xc#@ '$   @}Ra D@ǒ &J # w @$  @ $ @b!  w a@[$  ! !$  @ @~H$  @ z@~? z$ n$ l$ j$ h$ $ e`@ &J # w @{$  @w$  @s T$ $ $  @k "@~$  @b "@~$  #@Ϣ / @Ra, ! ! !@۫  @ @ @ @ @ے   @'a `J w  @t OC w㿘 x# @@   % 1 x #㿘@0 1 x  #@ # 㿘@  x# "   @ 0 /etc/fstabr㿘1 x# " @: 0"  @}b0 &# @#   㿘! x# @Q$#fstab: : p "'А ' " 'ؐ ' "' '@|@'' "' ' @o 㿘'L'P'T'X@JLRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx  ''Ē x@+Ѐ  @{! ' @  . * :   |" J@ :`'   *`*  J@ | : `*@.)  `@.$  `@.   @R` 2 X     @Ga  X & X a@+  : " X & X a @/ ?"& ( a(@/ a0@.& 0 a8@.& , !@@-& 4 D@` 6 Ē@.ݔ?  6  aH@.Ӕ? ,@  0& 8& 8 aP@.Ŕ?2 8@ 4& <& < aX@.?. 6 H a`@.?  6 J ah@.?  6 L ap@.?  6 N ax@.? & P a@.? & T a@.w?&  a@.m?&  !! 7/ !! 7/ !!  `7/ ! !  a7/ !p!  7//////Ē@.<?8$|@.2$|x@.,$? x $Ē@.!t 2 t@,`,`Ē@.?   ,@Ē@, D@1a,@ `* :  p,: ?6  ! \!  07//Ē@-l? l$@ * :  4` aW&@[& 㿘@  @@z "&@`@ 2@Mb   > @zڐ/var/run/dev.dbwarning: %s??㿀# yah  y% yl  y А   @ $ah @V7 $l y!l 1  @t '7' ' y!h   㿈 4  ''   @ؕ ? `@Ա찒   @؃ ? ! # @Ȑ$# ?@.*?@Ծ  "c  ./㿘 N  " y"@? J /8J J / @ " y" p*p. @ " J /" @8J"  $1 y!p@ߔ.  ?"c  $OpenBSD: assert.c,v 1.2 1996/08/19 08:21:46 tholo Exp $assertion "%s" failed: file "%s", line %d 㿘M H`@@@x"`'"`"`  @؀ ?  '$OpenBSD: sigcompat.c,v 1.2 1996/08/19 08:19:39 tholo Exp $㿈`  @'`'` `'@@  &㿐'D D@ 㿐'D D@  㿘'D@ѐD$OpenBSD: killpg.c,v 1.3 1997/07/25 20:29:58 mickey Exp $㿘 @#   "c ?$OpenBSD: creat.c,v 1.3 1997/07/25 20:29:57 mickey Exp $㿘.`&@{2$2 `@$1 `@$ `@$ `@$̈́ `@$< `@$$ `@$9 `@$ `@$ `@$ `@$Ä `@$` `@$R `@$S `@$ `@$ `@$ `@$ `@$8 `@$ `@$7 `@$ `@$ `@$ `@$ `@$j `@$  `@$ `@$ `@$u `@$d `@$' `@$Q `@$O `@$/ `@$ `@$+ `@${ `@$| `@$# `@$  `@$) `@$= `@$ `@$ `@$" `@$  `@$ `@$OpenBSD: sigsuspend.S,v 1.3 1999/01/22 06:07:56 marc Exp $ o `@$OpenBSD: pipe.S,v 1.3 1999/01/22 06:07:56 marc Exp $ * :"`@"$OpenBSD: Ovfork.S,v 1.2 1996/08/19 08:18:01 tholo Exp $ B `@"` h`''' ''''' '$'(`''ДȲ```     ` ` `@ "c ?$OpenBSD: strcspn.c,v 1.2 1996/08/19 08:34:15 tholo Exp $    (8J2J " $OpenBSD: __strsignal.c,v 1.5 1996/09/25 13:19:01 deraadt Exp $㿘 z !t?@D  0,@y  4?@8  0,libcUnknown signal: 㿘 X@{  ,8,  @|@ .  ?@|`@ . @~ "@@|ڐ$OpenBSD: strtok.c,v 1.2 1996/08/19 08:34:28 tholo Exp $ 2 J z 2J(  H "JH? z  J  z H  2*? #! 2HJ$OpenBSD: setenv.c,v 1.3 1998/02/02 22:44:53 millert Exp $㿐N@ ="`@@ "p @*9@,`*   b  "  z ` za  ! "`@д*` "J?$" "a`@h*  #! "@?,`$" "',` " L`=$ L  $@K   b* "@? L =  = ,*    =,@ @,`*    㿐! @Н "* `" " @'L'P'T'X 7'@~''' '''@.L㿀'@˒''' '@耢 @t&㿘 (   "c :?@ @2 P    (  ?2 2 #?   :  0@ c "  < :@ c "  "   "  :@ C 㿘`6  "&"@=&+,(  @ 2,  @* ܒ#&@&@2,$OpenBSD: pmap_prot2.c,v 1.3 1996/08/19 08:31:41 tholo Exp $㿐% `?@ @ @Q'    @  @3B   2@ 㿘<"e@& "4"E@&  $@.  " @(  " <@" < @@$OpenBSD: rcmdsh.c,v 1.5 1998/04/25 16:23:58 millert Exp $/usr/bin/rshrcmdsh: unknown user: %s localhostrcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: setuid(%u): %s /bin/sh-c-lrcmdsh: execlp %s failed: %s 㿈`!@} 2 M Ha@,?@Ta   @( 2@?&  @(Ŗ !@+ !@cc?0ys@ @(В  @(ʒ  @cP"@ҧ @+ @cG"@Ҟ @Қ @( " #M`H# !@sh"@@Ԕ@҆ @a @  J  "X@( /  `@'g  @( /  h@'W#\ # #M`H!@s*"p@@H @И@ No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): x N "  '@?$ !' ' @ #@3$$  !$ $  ؔ$ :@Resolver internal errorUnknown resolver error E "E"* /etc/servicesr㿘!E! "@sc$!@/ b"b㿘!E! " @$! "" ,/㿐!E!  E"@sc  $!E!@sْ l @J? '#E! z!@, N #@{ # 2, {"!@qĒc E. N "  " @qc E, @rҐ {a* 2 "`"`  {!"`#@qc "&,  "& L    & @qc ,  2L&1 {!/etc/protocolsr㿘!E!P !@s a$!P@/1 bp"bp㿘!E!P " @s$!P ""p 㿐!E!P  E!@ra  $!PE!P@s/ ` @J? '#E! {"0@C, N #@z # 2, |""4@qb@ E, L "  " %@q @ . @r( |b4"` |"@"` `L    @$@`@p@ ,  2L$@1 |"4/etc/networksr㿘! |"Ѐ  @rm`0$"@. b"b㿘! |"Ѐ " @$" "" 㿐! |"Ѐ   | @rJ`0  $" |"@r p @J? '# |! |"Ԑ@Υ, N #@z\ # 2,! }$"@\ "* @pv`  |, L "  " %@pf . @Gv }b"`  "` }""`  `L   @ $@`@  8, @p< ,  2L$@1 }"؁gethostby*.getanswer: asked for "%s", got "%s"-_/㿘*`& # ( (А (c:`@yߒ 2  .2  N .2 *`߰  gethostby*.getanswer: asked for "%s %s %s", got type "%s"㻀'D'' ~"   0  ~!@'$'?D# `   D@kԘ$  쀢 ` }  ~@·  ~" @' "' ~ "  ~"` ~ " "` '?%D@k  쀢 "  @m7* @m22`* @m-4 * 2  r5 2  ~<@D@kn$   %@@'` '"@@' @ 4ʨ @] ~ $@&#D@k>$ & @lj " @ @ 4 @]z''"' @>  @>@> %c@L7 6 0|3 0y@o  %b4D@j &g @l!쀢 `  ~  ~<@%@`?O @͞D  ~@o쀢   % ~b@K= ~ @26  ~@  '"@'  "@ !A@ '  ~  '&  @@'"'耥 " ? D1 %@& "D  ! ~ ~ @! ~  @0 @  @\$ @'"'  @@ "#  "c 㿘@0 c'  @&@`&``&`` &` `&  㿘\@` c$  @&`&`&` & `&  㿘  耊   @g#? @ 0 @@   @ bf㻈  耊  @g?`@``     ?"c  /"c    "c  ~ " " @w . 2 @@. 2 @M"  E0L ."@ @ D@BȔ ! ~!@@w , !'#' ~"   ~`& "` ~"  " &   @R@ȔN @M"  `.2 @J@ 2 @J .Ɛ @Mb  D@w- : 2L@L@ :E L@ (L .=  D@Br ! ~!@@w+ , !'#'1 ~&   ~`& "` ~"  " &  Z"# @M"  D `*:  : .  J@ 2 @J .ɐ "@D O  `@v  M + f"  y b  2 `2 @ @,$ &  @   "M%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.int㷈  耊  @e? @ݔ``h@%  `x@%        /     "c  ?"c  ,"    @\`!  1  @\2?@ ,@ ,` ,` ,` ,` ,` ,` ,` "@ O耢  `@v+   !D/ ~ HJ F f": y b 8`26`23`@.  @+Ϙ$ &'`( "`& & @@%  &@@7 &  &  "#@$`` /etc/hostsr㿘!E!؀  @mu`$!@)E"!܁㿘!E!؀` E!܀ @ې $!؁ 㿈!E!؀ E @mR` $!  ?E!@m   "c @J? '#E! ~!@@ɧ, N #ސ@u^ # 2,@k`  , @    @@D     D@@   @@    ' ~ !D"` ` "` ~ " " " L "  "  ~"`` ~ "`#@k9` "&,  "& L    & @k"` ,  2L&  @  ~!@'$' ~ @] "#1 ~ 㿘  @@   @ 㿘 1  @kĒ   @k   0㿘      @$  㿘 ~"`` ~ "` "`  "`  }#x ~ "` @j`2 , ~ 2U$@V $@hoLL "  " @j{`Ƞ   ~L " ,  ~`  "`@  ~!<@ $@`   ~!<)L    @$@`@jH ,  2L$@$1 ~ %u.%u.%u.%uhosts.byaddrx ~` `@ (*   @ZMb' ~ @ś$ ~`!@"@!}܀  R   "chosts.byname㿐 @А , ~`  `@ % ~! % ~ @c$ ~`!@ȴ#@!E     "c㿐@  .@?` .@`.@`@ 㿘  , ( &   &    @ &@ $&@" &@@$@ &@ ?& 2@㿘P  * ? !d :/ @lh@/  /   3 $ S&   ޲`  ? . .P@Q 0@1&&  趆?./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345*`2` B@J  K? ? `0.*` 00*  &K? ? ` ( `<0*  K   `(*   Ŕ%2.2u$㿘 $. 2.  a. .    @ .@6㿈  , 2  2,@, * 2  2` ` ( 1 !ؐ ͖ `OrpheanBeholderScryDoubt?#@ a@y `N@ 241EN``$``a21E` `N` $2 1E@ip * ?1E!# H`@`8   ?#@ @a  @ @ @ ``@ ?cn7  ?# ?#x @ה,   $@  ?#?#x@ ``? ?#@?#x@    * , 2 "  *  2 "  *`2 " *  !X $. 2.  . .   @3 ?c @  @ƒ?c @ *2@ @, @`0( @@*  @` ( 2 @@*   *  @`2 @@* ? @ * ڐ *㿘?@?#3. 0 0( (@7`.@ 0@0(`(3. 0 0( ( @7`.@ 0@0(`(3. 0 0( (@7`.@ 0@0(`(3. 0 0( (@7`.@ 0@0(`( 3. 0 0( ($@7`.@ 0@0(`((3. 0 0( (,@7`.@ 0@0(`(03. 0 0( (4@7`.@ 0@0(`(83. 0 0( (<@7`(@ 2` @2 * d(`(@D@&@&㿘D?@?#3. 0 0( (@@7`.@ 0@0(`(<3. 0 0( (8@7`.@ 0@0(`(43. 0 0( (0@7`.@ 0@0(`(,3. 0 0( ((@7`.@ 0@0(`($3. 0 0( ( @7`.@ 0@0(`(3. 0 0( (@7`.@ 0@0(`(3. 0 0( (@7`.@ 0@0(`( 3. 0 0( (@7`(@ 2` @2 * d(`(@&@&1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىyP?#$b8#@P`H@L`H *`2`*0 : `* `0@* 2㿈7 .#6,   2` @*2"@7'' #,  * 2  2`*``*`" "@  , 2 m.``* 2  2`*``*`&@&  * 2   㿈7 / #7 ,   2` @*2"@7'' .2 9x'q'$,  * 2  2`*``*`" "@ .2  , 2 N'G'.* 2  2`*``*`&@&  * 2  ִ 㿘.66㿘.6  ̔` * 2  `㿘.6  J` * 2  `㿐 @6` * *` *  '* *` * @ ',.2 . ..`.@2 .  .@ Ѳ`㿐 @6` * *` *  '* *` * @ ',.2 . ..`.@2 .  .@ Ѳ`㿐 @@  @  *  * *` *   '   * *` *  '., 2 ,  , `, , @2 ,  ,  Ơ 㿐A  ** +    '   *+  +`   b'., 2 ,  , , ,  2 ,  ,  @  *?ƴ** +   '*+  +`  $'..2 . `...2 .  .@  . E( `?2`* $1$$# %El$bl@@sӒ bl@lbl@$blbl "p ``$ p@   `"p `  $2p # "pbl@6" @@6E"l@@6bl@68@6@s@6bl@6@i@6@6@_ 耤  @6o?   @c @K "! `@6Z <```! !Ebl@K  bl@gj+@]t` @6r8@60`@! @63@  8 bl@6)@   `@@6`8 @@6`@6<8c1 !@! $"h *`*@ @ "h  $"h*`*@  @ "h  $"h*`*@ @ "h  $"h*`*@ @ "h  $"h*`*@ @ "h  $"h "h  $"h@+ %s: 㿘M H`8,@``@,@`@㿘@D 㿘? @< pXH8(x`H0User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0㿘N  @3  " @JQ $Ec $ "c@J 㿘E# " @q 2   2 㿘E#`" "#@@*`@( 2@E"#㿘 ")E%#%  (`L@   ?@f @#"@^ E#"`EL@   ?@M @E#" @D E#" %E"` "` "`-!("``EL@   ?@( @" @  E#" `EL@   ?@ @jE#" @ E#"  `EL@   ?@ @PE#" @ EE#" E#$"`$ " ""́: 㿐'N@ J`:'J '-c@&@& @ "k @[& @ "b @[ & @& @ "S @[& @ H @[& $-!(& & & $!-#@t& @p& @lEc`+& E# " ` 2&  b̀  E# & b̀ EE# & c  2& c  2& c 2&  master.passwd.bynamepasswd.byname` " !E@` C #?E@B$#E# ! "  bĀ  b@D "$"" "E   " S " " 0 @= "..!ؒ!#\#` "# b% @7@b  $b ܀`""@ ' b$bt$@"Ā .!.!  Ș@؀ \ `""@i EԒ@[̀ @$" "EJ ~ @"Ā ..!آ!@@2؀ %, # t @"Ā ..!ذ!#Ec@@ؠ c@ "b  $c܀ "CE@?E ؒb@@ ' " ؒb*@ +E0b 2/ "" @#"' '@ OE# H "J + -J  @     "b "b@0   ""@Gɐ E"cE%1 J ꀢ @@yԒ@̀  Ѐ`J@ L @.EDE1 " __YP!+p/#8' ' 1//#@є @C' '! "   "    㿈!E#?)@  !$#bĀ  b@  $# ".aؔ@耢  E@NE "c"# p " @ ".  ?  "b/ ' 7.5.-  "+ b 2/b@ٔ ' '@Ð bJ`+`-"J 0Ā @Ā  bJ   @O  @$Ā ؠ@HP ?@$?2b@ ܒ@ҔԨ @Z?  "J XĀ آ@@Ȁ + "$@$"b@$bĐ 6'؀ آ@@Ȁ   "N$@J$@CbȒ.@ < =b " 05``@@3 ܒ@kԀ  ؀`J@  @b b@m   " ! " @$"E>"#` b  "b " ! " @$" E'"# 1/@`  @ܠ'`'@Ɛ "  `! " @$"` " %umaster.passwd.byuidpasswd.byuid` " @t "4 Z ?А1a@G  "b/ ' -  "+ b 2/b@ ' '@x bJ`+`-"J Ā @ ;Ā  bJ   @U  @$8Ā 11!!@V ?@$?2b@K ̒@Ĩ @ ?  "J  Ā ..!آ!@ɐ@ZȀ . "$@b$"b@\$bĐ 'Ȁ ..!آ!@@5Ȁ   "L$@=H$@bȒ.@ : b " 03``@@ސ ̒@Ā  Ȁ`J@  @   " ! " @$"ɰE7"#\ b  "b " ! " @$" E "# 3/' @' '@y b`! " @$"` " 㿘 "" "" 1 "`""@ &"E"# 㿘 㿘 ! """@ $" ! "`""@ b$"E"#/etc/pwd.db/etc/spwd.db%s: %m㿘 ""E?@ "c 2#p2#   @p:   "b ! "x   2c@3 $"x 㿐 "  w  |@a! "@a"| 2 $"" "$"@=$"`  " "",@ *  ` "",@ *  `! "@ה   @Ҕ   @͔  $ ,@ *  ` "",@ *  ` "",@ *  ` "",@ *  ` b@  &@ b@    "b $OpenBSD: getnetgrent.c,v 1.8 1998/08/14 21:39:28 deraadt Exp $*netgroup: %m㿘@ 2&  3@ ʒb & @ P & 3@ b㿘  @2 & @*` 2 & "&@& 3@ b * "  & 㿘`  @ .`@}  `@*@v@t㿘  : , @k  2  * 㿘L@  @M"@  2`` 2L@`L@  @L@M" @ J `@  `  L  M"@  2 ` 2 L L  @ L & " `&@  3@ b@@*? & 㿘@͐   3@ b ,$  ,   )    "@ @@ʐ netgroup: db getnetgroupnetgroup.byusernetgroup.byhost㿀) "Ц 0 @ @,@3 ''"Д ?40@@B耢 & 3@ b& @0"@ 2" 43140 40"""@Đ@ U䀢   netgroup: Syntax error `%s'㿘J "` MJ #Y 0" @  ` 2&J 2J@ ( @? &5@0E 0:?8    ⌒ @ ` 2J@  `&J`  `⌐@  ""L" @ &@ 3@ b@@ *? 2 netgroup: Cycle in group `%s'㿈u  @5!@/0//! 1 &5E'u耢  ? @0 "` &Ȓ㿘  ` `@iC  `  @i7     @i+   㿈  @z5!@/O Ȓ 1 "E '耢 9 ?4" @`@J   "@C  @<@:  ɐ@, @( %s.%s㿘@   3@*b6!N 3"`3N@ 3"@v(%s,%s,%s)㿘6!6! 6!`6!@v֐㿐` @7 @1 @ː   ,㿘ؖ   і  ǖ     # @76@@N "NN? ,2 N`@[ڐ☀  @ @ 㿘EE  "c  #  $c@l#  "#@e#  @^@\#c $#! "Ѐ  @$"Ё/etc/netgroup.db+㿐Ec'`! "Ѐ  7 x   @k $""Ѐ   7`s 1 @V0@@@  3@&b,E E"E" ""@"   㿐! "Ѐ  '7 x   @k $""Ѐ  @`7`) 1 `@ @`  `  3`  2  2 @?(  /0  @  "c #@k #հ  /,@>&@@0  ".#@U $ .-- 7# @~2  "c  ''@~= "Τ .@m  .,,,@e {@ t /,  @is ` @ . `@ih U L` . `L` ?`  ` `@ʔ@}     " ׀ `$ @ 0 @ o.@$ "&@&@@ ` /, ` $ @@f*n,c  "c  "c  @Ő @ @f 㿘 1 "܀ "&"@&" "" @ "b@z   "b "" @>x   "c ?J:  K J" K K J KJ@:  :2J0 2J J@ 㿈#\?@ %s.dbtcx'D'H'T` 'X?X # b܀@T! "@$db@>'"غ Ʋ$@$ V@ '    @'; 9@@sX   @iϘ "T@@ `@`@@L@ɐ@}`@ H  D@ @| &j` ' @$ 4 耠 @B ?1 M   (*,L \2&,, ܀&@d@Œ $ @  耠ٰ?@հ?,L " #"T@ 2\@2 2  `@ 2V  @k?? 9``Ҕ = x L`:" L  ?#\X $? 耠@@90u,?" ?2 :,??ʴ L`: L  $$@L? : :,`$@&@ &@@d@) $%' @  耠"c @w1@$@@?耠$@\$H@ @ 2 @ѐ  "c  ?@ɰ?0D@ 㿈@''  ? J@?? `'?`&@J `? J J|: ?  ?J:|?  㿘@@㿘1 "䀢 " @g&" "" "" "" r㷈 b쀢 ""b! "䀢   b;@Oi`( _$" "܀`   !  "U ! "@O "䀢`` @A@g  """ ; 0@O;`( $"0/*?􀢠M @"@  *`:  : # b耢 J? \   "b ""J? \2 "b "b@g }?0S '  J*`:  : \ ,J   ,,  @O5 䀢` ` @@gT $*?O J`| `:*J *#\?R    *㿘 = °?@f d  d  "c ?N :< *`:   ^ \ N`:` u*2s* N : А   * N?А  N`/`7X** :  2N * @d|pd|p * * * *  *  * :*?* ?"@ `d 2  ?@? dN :f* "@ 2  ?@Ґ?&㿘: = >?@ d  d  "c 4?L"*@*@ `"@@ǒ d 2 `?@? d@L : *@`"@@ 2 `?@?&㿘 # 2N@1? 0  `N@ x X `  @А *`: ?А *`:  ?  *`: ?ɀ @ `& 㿘N@ :`N@ :2``@a.`.`㿈 `2,`@J,`  " @' & , `& &㿘'L'P'T'XLД  b@?! # @$# ?㿀'L'P'T'XL  * j ?#L`# *`#@ 㿘'L'P'T'XL @1! # @Ɛ$# ?㿘 b@?PATH/usr/bin:/bin:/usr/X11R6/bin:/usr/local/bin:.execvp: : path too long sh/bin/sh㻐 N  "c @Tݒ /  D'=@" ="@9x'=@b rL  =#@@@$ =c@  @ =c@ ې@ /,`@, b@| #   =` &`07 @   , @ 2  @*  %=#0&& ` @̕, = b#8@L@ ` 4  @)(   c ` "c `@?㿘'L'P'T'X@&ޔL$ `@$ `@$ `@$ `@$; `@$Z `@$OpenBSD: rindex.c,v 1.2 1996/08/19 08:34:08 tholo Exp $ *`:`J " $OpenBSD: _yp_check.c,v 1.3 1996/08/19 08:34:57 tholo Exp $㿐 J"  @     "& @+"`?$OpenBSD: yp_first.c,v 1.5 1996/12/03 08:20:03 deraadt Exp $yp_first: clnt_callX "u N"q @ @ @"j N@"f @ @('_ &'@&@)ʒĀ "'T ?ؠGĒ  @'В gԘ#'' `h 4#\@؟  ``? `@=Y`0Đ?"`h@)8ఒ 2!g&@ې  & @*@'@@̐  ' @|@@*@g#@Yw@*ā$OpenBSD: yp_get_default_domain.c,v 1.3 1996/08/19 08:35:09 tholo Exp $㿘& Jb  b@'!    "& $OpenBSD: ypmatch_cache.c,v 1.7 1998/01/20 18:40:27 deraadt Exp $㿐@HR "      2  2 @k  & @  b 2$"b  " @$  @y$ @O  $ @J $ @l $ " $ $  @  @   @^  @T @7N $ F`  $ 㿐! "  ( &  #'@G" "  2 @^ϒ 2 @m 2 @$  2  yp_match: clnt_callX @" L@" @^ @@" N@" @S @$' '@@(}Ā  | "@^ 2 '쀢 '@@  '@)c @\@@*@@)Y '''''ؠGĒ  @%' h'' `g ##\    @ `@;aPĐ?"`h@'谒 2"g'@@g  ' @@ "@@^!*  g@Д " g#@X@)oāyp_next: clnt_callP\ `N"w @ @@"p N@"l @ @$$a '$'@@'ђ "'V ?''ؠGĒ  @'Ȓ g̘#'' `h #\@П  ``A `@;^`?"`h@'=ఒ 2!g'@@  ' @@@*@$@ѐ  $ @*@g#@W|@($OpenBSD: fork.S,v 1.2 1996/08/19 08:18:06 tholo Exp $  `@"` $OpenBSD: strsep.c,v 1.3 1997/08/20 04:28:14 millert Exp $  J H 2* #2HJ$OpenBSD: ffs.S,v 1.2 1996/08/19 08:17:58 tholo Exp $A "2 J "2 J   "2 J  J $OpenBSD: bcmp.c,v 1.4 1996/08/19 08:33:57 tholo Exp $2J@  "  J@J`    9M;w@``"@  `%  4@`  2@"   "@  &  &2  @`xײ`B",`  T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T  T T T T P T T T T T           T T T T T T T T T T l  T  T T T T X T T  T T T T T T T T  T T  T T T T T T T  p    `  T T h T $   | T  T  T T   4@_l 2   &  C&h f d @ l2` `] ,* W?Т x 6   a1  -a"* ( @ @!  @ "  a  2 @ 2""@     x     @@_   @#`"   `%M  ? &  &@^ 2g   2 `8@C"P,` dt"    @$@@^& "  :@$@& & @Q '"? ) J@ ` ` &  &`4 @^ "`"0 L 2``g@ J@    ?&  @,`&  4 @^f "آ0 L@ 2 "ְ,)"? %"    !M` &  &`4@^8 2"   "`   #M ?&  @,`&  4@^ 2 ,b   " ,$8!%F!4 Հ M* D",,,Pxxxxxxx,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,`$ "$" < :-`U <-`U`` %! <  ! ?"񀤀!  =, ? &  &@]l !2s! (߰ @Aڰ `x`X @5 Ð,   2  : 2"8!'lE!D Հ :d* 88L0000000000`` > "! ?"! = %$ 9!, ? &  &@\ǐ !2!$7 @/ `e`E@ @ ,@  2 ":"$p ? ^      ( 6( !? * -  ]** ]6  -* 㿘 0 @@2 4@$ $& 0& 4  @,&  ,`@B  @&& 0& 4 ?㿘?, # 2` @` 2`0  " ` @' 2@?&`` &` ?6` `  6` `0  ``4@& @ "@(?&@*`! ` ` ?߀6` @@  `@ 2`@&@` `@&`0 &`4`.`B@&`<&`8`B&@ &`㿘 @    "c ?6 8 # @ (` M  B D > @ @ @2 P   @  ?2 2 #?   :  0@ d "@ < :@ d@" @" @ "  :@ D@     "c   2 @p (̀$ !@2 U  & @ 2  <   (5  % L$5 2U  >`@ ȑ>` B 2$ 0 @"  P  @  ?2  :  0@ d   < :@ d 0    8 ;  @ D <#@ @ d   "   @ d  @2' L4$ L@8 L @ D$2 L@( L&  %  0 ` % @@"% 0@ % 0 V   :` @ ?2 % %  0` % @@"% 0@ % 0  ?5 @Z    %"@% % @  ?>`   @?2 0? 0` @@"% 0@h % 0%    % ?5 㿘@ 2* @’& &&@@Ԣ$@@@ZD& $@@Ĕ"@&&$OpenBSD: xdr_reference.c,v 1.3 1996/08/19 08:32:06 tholo Exp $xdr_reference: out of memory 㿘@    @ې  &@M HH@xoaH  @b`@&@㿐@ @ @Q'   Ŗ&@ 㻈 ?$  耊 2 #\@9e2#\ ?"##`$#d @К   ."c@6  6  #"c `  `H#p*` ######         "c?㿐     '@9  "# "#   "c N J@ .`J@d?  .@ J .`?  @ǐ wz "D2  ? @s 4j #`   耊 2  ?`>`  耊"9`  !$@2!$; / @@L 4Cc =;    "  2    2  "" `@  ֐`  @   "#   ?  "c?%.*s.%.*s㷐  耊  @8^` "#(?`@?"N .2h@U , Ib$ @/>˜HOSTALIASESr㻐  @I@#@۠ 2 I@@c  @/, 'M "@@ɒ {@J? '#@,@O ⌐@  2LO @  2LM" L  @  " L E,@?   ⌐   M"    2 L + L   ⌐@  L    @  M"`L@  @@  "`@HW$,@.$@Xz0@Xw Hd    `@7{` "#?` @> @6 2@4@` ?''@* * @$@ ~*  !@ D$@?Z?2X?? Ґ@: ɰ$.2 @;ے .2 @;Ւ  ;5  8?@:m  @;’ @;  @;  @; 5 ` .,` 2 @;` .2 @;` @;`/`2 @;```@4`&rjeechodiscardsystatdaytimenetstatqotdchargenftp-dataftptelnetsmtptimerlpnamewhoisdomainaptsapfsbootpsbootpctftpfingerlinksupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srv%d㿘`4K"X*` 13 03 03 13 13 1 3 1,3 181D1P3 1\3 1h3 3 3 3 3 3 3 3 3 3 3 1t3 13 3 113 3 3 3 3 3 3 3 3 13 3 3 13 13 3 3 3 3 3 3 1113 3 3 3 3 3 3 13 13 3 3 3 3 3 3 23 3 3 3 3 3 3 23 3 3 3 22(242@2L2X3 3 3 2d3 2p3 2|3 23 23 23 23 23 3 3 3 3 3 3 3 3 23 3 23 3 3 3 3 3 3 23 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 223 3 3 3 3 3 3 31K 1K 1K 1K 1K 1K} 1Kz 1Kw 1Kt 1Kq 1Kn 1Kk 1Kh 1Ke 1Kb!1K_!1K\!1KY!1KV! 1KS!(1KP!01KM 1KJ!81KG!@1KD!H1KA!P1K>!X1K;!h1K8!x1K5!1K2!1K/!1K,!1K)!1K&!1K#!1K !1K!1K!1K!1K!1K!1K"1K "1K"1 #K@,Mb(icmpigmpggpsttcpuclegpigpnvp-IIpupchaosudp㿘`<L#*` 34444 4,484D4P44\4h4444t41L)#01L&#81L##@1L #H1L#P1L#X1L#`1L#h1L#p1L#x1L #1L#1 #K@+b(㿘 "@E  !"\@s   !` @ @8l  @9P * 2 &<!` "@ !`?` '`@ * '@  @+L㿘L@c;; res options: %s㿘M@sVb    #M " @ @sFb2 `?`&`@ * &@ @+;; ->>HEADER<<- opcode: %s, status: %s, id: %d; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %d, Ans: %d, Auth: %d, Addit: %d;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed 㻈    2!`@3?l!`   (F ! F|2 `<  *Fc@ M@rb?`& * & @* "@ ( ?`&@ ; ;* &@*j "@ "@ M@r}b2  M@rub$M@rnc"M@rgc!M@r`c M@rYc @M@rRc  M@rKc0 M@rDc8 "@ ! M@r8c@McP!?#@r0 M@r+c`Mcp@r%  "@ +"?`& * & @) t "@  "?M@rc? g  `  @M@qc@`   @ @5$ @ `t@o`  " `@7* @2 M@qƒc`@[`   @7}* @ԑ2 M@qc` ` "? ?`&* & @)?<`@/ M#\?ؖ  $@ @M#\ @ M#\  0 McN`@qa㿘"㻐@5l$ O ?`&@ . .* &@)@)㿘"Ԗ.㿘@5< & @ J? ."O  ". "  * 㻐 ؘ$ @)z0  %lu %s %s ; proto %d, port %d " "\"?" ;; *** Warning *** OS-type missing ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %d %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 %d ; LABELS WRONG (%d should be %d) ( %s %u ?%d?;; packet size error (found %ld, dlen was %d) ?c  耊  @1 E"# @$ <@(@6! * @62` * @62` @6 b@ * 2 `d Oc@p@ "@   !O@R#@p1!O@B#@p)`eP#*` DEdVpVpEdHtEdEdEdVpQEdEP4J,LHP4J,KEJ,NhVpTXRJtVpNNVpVpVpOVpNVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpPQTQT``2y?`@}   ?aT " !O@# 2d?aT @"   @5U * Oc `@o3 L?`&@  * &@'Xo 24H O#@'8 $6%O:2@A6  \?`&@ \* &@') ?`&@  * & @'? р?`&@ " "* &@&M H O#@'$6%O:2@@  \?`&@ \* &@&ג ?`&@  * & @&’? р?`&@ " " 2O#@'KO@nŒc?`&@  * &@& " ?`&@  * &@&| mP @'@4V P` @n@4M !P@1 8@n{@4A !P@% P@no@45 !P@ h@nc@4) !P@  @nW!P@4 * @nL2 E 2  !P@4 * @n:2 3 " ?`&@  * &@& 2 O#@&8 $6%O:2@?  \?`&@ \* &@%Ւ ?`&@  * & @%? р?`&@ " "?`&@  * &@%} "'O?`&@ "* &@%7 $5:2@?w  \?`&@ \* &@%j ?`&@  * & @%U? р "?`&@ "* &@%@ ?`&@ * &@%-  ? !O@ C# ?   .!O@ P#?`  !O@#@2 * @2ޡ4  * P`@m2!P  @m  @m @l 2̰ @2 * @24` * @24  * P`@lܙ3 Ք 2 ?`&@  * &@$ " ?`&@  * &@$ 2h| ?`&@  * &@$r@%O 2M!P@2L @lB  ?!? @z  ?aT  " !P@ v Ȣl@lb :,#P  ``@$Ւ @$В ?`&@ * &@$, *?`&@ ) )* &@$?`&@  * &@#@1ѐ * P`@l2P` @l P`@k "@?X @ ~✤'P ?2@kL@?`&@  * & @# 倌 ?{@1 * 2 M@עb@kPa@k @ Pa @k@1qP`@k !P@1d!H@ @k@1\@ @k!P@1M!P* @k2 ~"@?X @ ✤ "'P ?2@kjL@?`&@  * & @#8 倌 ?P@kNaP@kHa@PaX@k>?`& * & @#&Pa`@k( WXWPWHW@W8ANYHESIODHSCHAOSIN^X^P^H^8^0^^]]]]]]]]] ]x]h ]`]X ]P]0 ](] ]\\\\\\\\\\\h\`\P\H\8\0\(\ \\][[[[[[[[[[p[h[X[P[0[([ ZZ!ZZ"ZZZZhZ`ZPZHZ ZZdYYeYYfYY#YYxW8Yp"any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA㿘    @2%  2 &   2&㿘`   @2 2& `  #(K@!Hb(2&㿘`   @2 2&  `  #<K@!(b(2&㿘U#\ 㿘U" initdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2?0x%lx?㿘 ":1X"/1X&'1X=1 &'1X61 +1X@"#1X+1 $1X1X"1 "1X1 1X   1X 0 8 H1X P X  `  h  p #PX@ `0 secs%d day%ss%d hour%s%d min%s%d sec%s㿘 X !!  *x x.  .  .  .  . . @t <@/ <@t <@( <@t @!  cx X!X"X"@ L N 2 `  . `X"X"X"@ 4 N 2   `. X" X"X"@  N 2  2 1 `21 21  `2.. X"0X"X"@1 #x%ld.%.2ld㿘 2 @tq   @tk Fc* @@ d1 #!Y@ @tY d@ɔ㿘M" @     `*+  * ? @: `` L@ .+ ` @M"@  *``: ?Г*  @@  *`Б*: @`+  *  * @ F# *`@ `  , @? 4 * $ 㿘 @M.(`(> M2Mn/ ) (>  M2MN..`(> .2+M!(8Ї(((. 8Ї((Ѕ. 8M"M2(82\Z0(ijjjjjjjjijjjjj@jjjj@jjjjjjjjjjjjjijjjjjjjjijjjjj@jjjj@(` (( (( (( 1 &(` (( (( ((& (82@Z(kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk " ""M"M2"@㿈   ''@'   `  2 쀢 2   J@ - +?`'J@ +`'Mb    . * J?Д'  @ ` . J .' M"@  '*`: ?Г*  @  *`Г*:` '. @*`@*`@@M @ ``&%b    ' `@ ``Mb      ' `@ ``:d.@M @ ``   ' `@ ``Mb      ' `@ ``:5.@rM @ ``   ' `@ ``Mb      ' `@ ``:.@C.@.`.`.`4.`4.`4.`.`5 .`5 .` 5 .` .` 4 .` 4 .` 4 .`.` ?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %smX \@ǒ`0       * *` *     @  * *` *     @  * *` *   &%/" @/&%"" ??ڐ!@   N S @q#'@#@q <'@ <@q <@ <` W  E@q##@Բ @q < <@̰ @q < <@Ĭ @q d d@ @X _ @ F#8W@ F#8O@ 2#\F#8#\#`#d;h#p#t#x#|##\`@!F#8@m#8#8@g#8@a㿘@   6 LL ." `@ &L L * 2?J? .2 %04d%02d%02d%02d%02d%02d㿈'@   1  gl"   " #\##`]@ʒ`ZONEREFZONEINITUPDATEMAUPDATEMUPDATEDAUPDATEDUPDATEA8765NOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14131211109REFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERROR?Ѐ 8?Ʌ(8㿘 @? 'M%G@: `."4+"1/".`-   *  `@  D" Ґ  * ⌐@  D"  ,  .@```ǰ    4  6%* . @ 0 07* @  `07*6*& @* 㿘    @ @W /"c ?0123456789㿐 /N( ^ @4  . @* @*`"@`#2,@  ,@2 `,@ N ް  .@.`.` .` 0123456789abcdef0123456789ABCDEF㿈 @Y N :  N :p H  NA ?#^!@4 ^!А@4  ",N %N:. `CN`=4,@`,@` 5 `1d  0*NŰ   ` 4,@`,@``@ $@  % #  @ *-@ @  @   㿘    @ @$ /"c  %u.%u.%u.%u㿈  _ @`P@%  "c  %x8 @   4`@: * * $@#*  *@ ``$ ?''  ,`  ?'' '"`?Ā@$''''``,` ?Ā@''?Ā Ȑ?'Ȣ  :?#@  Đ@@ `@ 20`,, ``, ,` Ā  2 2  Ȗ$  .a" * @  _@Q``` Đ@ 2, :, , Ȑ$ 8 @m "c  %d.%d.%d.%d㿈_'1 "#\@Mb 㿈 N 0   N x X   N "'M⌐    @} ?Г, :` D , :  *??  N N . @ $@Ģ`  M"   2$@?$@`$@ :   **@   ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=㿈`D `!p /  `2 `? ` *`/  2 @  */ // 2 / ?/@`??@z?@v @rX` . . . .° `@ //@ / * `@  2 / * 2 / *?2 /@=`??@8 @4`!p @ .逦` @ .  = @.  =. :?.?㿘 N[ `!pM"   2MN=N@1 X "`   `  @"  @ @@C  ?@?@ @ ?   @ @@&㿈` ` '' `*2@ 2 `?`7 x 8" Ga   n  @ XH   @ 'p'  @5ک x @/  ) 1  :1#V /@  / 7    ۘ@ (@  /`7` @0os"@ @)  (`0`  @=_# @/Ȗ  ) 1  "* /@  / 7  * "@ (@  /`7` @?Q!@ @)  (`0`  @`& ؘ @/  ) 1  "=# /@ܖ  / 7  ?֘#@ (@  /`7` @"W5#@ @)  (`0`  @!" @/  ) 1  ?f! /@  / 7  )P#@ ?   /`7` @m !@ @?`'  (`0`  @=!b @@ bQ@  ) 1  0,#@  @' / 7  ) @ /`7` @:mc@ @/ @ (`0`  @5Ě`] @/@ @ ) 1  `S (@ @ / 7  6(yb@ ) @ /`7` @9cȚ@ @/Ȗ @ (`0`  @xsa @/@ܖ @ ) 1  0c֚ (@ @ / 7  =5Ca@ ) @ /`7` @V`@ @/ @ (`0`  @*xa @/@ @ ) 1  ?;c (@ @ / 7  bٚ@ ) @ /`7` @#J`@ @/ @ (`0`  @?!B @ ) 1  !}"  / 7  gX!"@  /`7` @?yN @ @ (`0`  @)/"D @ ) 1  # Ȗ / 7  =Ҙ#`@  /`7` @/ p@ @ (`0`  @ &ߘ"Ƙ @ ) 1  :I#  / 7  5;̘ @  /`7` @"!@ @ (`0`  @6u4 9 @ܖ ) 1  9!  / 7  蟘 @  /`7` @1+"e@ @ (`0`  @= H"D 0@@  ) 1  ʿ# 1@  / 7  *#@ 7  /`7` @?$ 9@ 7@  (`0`  @V֘!Ø 0@@  ) 1  #3  1@  / 7  ? }@ 7  /`7` @!a!ј@ 7@  (`0`  @"O 0@@  ) 1  ?9" 1@  / 7  (P#@ 7  /`7` @!@ 7@  (`0`  @=ߘ" 0@Ȗ@  ) 1  /N"5 1@  / 7   "@ 7  /`7` @:ᴘ#@ 7@ܖ  (`0`  @ & &  @& @& %s: : %s 㿘M H`8  e@[vah` @[e@[lap!e@#!x@[d@q㿘'H'L'P'T'X@!ΒH㿘'H'L'P'T'X@!ܒH  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~G* R 㿘'L'P'T'X@ Lsyslog: unknown facility/priority: %x<%d>%h %e %T %s[%d] /dev/console p< #f`Ӕ#G" :  ## G"@!(f@F6'$@!f@  @ה6$@G" 2G 2 8" f@Fʔ6$@G" G!f@A @F6$@G"  ` :,` ,@*` $$'f:  % N` m `@"@F6?$$`. ?`@*` : .@6!G" $'%@$'f!' ' @;F "؀  G "G"@,`G"@&ǖ " f! @O @+ > 'ؐ$$'f!' '@; @/dev/log㿘 G""G""1GG""1G"쀢?!#G# bܐ @ j j,bܐ ,  g`@+ gG"  , i  @/ ?&" @EΔ #Gb쀢1 "؀   b@ ݔ j? @qb$b&"؁㿘!G@h"?$" ""؁G 㿈 ''@ 㿈 ' ''  @x ?2 $ `@$OpenBSD: xdr_ypresp_val.c,v 1.3 1996/08/19 08:35:06 tholo Exp $㿘@  @` $OpenBSD: xdr_ypresp_key_val.c,v 1.3 1996/08/19 08:35:04 tholo Exp $㿘@   @a` @` $OpenBSD: xdr_ypreq_nokey.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@  @T` $OpenBSD: xdr_ypreq_key.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@   @5` @H` $OpenBSD: xdr_valdat.c,v 1.4 1996/08/19 08:35:00 tholo Exp $㿘@2m$$OpenBSD: xdr_mapname.c,v 1.3 1996/08/19 08:34:59 tholo Exp $㿘@2Ĕ @$OpenBSD: xdr_keydat.c,v 1.4 1996/08/19 08:34:58 tholo Exp $㿘@2=$$OpenBSD: ypprot_err.c,v 1.4 1996/12/14 06:49:47 tholo Exp $  $h(             $OpenBSD: yp_bind.c,v 1.9 1997/04/29 21:25:20 deraadt Exp $/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFDH'D h#H@M2?c @: ? # #@}ӐV @}ϐ@}GcȀ@ " """ `" @ @{; 2 ` ""G`"#&@D - @~ ( "  D@5Ē    D 2 h@z l   @~| l?& \& h  h 2? h$h`hpD@C @L’ ?". h@̒  # #' 'Đ'Ȑ '̐@ ̒@ @}S& h@}Om@}K"Ͱ @zːɰ   А @~/  /А / 'Ԑ?'ab  @Ϛ 2 h@#" @z # 2 '  @" @z 'Đ 4DGcĘ"'' #\耢 "  M HDh@Vc  @?d& h  @ / /# 2  H"Z @zXV  @}  . H . I . J . K. L . M  @. N   J. O6 X D@(& h. DG#'2  : ' `? @ ?& \ Hab  \'@)'Ā & `h@d#& h \ @Bה ?h@ܐ#؀ b&"b`2&@ 㿘 ` `@& `?& \㿘 㿘 " @4  2 ` `@`$@$@yՐ0 $OpenBSD: strftime.c,v 1.5 1998/08/14 21:39:44 deraadt Exp $ xp`PH@80( h%a %b %e %H:%M:%S %Z %YPMAM%a %b %d %H:%M:%S %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJan%c㿐@l'k!(@*2*`2*? "?%02d%2d%03d %H:%M%I:%M:%S %p%ld%lu %d%04d%e-%b-%YPM  j"/k+k`%  M`yk"d*` LddddddddddddddddddddddddddddddddddddddddddDdddddddddddddddddddddT<dhPddddd<dd<ThDddddddp$8dhdd$dHh(,L?` s* q |` l* j `` e* c 0` ^* ]` d@rO'laBE 4]'\ jK#` a,` ka&`a!`@a " aka` `ka `@a֒ " ka`aa` k!` $k!k!@a@'`'`'` '`'`'`'`'` '`$'`(@ 'k@ ^aӐjא#k͐!` `@q" a` " ka`? @q ; ```'l`!m@ad d  !n@a^! !m!n$@aW  @aR$?& րא$`2ݤm@aA d 2֤n@a;! 2ФmΤn`4`` `2M` 2M 5M V g aP  '@a daEka@kW!``` "  @q< a/`ka)A '(` '@4;':  '` d@`ې'laka`'l@. &`( ` `H L*` ᐒ@%   .  M  㿈@ j@  *(  *GMTJ ? * ``HH@ LL  H  @  L ` ( #@  H @'LHL @؅(( ( " `@@../etc/localtime/usr/share/zoneinfo/?` #@x  N : /@$ / 2 n@`8 2  N /@$ .   2Nn @ "%?N :" N /`?"n P`"?@yi@yf #@n@`h@@$M . 2 @ܒ  2?@G ͐?` @x$@xY 2ް?5 2 / &@, &`) $&`& (&` @ 2 ,``a4?` !r4?24? ?  ?? $@ `$ `+  *@ *``  @ *` u 6`$ `` ` 6` @@*e` [``& @` 6` 'LŰ@&@` @&  F` @& `A`` @4\?` `   @#L@ @* ` `@cL* @ 6`!L@&@`$ `@ ` 6`'L @ L@"` `?"` ``  'L  @ L@"` ` ?"`` mn +  (:` Ѐ ,-:` " JЀ   +  (Ѕ+`8   JЀ  & "@ 㿐 ۖ $* "@*`@*`&@N :  ʖ ; *`" @* @&@N :   < 2@  &@㿘N -   +"    @ &@㿘N J M&@ `* !?А &@ `   "0 N .  ` v  "$ N . `      &@` !m` 2N  / u` &`㿘 `@] d2  @]!2  "  ""  *` * "@*`" * y;vTs!*` * "@*`" * k ? o! - * @ *` * "@*`" *   @] $  &@ d@mӢ`@] d,`* * ?@mƒ     <  :`,`" @]{  &` ,   + o*`- * @   6+  +  * "@*`" * posixrules`  @v!!'& (7?N 'ܒĴ ".?p# 2&@N  c&`(?N  , ;  2N ?Đ1'N , ;i Œഒ "?N ,ȴ "?N 2? &` &` &gP&gT&gd&gh`eئ ' o"Ē &gL &g`ޔؔȀ$ $@$@`, $@`,`, $@`,  @\ d2  @\!2 .*` * "@*`" * Ȧ 2?   ?gL gL) ` @ %ؑ* * @gP   @  `6`@ %ؑ* * @gP ۘ  @ ` / @ eؑ* * @ S*e\ 2* X 2`"`"@#`* * @'P'L` ` ֚`&gP&gT &gd&gh &` &gL  &g` &`&`&gP&gT &gL `&`  &` ` "8?#L@@ @.@``@ .@ 㿘m#В  㿘 b ?"b  cH n㿘TZ㿘r@r! # ݞb  !@, 4@u= (  $b !@L  "#H#H" "'L"'T "m@c0 cHx L :N  㿘㿐 #H``'` gP ` `gP 2*   `` ` %ד*@ *`gL@ @ @]HL cL&  * @"   @&(㿘k 㿘 "`" 㿘 b 2 "b %"$ $@'`H @ !p&(㿘 㿘 "`" 㿘! "Δ㿘  J!L!P*  <2= 4  * @` `$"**   ` 2!L*  @ @  `* @ *'T@j@Zဠ&@Tဠ T! ?"  @jƒ.&@Z.@j <&@Z <&@Z|  & &'o" @Zl d2  @Zf!,  , 1@j!m $@* @*`@*`@` d@j< !@j|$   d@jr:!@jm$ $$&&&, @*`o!@*   &* $ 6& & &$㿘Ԑ@hÒ@ "&  2` 㿘@ &: @j*@j&: @h@" &@`` ` ` `@ 0&' ' ' ' ' ' ' ' ' $' (  '̒ < 23?А < 2+?Ԓ  2$?ܐ 2?'l 2?Ԁ )!no"z?  ܀ 4  @` @Yj d2  @Yd!Ԡ ԓ,   'Ԁ!n* o"܀ 4  @` @YF d2  @Y@!,  ,  Ԓ " 5'Ԁ Ԁ!nآ oܦ!؀ *`@Y# d2  @Y!,` ,`* Ԁ@"@'Ԑ  ''ؐ  آ ?ܒ8Ȁ 2?ܐ'l'Ȑ?ŀ 2?Ȑ ;'i''Ƞ ' r"@Ȓ  h? `?',@" ',@ '耢`@ =@  #H"$? F,`* P耢@2'? "/ * 'P耢@'L'L " @'Ȁ 2?耢@??좄֤?&  5@ ''@ &?㿘 ` 㿐  & `" K && r"@  #H"$ ? :*` * P @2/ ? *,`* 'P @'LL#@  & `?& `2'LL" "@ &`?& ޠ?쀤6P?㿘%rb 㿘?" 㿘" s`d 㿘" s`d H HL*` 㿘3'DDD&㿐*'DސDD@'ِD"@@ `'D&@ &􀢀 ?0'D&@ 4􀢀  SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d 㿈  * v#8@v"@  (* v#8@v# @  #\ v#`@#d gl#h@6\   㿘 "8`" ΐ$OpenBSD: strstr.c,v 1.2 1996/08/19 08:34:27 tholo Exp $㿘N@ `@pN    2N@' 2N?$OpenBSD: strcpy.c,v 1.4 1996/08/19 08:34:14 tholo Exp $ @( @ *(`$OpenBSD: strdup.c,v 1.3 1997/08/20 04:18:52 millert Exp $㿘@pZ @lؐ @o0 㿘M"   -+L  L0 L x XL 0  >??</  ??@Ti    M"    . ɐ' "8?2 @  @  ??? " % ;a> <@ F ʦ  `  '㿘M" @  ` - +M@ @ M@` 0 M@ x XM` ` 0  '% '?%>: 8 $ %D    7  "M"    ?T ?ɐ?M H$4?  @  ?31 `1& :> = @ f% @?2 @  @  ?3?1#c & :> = @ F @`` '@㿘`` `&`` 2 @@b   "c &?@``"  @c ? `@?&`*@``&@`  @c ?8`#`? 7"7''''@HA*@@'L'P'T'X?7"7''#''@H*L*@㿘 @? @ޖ$: x N   '@n$ y ' ' # @ג@nr$$  y $ $  ؔ$ :@(㿀@n_'''' '@Q$OpenBSD: clnt_tcp.c,v 1.16 1998/05/19 06:58:51 deraadt Exp $clnttcp_create: out of memory `@j M@j d 2 M Hy@GHb  "b # b}"` 2@ *` 26 @j0t 6"$   @$ &@k  @     "b # b"`?O @mK $ $$ $ $  $  $   @ `@  @ے` @֒`  ``  @9`   H ,H 0 #`  #d   #h #l?@   2 ` 2`@  #㻐 )@$ @?@ `* @4 `*  2  @ 3   ܤ 㻐  ' %? !@I$ @@`* @4 `* 2 ߐ  h'D'H  'Ԁ @4?"?  耊 'H"$'Ђ '''̴ < ` Ѐ@ܮ  `  @6`)H7 ,`  @'-Hc, $Ȳ DHHc, ɑ* `t@ |   )4?`Ȁ`#  @`H#(2ހ` @  @ %# & @   H "#(J@a' '# D H'@"'H`   7# @gD  ސ"7ޑ*  @ @l 6,̀`) @d'-@* 2 ' 77ހ# *@g2  ސ"7ޔ*  @  @=` b&""(# @f ސ"7ޑ*  @@# H#( "` H#(  @  @ %# H c$` H`c$Hc$  # @Z  #H c$# DH@ ٖ Hc$   /'7# @D H c$& # DH @ښ H  -`*'@^c` '耢 $''#   @@2  y  # `3`( `@-  @&@@d-  # 0a2&  ]'А '#  @؀ P'@ @'`$ ( # `(2 DH0 #     2 `-@da` "C` `  " @V'u-Ȁ`` `!H@FHc0 " "DHHc0 /* |   )4"?``@7,``&+` @Ȁ`  Ѐ`  ="c  <"c "# ?㿘!H#  @e?$# H"#$H"#( 㿘.`` .2  ,`2 . @\2`@MD,4 . 2 @\@M: ,`6 㿘@- # $bp?# %@L 2b` ,4 @-2"b$bp ?#2` @ bp`  4bf 2bdbf @Lb*   4bf@-# $bp@LUc4 $$bp#Ƞ ,2 , 2 @LF*   * 2  , , 2  ` @Lڒc  ,2`} 2bhH2#8! "t@4˒  "tH "bl:  ` ? 2:㿘! "t@4 H#8!/@"t bl 1 u1 "p "p@-1&"p"p2&"pH#8 @!/@ `4 # ) ' %"db`@[_ f@L 4b` "hH8 b`28! bbH:@ . 6 /&fLOCALDOMAIN/etc/resolv.confrbf;#domain lookupsearchnameserversortlistoptionsconfRES_OPTIONSenv㻀 ' `` "` 2 $ 2$"$$ , 54 $ $`c d<+  @$d@d 2@@b# 9`@ ,_ '$DL` H\ N   `. " $    N 뀤 N" . N   ` .$#@c ! "c@O />>H.@A #@dac@D.@ 2.O c@:  *O  2$䀣`2אN "  " N "ʐ ǐ@  -a_@cذ 2. c@   BO  <  "@B N   L y b f @*!  , `L y b f2  @ `*a "`Ѱ rc@Ĕ  UO  2O䀣`2aN "  " N "T Q@ -a_@t 2.%`D Ka@ `H? N  `. " $   N  N" . N  ` .$ c@j *O  2$4!N "  " N " @.쀢 % - 55`@;  oO  i ذ)'M-N "  " N  ƀ ;Ā #*`@:` 2NN ;  ⌐@  2N N N@. +#@$!h "!h.⌰ NN` `;`  " N@. !h@'$!l  .u`@ǔ  nO  h@u`b "  d*@ *` @"d  L`` @  @n . `` @ ,a_* !$ "!$ $ N  *`:  . Nd  !@?:$` @C . $  $@bL    @  " @`q @`0 `` "` ndots:debuginet6㿘N G  #*`: N "  " bh@/  @M `!d*` < $!dbp@   bx@  2 N  $ N" N N  ` N  0 ???㿘?   H@ . \*`D?@ @:??(@`@/ ,- `. `\2 (@@:)?(@`(@`<  ?!? (  #&  ? `(@!㿘  @ @ 2` B ?@p   ;:,*`" 7* ?@$@`$@  ,  .\ $ ??"? >*@*,2$? $      ? * " ?  M @I*`P㿘D`4 ` ' `?8?, ., \"  А < ` "&`."  *  @ `Ц &*?J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿘N * N  .   㿘N   ߀ ]`. `\ " N` `. J߀](J    (  ((*`  2 *@*`2 *@2 *`2 *`*`㿐@ ?㿈'M⌐@  r `0   N x X   *`:  ⌐@    @V6 ?`*`: ⌐@  D *ɖ@ `. 􀤀8 $*`:  " -M"@  '$:  `+ *` 0?#* ?# *`* @  * * *` `2&@ %s: 㿘M H`8@9aH @9@9xaP%s: : %s 㿘M H`8  @9fa  @9є@9\a!@!@9T  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~I* R 㿐@.2  ?&㿈 ' ''  @_ ?2 $x `@$ `@$b `@$! `@$OpenBSD: xdr_ypstat.c,v 1.4 1996/12/14 06:49:45 tholo Exp $㿘@$OpenBSD: xdr_ypbind_resp.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@k " @  2  @`@`$OpenBSD: xdr_ypbind_binding.c,v 1.3 1996/08/19 08:35:00 tholo Exp $㿘@Ԕ  `@Δ  $OpenBSD: xdr_domainname.c,v 1.3 1996/08/19 08:34:58 tholo Exp $㿘@_ @$OpenBSD: strpbrk.c,v 1.2 1996/08/19 08:34:23 tholo Exp $J H ? 2H  J  $OpenBSD: strcat.c,v 1.4 1996/08/19 08:34:10 tholo Exp $H" @ J2  @*`( $OpenBSD: bzero.S,v 1.2 1996/08/19 08:17:56 tholo Exp $ `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*$OpenBSD: strerror.c,v 1.2 1996/08/19 08:34:17 tholo Exp $㿘 @b$OpenBSD: strcasecmp.c,v 1.3 1997/08/20 04:13:57 millert Exp $  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  @ ` @ `     @ `    2  $OpenBSD: atoi.c,v 1.2 1996/08/19 08:33:24 tholo Exp $㿘 @\ 㿐Y?@Rs 0 @" &  @@"& 0@ZD & 0& V & @Z<  3\@Q `@Z  ?@Y`2   6 &  C&&  & 2(" 6 &&   &  &  & & &  ܐ!"`T㿘'H'L'P'T'XL#@6ҔH㿐@G & @Q  @+! 66 6  6 &  & $!4& ,!& (!`&   @Z $OpenBSD: fgetln.c,v 1.2 1996/08/19 08:32:29 tholo Exp $㿘 H* D  @Y "?& D& H 㿘 4@ 2G&@@D$  $&@ $@4 "5$ Β`P +$@D@\@t 2&@@C  @$ @ 2&@D@[$"$&@D&@ $OpenBSD: xdr_rec.c,v 1.6 1998/05/20 23:50:02 deraadt Exp $xdrrec_create: out of memory 㿘@Y D "M@$ <@$ @@@X   $ M H@5`0#   $  $ (I"<& & $$ $ $ $ $$ 4  $ 8 ($  $ $ $ 0$ ,` $ $ 㿐 4 ,0"  @&@4,?"4` ",@%   &@ 㿘    & &  & @3 2  & @ "㿘    4   8 2 @g 󀦠  @> @ 4&"$ 4㿘"    "   @[@ &   $ $ @  2  㿘`   @[_  ?@  "  0 ?  "  ," &㿘 ?'"   0   "    $  , 4 "  0   (  $ , " $ 4   "  40   @" @   , 0 "   " 4 " , 㿘 @W @W㿘 @ "  8  & 4@ 2 4   4 4 4 8 " 4& 8 㿘 @ "  8  & 4@ 2 4  4 4 4 8 " 4 , 0 `?㿘`   2 "  *" @   # ? "  " "㿘 ` " ?@?* "@   "     $  $ 㿘 ( 0 $  # ?" & ,& 0 㿘$  0 ,     4@Y۔@ ,&& ,㿐   2 & 8 " & 4  㿘`$  0 ,  @ ` 4 & ,&@  c(/  ?$OpenBSD: xdr_array.c,v 1.3 1996/08/19 08:32:02 tholo Exp $xdr_array: out of memory 㿘@ @  "B @ 2: @O @`` ' @V  &@M H@3>a  @Z1 : @  @ @ @V@&@㿘 :     @ 㿘 @  $OpenBSD: xdr_ypbind_resptype.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@ $OpenBSD: __strerror.c,v 1.6 1996/09/25 08:17:30 deraadt Exp $㿘 #?@@<  0,@Pq  4?@@0  0,libcUnknown error: 㿘 x@ܒ Ic| ,   @@ .  ?@@ . @Yu "@@ѐ$OpenBSD: strtol.c,v 1.4 1996/08/19 08:33:51 tholo Exp $㿘M" @  ` - +L@ @ L@` 0 L@ x XL` `` 0  `' #@?@O` $ %  /  "M"    ?2 ?ɐ?+&`&?  ?1 %  @NN&?  ?#%  @N< @Ƣ``&@NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC㻘 "?N @ / @@W 2 @U#Р 2#@Uِ   !cL*`:  :a %V  ?* :  (H* =>=>>>>>>>>>>>>>>>>>>>>><>>>>>>>>><>>>>>>>><J@ !:   @*`J@J@ :  @*`J@:   *: * L  *@?2 L 2 L ?0@& ?,@O~ @W1$?   @W#\@W%?2???#@ @Tv  && @V?㿘2  >  7   @40@08((@ @ @@08((Ҁ6@@6Ժ҂㿘?   "c  ?" @V @T7 $OpenBSD: errlist.c,v 1.3 1996/09/15 09:30:59 tholo Exp $JJJ`JPJ8J JIIIIIIpIXIHI0I IHHHHHHxH`H@H0H HGGGGGGGXG8GFFFFFFpFPF8FEEEEEE`E8EDDDDDpDXD@DDCCCCCCChC@C(CBBBBBB`Inappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$OpenBSD: index.c,v 1.2 1996/08/19 08:34:02 tholo Exp $*`:`J   $OpenBSD: strncpy.c,v 1.2 1996/08/19 08:34:22 tholo Exp $ @(`(  (02 @$OpenBSD: strncat.c,v 1.2 1996/08/19 08:34:21 tholo Exp $J H2 @ @((`($OpenBSD: pmap_getport.c,v 1.6 1997/09/22 05:11:08 millert Exp $p7ڐ?'ܐ o6 ab I܄!'' @|#\ . ''''I## '' #\@#\ڀ    "b b€`  ڀ 2   "b  @܀?"6 @Ss6 ځ$OpenBSD: pmap_prot.c,v 1.3 1996/08/19 08:31:39 tholo Exp $㿘@Ւ @В`  @˒` @ƒ`  $OpenBSD: clnt_udp.c,v 1.15 1998/03/01 10:05:33 deraadt Exp $clntudp_create: out of memory X\@P  `M H@-bb ?` ?`d@Px@  ``M H@- bR $ X@"q    IE *` TI6 #$$$  $  $  $  $ $ $ ?$ $$ ($ T@$ \''Đ '''в 8 X@ @S +  < @$ P 6$  ' @   '  "b # b"`@  b~@R$ @P$$  @P+ @P& 㿈b`''#\d'D'H'L`( ?\@'P``$'P`('T@`!ؐ` 2 * @OϠ     @SW'|'x&`8`8 `P€`X@ 2@`€H D € L 2 ؀ @O  @@`X `@4`  # ؀&`0@O P 2'T 2 '؀ @O 'p   # ' '@!i'Ш"??/!ؒ  @ 3`( `* $@`@ ? 2T'Lx`@|'`` @@'d'`@'d`dP'x '|T02c Kh@!. hpl"@t'`"'d'`А"@'dx`|@d'X'\`'X'\X\P'x '|T"&`,@O&`,l `` @`\@L c "'Lc #&`0@O &`,O}`X``@2w``@ @ʒ ,@<`,`,  D €  &`, &`0  $@ND ` @  ?&`8 @''&`,؀"`,@N`, ,"@0"`4"`㿘  " 8 8@* `(WtWWWW" $" ( $" ("" "  "  " " " " "   㿘   " <@P < `@ 8@N[@NY$OpenBSD: bindresvport.c,v 1.9 1996/09/15 09:31:30 tholo Exp $x ` '`   ."c D? @Q / .``  'ܐ  @ܰ , 'ؐ  @  "@``!  #   @  &$# 0 耦@ @䀢 &$#  $OpenBSD: auth_none.c,v 1.4 1998/12/20 23:45:41 millert Exp $㿀! # 2  < @*D @ 2$#.  < * c& c`& `  (&  & & I& &  @~ @9@6   @& <  `@㿘 #`  ``< `(  $a `@$i `@$ `@$] `@$ `@$v `@$  `@$h `@$OpenBSD: xdr_mem.c,v 1.6 1996/11/14 06:33:13 etheisen Exp $`"JI" " " "   "@     " @   "  " +d d( ( (d"@  "  #"@ #d dd** * *   "  #㿘 "  $  @O`  $  㿘 "  $  @OM  $       4 " ""     $OpenBSD: rpc_prot.c,v 1.6 1998/03/19 00:27:21 millert Exp $㿘@  ``@Ζ!㿘@ 㿘 @w` " `    ``€ @|`  @u`㿘@V " @   @``  @[`@?` 㿘@N @1` " ` 2  `J` D@  㿘&` &` 2 @+ @` @!`  @` @`  4* bbLbXbdbpb| "@ "@ "@  "@ "@"@ "@"`"`   "@ "@ "@ "`"`㿘    &@  "&@ @ ڒ@ &`@ "  " 0 " 0 &` &`&` &`$OpenBSD: xdr.c,v 1.5 1998/03/19 00:27:27 millert Exp $㿀 ' 㿐`"  ` 0@ '@€  &@  㿐`"  ` 0@ '@€  &@  㿘`"   `  0  `@€ 㿘`"   `  0  `@€ 㿐`"  ` 0@ '@€  &@  㿐`"  ` 0@ '@€  &@  㿐`"  ` 0V@ '@€ "   6@ 㿐`"  ` 0@ '@€ "   6@ 㿐`"  ` 0V@ '@€ "   6@ 㿐`"  ` 0@ '@€ "   6@ 㿐N@'ǒ "   .@㿐@'ْ "   .@㿐`"  ` 0@  @ €'@€   @ &@  㿘ɒ㿘' "       c         J `h`?xdr_bytes: out of memory 㿘@c "3  2,  "   0"   @Ic&@  M H@%b    @Is&@㿘$㿘w "   @   2    €xdr_string: out of memory 㿐 @   "7 @L' -8+ `  ` 0!  2@H&@  M H@%` ,@I&@  㿘?$OpenBSD: qsort.c,v 1.5 1997/06/20 11:19:38 deraadt Exp $㿘  `@ `; @A@ @/$ (``@$&@6? ""$ ? **$ֲ$΢@6`@AR`@AK`(r6`@AE-    4  $@ @   4  -%%    4      4  ``@&$@6? "" ? **@@/ 4\2(` $$`6? "" ? **Ґ0/ &.2($@` @$@$`6? ""$ ? **$$@Ґ(``@$$@6? ""  ? ** $@:@?@@/$ (``@$&@6? ""$ ? **$ֲ$΢@@?Œ$$ 4 `$2  ? ""$ ? **$%"@* `%2  ? ""$ ? **$( $@@.ז$%@@#в㿘@ union8@k Ӱ @A]   <    "c  @N ?@F] @$#"`@ܒ  c@      @Fs 2 {@FP0w%@  @$䀤``@H@ 2 & @F2@F0e &   @```$@  @ , $ ( @Ζ⠑, $   @  "$  2`2$ 퀥 @E   @E*    & $@& & @E & @Eא@HP  & & && @& 㿈 c c ' ' '  @Ik ? ? #㿘 @& ? @E&@E@H$ `@$OpenBSD: strncmp.c,v 1.3 1996/08/19 08:34:21 tholo Exp $2J@  J ` 2J@ $OpenBSD: strcmp.c,v 1.3 1996/08/19 08:34:12 tholo Exp $  J@   J@J`  $OpenBSD: merge.c,v 1.3 1996/09/15 09:31:50 tholo Exp $㿀'D'H 'P  "c ;? 'D ``?'H@=ߒ@D  D(?HP'@# @''` ?   H@=Ē'` ?@ ' ?&@耦  ?&쀥@P@ ? `2@@QP@K2@ '@ %@P@$P@4*(',@@(%%@@>2 @=\@P@4@@%@@P@4<"`" $ $ / ,  , !`" $  $ ,   , W`" $  , 䀥`" $    ,  `#@ ?耦 ''` ?@ 'D@ H@<@HM@C 㿘.@`@< ?@$ &@<@%@ @< ?@$ 4    4  ` `` "@"@  @, *@`$ P)& 4  " &@"@ @, *@`"@ **ݢ&& @, *@`"@ * $   $@"@ ?"`? 㿘$@ $ , *$@@8$@㿘@㿘@B   " "  " * "  c@""@?㿘`*` #@  @   2  '  @  @" :`  @Eؖ  & &  $ @ "  @@B$@㿘  @&   22 &   2   2    @D  &   @ 2   "   & @ "   2   2  㿘 #  $c  c  @E! "&& $Ą `@㿐@  @   ``  @  "c  @9  6 `26 !6 6 &  & $!4& ,!& (!& $y `@㿘  ɔ@FT 㿘@  ? ?$  @`$㿘  @:#㿘 # @9  $  2 0    "c F?"  @: ??$  $  ?4   4 ` @@" <@A͐  <$ 0 $  8 %$  2 @8ݐ @Bѐ!   $ $$  ?Ȑ*@ ` 4 2  $  @4  Jr  wa          &  "  J+b  J +    "@ 㿘V    "c ,?` @9 `" @  &? " 0@AP  0` @@"& 0@AG & 0 D "6 @A@& D6 & & 㿘!ɀ@"   n68@o@ n68@ @  n68@F_@   "c  ?p" " " " " " %$sniglet^&8`    "c @]!ܢ ?$a $ad  @  #   c ""c   @?$a #  @    @ J K 2$a K!$a a@B!?! k# 2i O@!a@2c O`?  !a € `@ "`T O`(@:@$a@ 2T a8`  ` *@ D* `: $a@C* `@@  $a0a @ $a4?$a$@@= $ 2& ! # @ِ#$#  & "&  & "0& "x& "(&  &   &`@Ba@@< "#  㿘 ?@ @@. " ? ?   ?8 $ 8 $ $  $ !$  $ $ @$ 4 DK  @Ct$!  Ē @Cp @` @ 9 @ $ $ - " @ $  *@@@$  2$ 4 2$!  2` ဢ@ d"  "c   $ @  㿘 4@9Ӑ  & @  *" D*" D&  & $* `, @M ?& 0& (.`& , ! 2 @9& <@ j  , 4& @ 㿘 !4@   # !؀ !!ؐ?&!* @@?n!??&!@?g!@J 2! # ! 6!a8 "!@?R! `!?@A@?E  "# ?㿘`  "c ? "? !4  @ T  2 ?@  2?&!0 㿘!4 8!a& & !! € & @  ! @B?"#?@A*!?!  O"c &!,? !8`" ``Ė @Lt  `  㿘  @@   "c #!,?㿘   !   "c #!,?  @ 㿘       @    "c ",?㿐 @ @  ?P `` -`  @G`   % 2  @H@ G` `  @  "r `݀@@Ol +2 `'@O* 2 `@ g "V `  S?` ` @Je E?E ` `B `! ``+0/ `5 ,`@  @O  & " &@H 2 `@J0  `?@H  ?0 @>?? ` ?-`㿘     "c $!,?!$  $!$ $!($!   ! 2!!$ ( @ "p?$!   ( $!( ($!$?$!$^ !(*`   2*` @ $! $!(     !$$!  $!$"!  "! !*+`    @OϘ  *?0)!    &@`  " &`(2`! @   & " &* 2   $! !$$!( $!$$!( 㿘 ( ! & (4  0@   @  !ؓ**@2 "-?&  @  !ؓ,`" "?!! &!`&! (@   **` `D" D&  ,(& 0& ,@G㿘@<א  @AG @@b&@<$㿘! € , (  0㿘 @C   &!  @<.@   ! # I$# ?6  *!ؑ** "@ ! &! @< :'`'d'h 'l'p't'x'| ?"@ t  'lt  |"x`'t#'x| "'||"'t'd'`'| 'l#'x'p| ဢ@dU @<;"$ V @?˔"$?$a|$a$at$ax $$a@<*$b D$` @? $a"&b  $b && "& !p&  &  `& #& !& #p& `    "b     $b @ ߔ  $aaА`  @j?$ab  $b aВ @Ɣ ?`a@6 `Ȁ wa@>4  䀢  L!b@b ?F$b  $b \'\ `/ `/ `\//'XX `/ `/ `X//'TT `/ `/ `T//'PP `/ `/ `P//'LL `/ `/ `L//'HH `/ `/ `H//L!b@   O?"@ _2| 'pb  $b $a$bp `؀!'p"'pp@ 8'p` 2$ab  $b $ab $b $b p$ad` p?@ `*  'dpd* @ *'ddaؐ?@4?l@4?4aܑ* 2   4aaА a@ +$@b  a@P@@3?b  $b  b  $b @b  $b     O"c ` ` "a@;aЀ?@=x@: 㿐 @ڔ    2 2   @  "c , c 2,?"c @V  "@P   2?$$ $  4 !ڐ4  $ !@>& @3  @. 0?TMPDIR%s/bt.XXXXXX/tmp㻐@= @;.###@}$?' @=@? @< @= @#d d 0 $ҁ#㿘  `"" @ޔ & "  !А "c ?㿈  `@ɔ $   "c '?@ ? 2#\@@    @!"  @@ 0@$ P" `2@0' `. `. `..' `. `. `..' `. `. `.  . ' `. `. `..7..7 . `䀢.?P2 * 2   ܚؘԔІ*2  7 * *   '.  *`*`*``@' `*@ `*` `*`*`` @ `@' *@ *` *`*``@' *@ *` *`*`* 2  *0mk* 2  g ΰȞĆ*2  7`* *   ' .   *` *`*``@' *@ *` *`*`` @4`@'*@*`*`*``@'*@*`*`*``@' `*@ `*` `*`*``@' *@ *` *`*`* 2  *P" `2 @0 `?O2 * 2   *2  '.  *`*`*``@'*@*`*`*`` @ `@' `*@ `*` `*`*``@' *@ *` *`*`7*  2 *怢 *o`2l* 2  f ܆؄ԚИ̲*2   ' .   *` *`*``@' *@ *` *`*`` @1`@'*@*`*`*``@'*@*`*`*``@' `*@ `*` `*`*``@' *@ *` *`*`*2` `7ʐ* ˑ2 *`ʀ *`' `. `. `..' `. `. `..' `. `. `.  . ' `. `. `..7..7..t#t** *  t * #pp*  *`*` p*` l#l*  *`*` l*` h#h*  *`*` h*` d#d*  *`*` d*` `#`*  *`*` `*`#㿘 ``@@? $`@/ ?"*?@@@?"%?` "a@7$` $`a "a@7$a$aaȀ "a@7$a$aa@7@7@:  ?㿘  ``@ $ `  "c ?" `  `@? ?@ " ?$" 㿀 @I L!b' '!'!Ԑ'"'"   @;'@ɔ  ?$  `@$\ `@$OpenBSD: memcmp.c,v 1.2 1996/08/19 08:34:05 tholo Exp $" @ `  ?  2 @ @'P'T`'X#?7"7''`P'''@ߒ`*㿐 @3 ?㿐 @' ?㿘  @  2㿘  @   2㿘8`  "c L 2 $?  "c @9L@ x  0,?@0 L`XL X`?#@ @ 4GA,?L X` ``%<'+  L/2?,@' X, `Q%c 8L`*@!  &@D , A, a, # 5 " @ !  # ' @  #  `? aML Z2b" ,  @ ` ʀzŀ /dev/arandomx@ !@Œ @8: x@8p ?. .    @à .    *` * 㿘  ؀    8 ***   "`  8㿘  ؀   `8 `8 ?*`8  ,   @ ,   *` * 㿘  ؀   `8`8`+`8 `@ `  +   *`   *   `8 `+`8 `@ `  +   *`   *   `8 `+`8 `@ `  +   (*`   *   `8 `+`8 `@ `+  +   (*`   *      (   @ >` `:0p(*  *  *  *  *  *  *  * ؐ  㿘 "   "    ?@6@ !ؓ*` -   ?!0   2@$   `?@A  - $  "` "@!& !&$! "㿘a a  "@4W    @7 @4O` & @4q ` @7ڒ a t?r$a "` "@ 2   "f&  @ *  ?  @A֘ 2d  `" `a0 `aؑ2* @ `2*`*` *`*` # *`#  2 $  + 2(&  @ *  ? @A 2' $  , "` "@a $ a$a"  "  2$ & & &.  . a& a&$a " @ :@`! "! "!㿘! 5 !"1    `    @AD 2?`"  " @7 @3  "` @3"!2  "`@"` `*` `@ !"`!"@! ` h ``"b @@ $`b   "`(    `    "c ?`aܐ : (`@ ?' '@7 ܒ`@7 ``aܐ @ ?Ԑ' '@7 @7} ``aܐ ΐ2 a@`@ "?(`  @Ш 2 @ ”Ш ?  Ѐ @@|  Ѐ "b "@b?2 @@f ?`   ?  "@ @ #\@ `0j* 2  ,` `"@7*   6 "@6 ,2  `& $ ,@ `@6`@6`(@  2 a`@2a`  4`a䀢 2@  2  ?2 ?@2@ $a 4a쀢 2 @2@ $a4a$a@@   2b  @ b   $b 㿘!@ E 2!I&!& 6 `   ?  "@ @*7&!!䀢 2   2.&!*2`2 ?@2&&!@ 9  &&!  6 6!6!  2&!* 2&!@ "  4&!6!쀠 `?& @   㿐  `"" @  $ "  J   C @@A   7 ">  @ Δ 0' ?2   @0 2+? @F 2``  2 @  ?@ :`?   "c ? "  $" 㿐@@ & @ Z " @@ْ ,` \  @ !?&! "9@ h "ǰ  ` ?2 ?@2! @"@!2 !  &!2 @ @!"!2 ! @ &!@ 9 % ,@ Ɣ @ * " @@2`@@t@  @ 2s @@d ,` ^  @ !?&! "@  "R  2! @"@!2 !  &!",2 @ @ @ h @ ̔ `!"2`!2 !  &!@ O @  " @@2`@ ? @  &@`?㿐 @h 2} {?   @ ! q`? @  2W" `?2  2 @^ F?0W@  S   ?2@@ z ِ ` ?2 @" ?# `4  @ d  @Δ?"  " `4 `?2  @ Ŕ  @  ?@   ?@ ?㿘?#! ,@&! "u@@  "? ,@ @  @  ?"i`?2  2@@   4`!4` J$` @ 2f?@  "!^?` ?@ @@44$ ` *``2`4`@  ?# :2* 2  `?2 "?*  + 2  *2*  `?4`@ , @   @ $  @  ?@92  @  㿘 (@  . @.  .@u 2p?.   @ [ ?"b?`  @` @ P@ ?2`U?`@   ? @@3$  . *26?#`  :?2?* 2  ?2 "?*  +`2  *2?*  ?6 (@  2   @2  ?6  㿈  ` ,`"  @'7 #\ @n2 '7@ 2 ` W,`?2 ?'7@ϔ  ` C,`2`"@  %' 2@7 2 `" @ % ?2 ?2('`"$'@  2'/?7@ 2 ` ,`@  $@ 4`@  '7 #\`  @  `  ,`㿘``"`@ C "?`"`@ Ӕ ``" @ 4 2`?"`@ Ô  $ `@$ `@$ `@$ `@$t `@x\@` 7ސ@ @``"4`*`@ 2``"  @  $@ , $@  $ , @2/@2)@ 2!"  @  ?@ H P@3?"[! ,@&! <@ "G    7 " 0? ; = 09   7 ?!`   ) ?  + ` 2 *2  (#` ? ? ' ' ' '!€ ?:    @.``"@ @@  @a @`Ժ  ޑ* 2  *`@ `" @1*`  4`  "`  0 = `0`ސ" 4`*@ 2* 2 @@1bw$ ޒ"@4`* @2 *`2`@ $@ $@   $   , @1B  W` @ǐ?{`0Oހ ?* @  @  @` @$$ *``@ $4`2`, @4 $@@*$  ?* @  @  @`  ?2 $$ `ޒ"@4`* @2 *`2`?2 $@ @ $ @-C`"@ " @˒?@?@ @ !@ @  @ @ @ @ߔ S ?㿐@  b 4`$@4``$`@$`` $` ` `?2 @ @&` 6 7&C&@, ؠ @ 8 @/ @$@$ `$  4 4 ` $ ``@ 2@@,  "`@ @š@0G"@+&&㿐@ @  $@$@$`$ $ $` 4 4`!ڐ4 4``  $ $` @&&㿘!ڐ?6``6` @ ?2 @$$ `?6``6` @ ?2 @$  $ ` 6` ? &` @ 㿘!ڐ?6``6`@ &@  $, `  & 5`    ?" 6``6` @ &@  $ , @/    @=?  ? `  " 6`6`` @@/$ @+ 6``  ? "` @  㿀'T'X `2`*`2 @ !7?* 2 w2 ' ,2 2` X6  "-   - 0*  - 0$2 @ @ @2 @ @@@`    - 2 @   @2 @  @ @   ?@+,2   -2   :+- 2 ?  # *  '"6 2 @/* 2    ` ,`- 2  ,2    @6   , @@,  2- 2 @:# # "2,2 T @"3@ - +`@K2 - 2  `   "*` " *`0"  "*`0@ @ @ @ @ @    ?*`@   @@ @ @   ?@* ,2 " 62 @., 4  - +`2 ,2 @6 6㿘@  " ?`  "` @   (0*``0(0 㿈  `"@s $ ` "*` LhLhhL(h( ( @@&  "c ? @i#\!@>!Ȱ" @@3 0$ 㿐`e#*` <     "c K?@E @k "=?`?2  "` 2 &@`@ @ (6`@ %  @K "?`?2 "`  * @ @ @Δ &@`?2 ?6` 㿐    @XT @ E "# E&@  "  ` *`2`?2 @26&@ @  @ " &&@ "    , &@  6``2 @x 2 @ؔ 2??2 ?&@6` 㿐@ 2| "Y" q' '@  @D ' ' 7  & +@@- @ 2$@2C? @ =??2 4  @4  @@ &  ?2 @2 `@ `2 @R 24 ?$&  &㿘  " (@(W& &  (& 6  . ( . (㿘 ,&!  @( 2& l ?2 *   , 2 6 @.   "A!&Q, `?, 2   ," 2%&-  -   @[ 21 - 2`?2 @2&  @# 2 &6  , 2!"@!2 ! &!,2  @ @S 㿐`@ ' 7@Ô @9   @3 $  $ &㿐`@ ' 2@7 @   @  $  $ &㿘`@* @ \7@    @ 2l?(`2@ " @"@ @ @ @'0  @'n "Q?&&@+ && & "@   `` @ 2?.@`2 " @" `  @ @&  @'4 2'@?  '`@ ` @+Z  ' @'  ' 㿐    1    *    2   *      ' '` !@F!̀ "!?'!€` 8 @  " ` `` @ @    ``@㿐@*Ӕ `@*ϔ & :! @&L  @& 2&$?'!?@H 8@*@є " '@' 㿐@ !ت `?@l 2&`&?&`&` 6`6`&@`@*x @"`@ @@&@ۤ@  㿐@*[ `@*W @ 2` ? "!@x  ?`@' @Ҕ "' 㿘"`!@"`" &!&" @S 㿘!Ԁ`@ " !&@ " $!Ԑ $" @A 8@ x ' <    "c   @ $(  &&   "`"` `&$  &$&$&$"$"$ "$$mpool_new: page allocation overflow. 㿘$?M H@c@&@0 , $ &$@"&@" &$ *  *    ""` 2 "`" "@" " 2 &" & 㿘  *  䀢@ ""`"@@ & "`  @"@"`@%  㿘@O ?  *   "`" ,"@$$` 2@"`" "@@ & "`  @"`$ $ 2 &" &   X,&"@@ @$ $@'Ɩ2C @2@ $@'$$    "c 2 @(  $ , `,  *    $$` 2 "`" "@$ $ 2 &" & $"$$ `*` *` 㿘 @ & "`  @ &"`@$e 2@$_ 㿘  "  @b?" ? 2 @$  ?㿘$$ @*:$"6$  2.  @??":    *  @  ""` @ "@ @ $ "`  @ "`. $"2 $@#ڐ    $@'i & . $ $$ 㿘$ "$$$``$@` $@&ۖ2?@2?$`@%$$ ?` .``("  2"2 $_ `@$OpenBSD: calloc.c,v 1.3 1996/08/20 17:42:33 downsj Exp $㿘@M@#m  @&㿘'L'P'T'X@jL$OpenBSD: vfprintf.c,v 1.8 1998/08/14 21:39:42 deraadt Exp $㿘` @ &`&`&` @ ?7 7 ' ,'̒''$'''@1 @U 2? @  @4 InfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.㼨@t'H `'  2  @   "c @?   HV H2'8 '''''$<@  < %? $$@'  'd $'$   '?/+N `X"ē*` (DL 4 , @           P   $  T     T @h (O+ 2N /+`L ?Ѐ  , * ?Г*`:`L Ѐ  L $88  '8H@r88`- @ `- @ `6_N [` +X/+N*; L ?Ѐ  , * ?Г*`:`L Ѐ  L $88  '8H@188`- @ `- @  &?N * ?РN Ѐ (, $ & ? ` , * ?РNЀ  $28 '8H@8N``@N l2` ` 8`@- @  /@``  `''8`@ `- @ *  : `- @ :  ` ` -[/+g  G`" `8`- @' ' `- @' '̴Ȑ@ a L?  -/+  @ :  y a#\,#`7@@0gGe0?$ gg E e ef0@{'0,'` `00  `O7`,@ ` O7``  " O7 + -)/+`  8`- @ $:`:```@ `- @& 28`- @$ "``  `'' 8`@ `- @  `- @  ~ 8`- @   '@  xm 8`- @    @  "@$/+@#``  `'x'|x 8`@ `- @  `- @  -   ؀`  ''X'\X` 8`@ `- @  `- @  ` 2@ /+' O'`"- `30? ` 0, 4` 4  ,`6 04 01,  @`0,  3 ` `0,, 4` 4  `  ,'!@# '?٦@/@ /+&O+ `2`2O+&@ . L$ $@'  ' ? L$$@'  '  O+  +$ $@'` 0/8/98$ $@'  ' { ` 2&@ . L$ $@'  'ƒ ^? L$$@'  ' H  - L$ $@'  ' .? L$$@'  ' a e$$@AL? BV0!0$ $@' 'Y 0,@`` $ $@' '? פ,?  L$ $@'  '% ? L$$Y@a,!0$ $@' '  $ $@' ' 0  - L$ $@'  'Ւ m? L$$@'  ' W,$$@䀢Q$$@'  ' <0,"@ - L$ $@'  ' !? L$$@'  's  `!8$ $@'$@ '  'U !8$ $0@' '? פ,0$" $@u, 4 `"U$ /8 ./98$ $@'  ' L? B ,$$@ '2 ,? 6 L$ $@'  ' ? L$$@'   $@' 'ʒ b$$@'  ' O`/&@ , L$ $@'  ' 4? L$$'``'  8@&$ '$w 8'耢 k 8'8`@" @͐  @?$'d '`  @ *   N%c  N `XYǐ#*` (d(d(d(d(d(d(d(d (d (d!!!!!!!!!(d(d(d(d(d(d(d(d(d(d"h#h(d#h(d(d(d(d"(d(d$(d(d(d(d(d&`(d(d'd(d(d(d(d(d(d(d(d(d(d"0"l#h#h#h""l(d(d" (d#$%"((d&$(d&d(d(d'd N?Ѐ $*@ *`L@Т`L@Ѐ @L@N*4  N?Ѐ  *@ *`L@Т`L@Ѐ @L@ $` d@`d* 4b`d@`d* 4WVNЀ TNЀ  M * * ?Ж NЀ  $?: 86@42 `d@ݒ`d* 4N `d@̒`d *@ 4  Nd@`d *@ 4N@`d@`d *@ 4Nd@`d* 4ަN`d@`d *@ 4ͦNd@`d *@ 4N `d@n`d *@ 4Nd@^`d *@ 4N@`d@M`d *@ 4Nd@?`d *@ 4~N `d@-`d *@ 4mlNd@`d *@ 4]\N@`d@ `d *@ 4LKNd@`d *@ 4>=N`d@`d *@ 4/.N`d@`d *@ 4 N `d@Β`d *@ 4 Nd@`d *@ 4N@`d@`d *@ 4Nd@`d *@ 4ߦN `d@`d *@ 4ΦNd@~`d *@ 4N@`d@m`d *@ 4Nd@_`d *@ 4N2N@#* & ?ddʘ *"@ 81* )t)t)t)t)t)t)t)t)t)t)),)t)D)\)t)t@'`'`@'`'`@'`' `@'x`'|``$d`@@ 㿘@  * @ϐ&@@@@&@ *@S$ &@ 㿀?&\`f'  `e`E  LЁ 9/ -/$%#\?@ =?耦`g`G`f"`fN 02 @LЁ B  '@@@LЁ B3' : ` 0*  '`""@``,  - +,  ` @Y  0.@ ` `0.􀦀.   & 0. `0. &㿘` ` ` 2 @@/   "c ?@`    "$`$`, ٤`$" &`հ u " "` * : 2 ` `:` @``"@. `*. `@` "` $``$@`&  $`$`` "`*@@{`@"$`@$@-@`@ @i@@@$@ }`` ``, p`@@N`@"$`@$@`$" &`_   `  ` @5 "@  ``@`  @@@@$@ *0` ``, 0  @@`@"$`@$@2@p   `$" &` ` ? @4` 㿐@X 'TL!@  '%?T 耦 ؀ 2;  0ؘ'Ĥ744`4`44`4`45 5 45 5 `A ڸ? 28```@v@8`*  @l@.`*  @b@$`*  @XT  @T ;--`2 @- ,`‘2 @ Ĩ  ``"`` ?`   . İ?3 "* ' #@'.`@ '  @@  @?   '5@, @@@=, . 2`   ?#  $. ?@$, @@ "@"@4@6`#?# "6` 6 *. @ ?  @4@ 6`6Į`@6 T " @ " . ?:@ * @2. 4@T*  *`@;Α*  Г*`@ +     ( 8 2+ ( 2;`` 2` `?@2 2 #;` ` (``?#@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  $OpenBSD: memchr.c,v 1.2 1996/08/19 08:34:04 tholo Exp $"  `  ?2  $OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $X@V+  2     " *@ `2" "@ `2 *@ `0* @  "2 2  "? *@2" ?"@? *@$OpenBSD: strtod.c,v 1.12 1998/08/28 20:49:24 mickey Exp $㿘 !H,`   " ,, @ & & & &    `H(`"@( 㿘   ?#@ h 4 @ b@4` 2 *  @$ &-      *@!ǐ- "  & 㿘@    *`  &   @&  L Ѐ     L а?  *?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘! "  " 㿘 `@6  ` @ `  -: $*$ `, @@,`G?#@ @ } 4   @ r4`4 4 44 $@`"` @ \ 4 4`4@ R @  4 $`@ - 2&&㿘` L*`  >``$! !``i"q$!$@`" >`h>`` @ 2Y$@"㿘>` @ *`@  ]  @ "`@`* @ " @* "@`@ 2  "`@"`@ & H`(`@" ?8 㿘     #G#   #  ` ? #`.  *   "  : 22"  :`33   ?# @  : 2`@ :`33   ? 2#? ?# ?0   8 4?8      ( ;``"##㿐  * ? " &@ " 4@  ?,@  " 2@ ?,@  "@ 3 @   ?+  " 4@@@ ?"#㿐Z ?. ' . 6 ` '`'   " *@$ 2 '$   $ $   ڐ $   $ ` ΐ͐@& 5"  &&.`?.`"@&㿐v?o ?`"@ " * @ * #??ā?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doCp@ 'H @Mb     '쀊  @ ` @  2`M@ - + '@"`M@ Ѐ 02'`M@ 0 `M@ 0"`M@ FH'   M@/ 9  -*   ?4`+  *  ?Ъ`M@/ *`: E` =M@0Ϫ`M@0`π 6e'  )`     -*  4+  *    -*    +  *   `M@Ѐ (ӖЀe EK 2 `2"Ϫ`M@+ -І `M@Ѐ 00Ϫ`M@0"`π #Д`M@/%@ 9 *`` *  M@/?А%@ "@" 2    2 %`H``  'Lb0B?` Ґ"p$%*` H'  Lb0BD? 7'@ d 23%TH   Ґ"p- ? B"%Ғbp*@? B% -?@ B  Ґ"p *` ? ?&% G  Ґ"p* ? B??!4 <   ""# M"   Ҕ#(  < *`? B? `?,Ґ#(*`  ? B? ( $(#c?a _   Ґ"p* ? ??O<  6  Ҕ#P  < *`? B? `Ґ#P*` ? DLb(? F*?()B"# D?$%? F  ""c   `H`?@?u  '#`` `` *@ <r      &$@@ ?d3 6"  @  4 & $@ %  Œ Gu ` ے/ &  ƒ  03   @ݦ    ?@@Ц?΀ OF?L !b(? B40 !Lb8@ (L Lb@&3' L b@LbH$Lb@@LbP0bPH'bPH& ''?@?؀ LbPH (?,??؅ @?B'?# @c"N cE?Lb@@ LbPHB ??؅ @?B?   F'€LLLbX@ Lb` 0bh ][YWSQOMKH`2 @?(쀠`)㿘  q - @ @  @a` / ?#@`@ 4 @4` 2@ @ " :`2 ":44  (& "& 1 ` ?#@` 4 4`@2 @ " :`2 ":44@-` (& "&InfinityNaN0h'L'P'T! !@` ? !D "  *@ " $!@Ȁ6'@ '@ (' L T# ̀ ?##\N    \ pȁB T  \#  Ȩ0' |'?+$@$2`   @Ȓ"@( ̐$0@ ̐"('` LxB?{͆ '?L?L∅D' L☍DL␅DFDLp'  B# ` 'Ґ"p-` ȁ)'"?    ` '& 'L 8'LL 'L  'L&א#( ___0_\_4_`?' 'P'PP 'PP' 'P `'   ` "!D, D `"D !D "a@` Ȕ @#Ғbp `* =`  @#H Ȕ ?Ȁ  Ғ#( < /`@ B `ș ?ȲҐ"p`*` ȕB>` ?Ғ#( < /`@Ȕ B?Ȁ `耠Lȁ9' 쀠L⨔B?' ȅLLⰍD'?0',-L⸕¤ ?ȁ  ',- Pd䀠-Ғbp* L@L⠺ L⨍ȗJ ș'`0?.ȁ @ *+́ `@69DD?LҐ"p*`  L⨍BȗJ ș'@`0?. Dȁ \*ƛ+ 9?N 0"? ȕH`?Ȱ ? ]`\Ґ"pP-`   L⸅ Bȁ  1 . ȅ ąB"' Dȕ@`0?.% ȕ,-J?ȁ -?,-D`?" `?N 9 .  0/LȕBLp?ȁB`Ȣ' #L ؀$3 6" &$ 'ຕ6$@   ` @4&$@%䀠 u% eߐ \L̀2'?2 ' '' ?* e  "@ ` ` "```@VP耠  Д 䀠 Ȕ 쀥L   e  1Pɪ8 1. Ī`䀠`܀'xԐ  *@ ߔ  D 07M  +l` L ̀ `9+ 4`.& ``L`̀`Ȓ  4`2g.`"d.``:  9^. `9` 9.E T..@-  4 Ԁ  ,  'Ԓ % 'Ԑ   ` ђ 0.@    `{  4 ??`N" `?N 9  . 1/ N 0"? ڐ ԀАΐ̐2. 0/  .T` \2 $OpenBSD: multibyte.c,v 1.2 1996/08/19 08:33:39 tholo Exp $ "  J` ? `   ?J@"J@@  " *  J@"`  J@"`   `*`(    `*`( 㿘 # 2 @ 2   +?"  0` @@"& 0@  & 0 &   ?6 &  6   2 @   &  &   &  㿐  C&&  && @%@    C&&   &  ܐ!"`T &&  & @V  2  6 8T  &&@m < &  `?&؀`2 $&@("&@$ L ( (!@"$㿘. * "* @R  `& ?#@#`? #`  P;::: :(:0:8:@:H?:P X:X 㿘 # M@MM    V  X 2 $  6 && & & & & ?6 & 0& 4& D& H㿘@{M` " `   ` "@`4` $㿘@ "4 ܄ T   㰝㿘 2 @ "4   @  "c ?㿘T` `  ` `@" $@`$`` ? @4`  $``, &  4` $OpenBSD: localeconv.c,v 1.3 1997/07/23 21:14:40 kstailey Exp $M`􀠠$M        $((()(*(+ (,!(-"(.#(/"`M` MD  "`  #ttt.t@t@t@t@t@t@t@$OpenBSD: umul.S,v 1.2 1996/08/19 08:17:46 tholo Exp $ /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@+ddစ0(#h@ĒȐ: @  ((((( AAAAAABBBBBB $OpenBSD: getdtablesize.c,v 1.2 1996/08/19 08:19:20 tholo Exp $㿘@Ӑ @(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  $ `@㿘 `@ error: 㿘# 8`@} @L  <@u @D@o @>@i @8  @"` warning: 㿘   !ѐ   8@I @  <@A @@; @ @5 @㿘@  / 0. @   " 4  #6 "@  @ "@  㿐#\ . 6  . %  ?*@! #@.*. $#@$#  /etc/malloc.confMALLOC_OPTIONSunknown char in MALLOC_OPTIONS mmap(2) failed, check limits. P #  1M)   Ā ߐ#h@ ? $. @ 2@#` "`"}5 3 / - + L@ s @đ* :  >d* @@@@@@@@@@@@@@@@@@@@@@(@8@@@@@@@@@@@@@@@@@@@@@@@@@ @0#* $&##2  &#% % &$&$&`0&`0% % %( %( %`,%`, ߐ#% % `2L@d  ,   "`0#\  @? ?"c#@n  /2 ?"c $ "M `" " *` @" "`8 "# 㿘 /0  * `""`  "@"""2 6    #􀢀4 "  #+   "    *  "@  0  @. `  `8 "`8@㿘 (  ?>  >  ` #,`@ q  e 2 2 *   *,   @  @Q  *3 3 23 3 #  `  ?2* "  #@ 2 6  2  *  ( @ "    # +@$2 *  +@ * "   3 ?3  #,`6 "  c* "@@  #"@  9 #,`@    "   *`   " ?6 *    #,`"&": *    0 ,    @ allocation failed. 㿘 #    @  ('А    2 1#  ,   @malloc() has never been called. junk pointer, too low to make sense. junk pointer, too high to make sense. modified (page-) pointer. modified (chunk-) pointer. chunk is already free. pointer to wrong page. 㿘   @ # 2 ] p#4` " U  #N  #*@@oB `@ !`@    $ 5@30@00=(* 3 @ ! o2@2`*   `2 !(  $  @ 3 @ 0!@ 0%  @+@page is already free. freelist is destroyed. 㿘 M #  | p0D  A #6 " ` o 07 #@g 0/' *`   Y#X0! S!@0/M 0 " *`    *`"`*`   0 *  @' 8  $88 " " " `"" "K$8 "  * @  8" "8" $  3"@ @ $ '$ @2$   $  @$  $" 2 $ $    `8"" $"`8#p ,  %M@%#  `4@! @| `4@   $ @$   c$`42 "    "# #* " l0h  /2 !0_2`* ` `2 !(0S  0 @ А `*@$`   4 *`* 2    " " ` ` @ 2$$"   "2"  c2 "  c*  "  in malloc():recursive call. out of memory. 㿘 `!  @"<   $ @  @ ?$ @  @($ @ ݐ  in free():㿘 a!  @"<  $ @  @i @?$ @ in realloc():㿘 b!  @"<   $ @א  @ ?$ @ O @ `(?`"@  $OpenBSD: getenv.c,v 1.4 1998/07/16 18:02:33 deraadt Exp $ :   5  #8/"@J= J   "  J J 2J2 J=Ր    㿐$OpenBSD: abort.c,v 1.6 1998/11/20 11:18:49 d Exp $㿐?' @n M$    T` @"$@@  @B  @V @@ @ 㿘T @p  P>  B< P ?Đ*@4 㿘 !V   @  ?V + @76 㿘V  @ ?2 >P2>P ?*@  6 㿘@gV 㿘 M ? T` "??`X2x ?`'"*`  4Tl\(<Pdt  ' ' @耢 ? d 'q  ' '  ' z' ' u' '\  ' l'   'Q ! ' a' ' \' ' W' ' R' ' M' ' H' 'D' ' ?' ' :' '!  '  '  '  '  '   '   '  ' $' ܖؘ @͚ ??܀ "?0  "c  ? ܖؘ @ ??܁x @h ''?'  "c  ?  c(* @ @  '@؀ ?؁$ `@$. `@$: `@$ `@$I `@$% `@$6 `@$ `@$„ `@$ `@$ `@$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $Y V+ 2     " @*`2" @"`2 @*`0*@    "2 2  " @*2" @" @*㿈'XX  Ř#\#`#d#h@@㿐#\  ǔ@5  $OpenBSD: sigprocmask.S,v 1.3 1999/01/22 06:07:56 marc Exp $@2@  0 `@2"$OpenBSD: brk.S,v 1.2 1996/08/19 08:18:02 tholo Exp $N`@4   :N`@ `$OpenBSD: strlen.S,v 1.2 1996/08/19 08:17:59 tholo Exp $ J " $OpenBSD: memset.c,v 1.2 1996/08/19 08:34:07 tholo Exp $($OpenBSD: exit.c,v 1.3 1998/11/20 11:18:50 d Exp $㿘 "􀤠 ?, , `?<`2  T @/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin㿘 @th  a `2]    < ; <" `8@v <L    D "?  ?`6!t*` $$#?###    (","  "  "c ?$ `@$ʄ `@$Ƅ `@$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $Y V+ 2     " @*`2" @"`2 @*`0*@    "2 2  " @*2" @" @*$OpenBSD: sbrk.S,v 1.2 1996/08/19 08:18:10 tholo Exp $N   : `@"$OpenBSD: cerror.S,v 1.2 1996/08/19 08:18:02 tholo Exp $ c ??8w "^? X?  Ȧ , < N =" ƀ    ?ِ  ( $@ ,`  4` `,` 委 .  &$?  Ȧ , 2 ?א?. "?$  &@㿘@ _`r | ̰   ? ' '''!''' ' !ޘ   "  "&  & . ``& i& &`C9 '#   j ?#` `# ``2m   & b d&  @"& !h"&  Q   & x 2I5  ܐ !&  & "& "&  h& "8& "p& !&   "&5 `  2  "`   Շ!  )!€??5 0  "c 5  &`"& c&  㿘  `"" Z & " ( " "c ?㿘  `"E $ `7"*` |||H| @% (" ( #  $    ( " "  $?2"G " )2"!€??<?"  "c 5?" " )2 "!€ $" ـ @Y  $ $ (, (@" @"@@Ք 0$ 㿘  `ǔ $  @`2"  "c )?@ " )" !€ @  ?  @" @"@@Ԕ 0$ 㿐 Ȁ ސ `2C?$$''9 `? "`@  "@?2,?2,` ?@  Τ?ؠ *   !$ 㿐bO baaa`? "`aa@  "@?a'aȀ?&' (?@ r  ?+?2.aʤ!a̰& aȀ $aT `. $aȑ2 @. *aȀ b  !$b 㿐ab aȀ * h`2b2? !.$b $a$aa'b'bb!b :b baȀ *@  `  b@  ՠ  䀦$b 㿐bbb " b*'b  !$b  * & '@ ڒ  ?  $b 㿘  `_ $  $ @`" "@@% (  " 2 $ @   $?$ $ "c  ? "  @$" 㿘@ 2@?`@    㿘.@ @   r ?2I?`  ?@ @Ô& `.: @ *``2`6`?#@  :?2?* 2  `? ? @" : ?*  +`2  *2?*  `?6`b ?$b㿘` `Ҩ $ @% ? ?" $  "f"2?" ( @! " 2?@?"?p  `` x $ ` 2" e {  s 2 "!€??"j?"  ז @2b? $ 'ܐ'" "ؔ   24$ $"䀢 Hؔ   """$ $"' 'ؔ  ''"z ` (ؔ   $ $?"?"    ?  `"  ? " *@$" ?㿘'L!Ā L! @  ~  9L&! &!!  &!& "= `@* @ @    !Ͻ!̀ 2+?'!" @ @ !̔  !Ȁ    G 2&!? &!!o' !' ' 㿘 ,&!   L  &@& 6 q  ?* 2 * 2  *`2`@  8!!"!2`! &!  ͒*2      ?*2      "@ E  @ )#  ,!?&! ` @Г `*   ?*    "   ! "#  㿘@,  ``$@,`2 ѐ , 2 6$@,`2 Ő , 2 66, 4 ,  , $@2 2 㿘`.` @D" . "@ # `*  @ *2 @# 4. 22@2*  ,4 @` 24 8?& 8`  .`㿈  2   + 2 n?-.`3 @h3`  .   ^- .    -  @;  ߐ,  '2$@ '%* " , 2  $@ " 44  '`" "'`@˴"5* 2 * @ * %2`* 2   ?.   ?-p * ?* 2   #\@, 2?܀؀*,`2 @  2% ` # 4+ 3 + @ + ' 3`*`2`+ q3  _  @i  d ,`2 ` (^,`  ' %@ '`' `" '`62"  @ *  `@ @ɒ !w ". @ *  `@ @ 2?V .`* 2  ,`,`2  *N @ 㿘` "3`*  8+` #` *  @ *  `  U?– "S?` 2 ( @ *   `@8 `@< "7?` @ *   `@ ܔ `@[ 2?` .` 8   & 8 (l` 4 $    @ߔ 㿘 4@@ `2  & 4 & 4``@}.`,`2 `Q  &` ` *`*@`2`*  ?2`2`2`4`㿐!?  6@ ?6`  6`  <ѐ?*  D2  *  <    ?*  D @>   і ?"W??    O"c H?2`2   2  6@ ?6` 86` ဢ@3`  :  - @' *@ *` *`􀢀 *`` 7**    @7 `*@ *`` 㿐!? @Ԑ 2r?  ဢ@-!   :  &@' *@ *` *`􀢀 *``@  @7 *@򀢀 *``  <  ?*  D4  *  < '   ?*  D @>     ??1?   O"c ?㿘   <  , ḔX$Ḣ  R"?* $  $.2 đ."!8     (HASH: Out of overflow pages. Increase page size 㿘 $,`:  D:@  * ?1 @. 8@_ 2 * ?  $* ? @  :  ??m` $*` լ,` `D$$`D` "`D*  D$'$ ``$ $  b 1 ,`*  D "`D D " D * ?2( `` ,` @ F b  ,` `D'  "`D``Ґ $ ,`*  D "`D D " D  :**%   * @$ 5,` A  :**$   * @$  鶓*` $ ?$$  `D  ` ?*  D$'4 . . 6  㿘`2 ` '*  D ? $&& $  :*`!8 * ? @|  :**$   * +  TMPDIR%s/_hash.XXXXXX/tmp㻐 (## #0w$?' ?&!7! ;   !? ?㿘`,``$4, @2 `$6, 2 64`4``*` $2* 2 㿘!@6  .`$!8.`  Ė   !8"!8  ?*@   *  2@*@ 㿘`*  `?* 2 @*2%@ *   $ , 2 5*4 4*2*`$ 2**2 4 n`'*`  ,4 $@4,`2  6*`@`"2`%* 2  6`` .``*  ?D* 2  "*4`*  $ , 2 ̐*44*2`@* $2`* 2 * 4   2`?* 4 ` .`*   ? 㿘 `* 2  ( `2 *    2`*`@  .`*`2`O K`   2+  ?  22`$$?$?2+ 2  `* "@2`*`@ ?2` ` ,`8 ?$`8㿘`. @ " * 2 $ .     *2@ "$@   ``" * 2  *2 2 ?. @ ??㿘@   `*`    2&@*`@  "  &@   㿘.   .*`@  p ".   2*`@  [ `= * @ ` 2   ` j# ,C? & "  &`2&! !$ &!( *`@ O )&!  ! &!(` 2" !$&!  &!$  , 2@?&`   `!S ! & "c ?㿘` `  `("! Ð ?&!+ &!(`*`@ .&!   ,!$&!  &!$*`@ Ŗ $?,` 2 @  ! `@  "c ?㿘 @ ?&! &?㿘` ``" `?* 2  ! Y .$!  ,$?@*`@ Ϙ ,` 2 @  !``@ 0 "c ?㿈'P\ 2d?QP@ 4 * 2 ` PV $ L?$ ` `"`` *`/`  `*`2 6`*`2 66*`2`@2`* 2 $P$  `` *` *   6* 2 2 P*2  ?6P`"$ $ 㿈  `"" S $ " ""," "'8[ !̀ !Ȁ 옐 `?"$!$!! "!" " !'"' 2'#D. ߨp߈ߨߨ (    $@2"  @ "@ "  0R  "c N?"5" )2 "!€???" %" "" '*" '"' " "'@( #?"`" "5@  "$ $ "  ""  x ϔ䀢?0' ' '' @    "@]?2 a I?`    ?"@  @,`2 #\  2 .$,`2`* 2 @ .`` `"*   4 "@4 .`2   $  *    $$  $OpenBSD: crt0.c,v 1.2 1997/06/24 17:15:53 tholo Exp $<$///Z.fX.fX.k.X.(.(.p.p..B.F.....xN.pX@.hX@.X_ .P@.H.@P.8P.0.(. ax. ax. U8. U8- l- l- l- _- a- m- n- z- }@- 8- - -x -p -h -` -X -P h-H 8-@ Ƙ-8 Ƙ-0 Ƙ-(~- -`-`-<,,,,, , ,,, , ,,X,)H,x)H,p)H,hx,`,Xx,PX,H,@,8,(**$OpenBSD: args.c,v 1.8 1998/07/09 18:39:23 deraadt Exp $$OpenBSD: conv.c,v 1.5 1997/02/14 07:05:19 millert Exp $$OpenBSD: conv_tab.c,v 1.3 1996/06/23 14:19:46 deraadt Exp $@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.8 1998/04/30 05:55:02 deraadt Exp $$OpenBSD: misc.c,v 1.7 1997/09/12 04:33:24 millert Exp $$OpenBSD: position.c,v 1.3 1997/02/14 07:05:22 millert Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chflags.c,v 1.3 1998/02/16 23:48:39 millert Exp $$OpenBSD: stat_flags.c,v 1.3 1999/02/14 19:58:10 millert Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.9 1998/01/30 17:31:52 weingart Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.23 1999/01/31 18:28:29 millert Exp $@A0?PA>Bp>C=pC<@$@Y@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. xp`P@0(pXH0 0ۈۀxphP88H8(A0123456789abcdef@(#) Copyright (c) 1983, 1988, 1993 Regents of the University of California. All rights reserved. %`'''''''x'h'X'P'H'@'0' ''&&&&&&&&&&&p&`&P&@&0& &&%%%%%%%%4(8('D''$d'%P'&؈' !( "(#( Ha(8 HQ(0d((x (Xxt(P(H(@('(`     d677x7h7X7@7(766 66 6 6p 6XG(GGxGpGhG`ccccccpchc8cc cc chcchbh`UGHRD M@dmCXLS1@2`P@0 8(xhXH8 pH$NetBSD: atalk.c,v 1.2 1997/05/22 17:21:26 christos Exp $@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.19 1998/02/01 18:49:08 mickey Exp $@H0 @hXP Hx$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.2 1996/06/23 14:21:55 deraadt Exp $/dev/ptyXX\^:   }) 0$OpenBSD: cchar.c,v 1.8 1998/11/18 23:26:13 deraadt Exp $$OpenBSD: gfmt.c,v 1.4 1997/09/01 18:30:33 deraadt Exp $$OpenBSD: key.c,v 1.8 1997/08/24 06:49:30 deraadt Exp $H@8 0 ( X ,l !x!!\! 8 X  !$OpenBSD: modes.c,v 1.4 1996/12/16 20:04:41 tholo Exp $$OpenBSD: print.c,v 1.7 1998/02/14 08:52:06 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.6 1997/09/01 18:30:35 deraadt Exp $@(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.4 1996/12/14 12:18:01 mickey Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.63 1999/04/07 22:57:25 millert Exp $FFFFxFpFhF`FXFPFHF@F8F0F(F G0G(GGGFFFFFFFFFFFFFF8G`G`G`G`G`G`G`GXGPGHG`G`G@G`G8G`G`FG`/tmp/EdDk.aXXXXXXXXXXtA$OpenBSD: dkcksum.c,v 1.2 1996/06/23 14:30:05 deraadt Exp $$OpenBSD: editor.c,v 1.63 1999/04/07 22:57:26 millert Exp $xph`XP`XH80(hxphAA?DISKLABEL(8) OpenBSD System Manager's Manual DISKLABEL(8) NNAAMMEE ddiisskkllaabbeell - read and write disk pack label SSYYNNOOPPSSIISS ddiisskkllaabbeell [--nn] [--dd | --rr] [--tt] [--vv] _d_i_s_k ddiisskkllaabbeell --ww [--nn] [--dd | --rr] [--vv] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --ee [--nn] [--dd | --rr] [--vv] _d_i_s_k ddiisskkllaabbeell --EE [--ff _t_e_m_p_f_i_l_e] [--nn] [--dd | --rr] [--vv] _d_i_s_k ddiisskkllaabbeell --RR [--rr] [--nn] [--vv] _d_i_s_k _p_r_o_t_o_f_i_l_e ddiisskkllaabbeell [--NNWW] [--nn] [--vv] _d_i_s_k ddiisskkllaabbeell --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k [_d_i_s_k_t_y_p_e] ddiisskkllaabbeell --ww --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --RR --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _p_r_o_t_o_f_i_l_e [_d_i_s_k_t_y_p_e] DDEESSCCRRIIPPTTIIOONN ddiisskkllaabbeell can be used to install, examine or modify the label on a disk drive or pack. When writing the label, it can be used to change the drive identification, the disk partitions on the drive, or to replace a damaged label. On some systems, ddiisskkllaabbeell can be used to install boot- strap code as well. There are several forms of the command that read (display), install or edit the label on a disk. Each form has an addi- tional option, --rr, which causes the label to be read from or written to the disk directly, rather than going through the system's in-core copy of the label. This option may allow a label to be installed on a disk with- out kernel support for a label, such as when labels are first installed on a system; it must be used when first installing a label on a disk. The specific effect of --rr is described under each command. The read and install forms also support the --BB option to install bootstrap code. These variants are described later. In all cases you can specify --nn to operate in no change mode to avoid committing any permanent changes. The --vv flag can be used to make ddiisskkllaabbeell be more verbose about what it is doing. When reading or editing a label, you may also specify the --dd option to use the _d_e_f_a_u_l_t label. This ignores any existing OpenBSD partitions on the disk. Note that this option will only work for disks that are capa- ble of reporting their geometry, such as SCSI, IDE, and ESDI. Also note that the --dd flag may not be used in conjuction with the --rr flag. The first form of the command (read) is used to examine the label on the named disk drive (e.g. sd0 or _/_d_e_v_/_r_s_d_0_c). It will display all of the pa- rameters associated with the drive and its partition layout. Unless the --rr flag is given, the kernel's in-core copy of the label is displayed; if the disk has no label, or the partition types on the disk are incorrect, the kernel may have constructed or modified the label. If the --rr flag is given, the label from the raw disk will be displayed rather than the in- core label. If the --tt flag is given, then the label will be formatted as a disktab(5) entry. The second form of the command, with the --ww flag, is used to write a standard label on the designated drive. The required arguments to ddiisskkllaabbeell are the drive to be labeled (e.g. sd0), and the drive type as described in the disktab(5) file. The drive parameters and partitions are taken from that file. If different disks of the same physical type are to have different partitions, it will be necessary to have separate disktab entries describing each, or to edit the label after installation as described below. The optional argument is a pack identification string, up to 16 characters long. The pack ID must be quoted if it con- tains blanks. If the --rr flag is given, the disk sectors containing the label and bootstrap will be written directly. A side-effect of this is that any existing bootstrap code will be overwritten and the disk ren- dered unbootable. If --rr is not specified, the existing label will be up- dated via the in-core copy and any bootstrap code will be unaffected. If the disk does not already have a label, the --rr flag must be used. In ei- ther case, the kernel's in-core label is replaced. An existing disk label may be edited by using the --ee flag. The label is read from the in-core kernel copy, or directly from the disk if the --rr flag is also given. The label is formatted and then supplied to an edi- tor for changes. If no editor is specified in an EDITOR environment variable, vi(1) is used. When the editor terminates, the formatted label is reread and used to rewrite the disk label. Existing bootstrap code is unchanged regardless of whether --rr was specified. With the --RR flag, ddiisskkllaabbeell is capable of restoring a disk label that was formatted in a prior operation and saved in an ASCII file. The prototype file used to create the label should be in the same format as that pro- duced when reading or editing a label. Comments are delimited by _# and newline. As with --ww, any existing bootstrap code will be clobbered if --rr is specified and will be unaffected otherwise. The --NNWW flags for ddiisskkllaabbeell explicitly disallow and allow, respectively, writing of the pack label area on the selected disk. The --EE flag to ddiisskkllaabbeell will drop you into a simple initial label edi- tor. This mode is only intended for new disks as it will move partitions around as necessary to maintain a contiguous pool of free blocks. Some commands or prompts take an optional unit. Available units are ``b'' for bytes, ``c'' for cylinders, ``k'' for kilobytes, ``m'' for megabytes, and ``g'' for gigabytes. Quantities will be rounded to the nearest cylinder when units are specified for sizes (or offsets). Commands may be aborted by entering ^D (Control-D). Entering ^D at the main ``>'' prompt will exit the editor. At prompts that request a size, ``*'' may be entered to indicate the rest of the available space. The editor commands are as follows: ? [command] Display help message with all available commands. You may specify a _c_o_m_m_a_n_d for which to get more detailed help. There is also (simple) context-sensitive help available at most prompts. M Display this manual page. u Undo (or redo) last change. Entering _u once will undo your last change. Entering it again will restore the change. p [unit] Print the current disk label. If a _u_n_i_t is given, the size and offsets are displayed in terms of the specified unit. e Edit drive parameters. This option is used to set the follow- ing parameters: sectors/track, tracks/cylinder, sec- tors/cylinder, number of cylinders on the disk, total sectors on the disk, rpm, interleave, disk type, and a descriptive la- bel string. b Set OpenBSD disk boundaries. This option tells ddiisskkllaabbeell which parts of the disk it is allowed to modify. This option is probably only useful for ports with fdisk partition tables where the ending sector in the MBR is incorrect. The user may enter ``*'' at the ``Size'' prompt to indicate the entire size of the disk (minus the starting sector). This is useful for disks larger than 8 gigabytes where the fdisk partition table is incapable of storing the real size. r Recalculate free space. This option should really not be nec- essary under normal circumstances. a [part] Add new partition. This option adds a new BSD partition. If no partition letter is specified (a-p), the user will be prompted for one. c [part] Change the size of an existing partition. If no partition is specified, the user will be prompted for one. The new size may be in terms of the aforementioned units and may also be prefixed with ``+'' or ``-'' to change the size by a relative amount. d [part] Delete an existing partition (or ``*'' to delete all parti- tions). If no partition is specified, the user will be prompted for one. You may not delete the ``c'' partition. g [d|b|u] Set disk geometry based on what the _d_i_s_k, _B_I_O_S, or _u_s_e_r thinks (the _u_s_e_r geometry is simply what the label said before ddiisskkllaabbeell made any changes). m [part] Modify parameters for an existing partition. If no partition is specified, the user will be prompted for one. This option allows the user to change the filesystem type, starting off- set, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all pa- rameters are configurable for non-BSD partitions). n [part] Name the mount point for an existing partition. If no parti- tion is specified, the user will be prompted for one. This option is only valid if ddiisskkllaabbeell was invoked with the --ff flag. s [path] Save the label to a file in ASCII format (suitable for loading via the --RR option). If no path is specified, the user will be prompted for one. w Write the label to disk. This option will commit any changes to the on-disk label. q Quit the editor. If any changes have been made, the user will be asked whether or not to save the changes to the on-disk la- bel. x Exit the editor without saving any changes to the label. The --ff _t_e_m_p_f_i_l_e flag to ddiisskkllaabbeell is only valid when used in conjunction with the --EE flag. When the --ff flag is specified, ddiisskkllaabbeell will write entries to _t_e_m_p_f_i_l_e in fstab(5) format for any partitions for which mount point information has been specified. The final three forms of ddiisskkllaabbeell are used to install bootstrap code on machines where the bootstrap is part of the label. The bootstrap code is comprised of one or two boot programs depending on the machine. The --BB option is used to denote that bootstrap code is to be installed. The --rr flag is implied by --BB and never needs to be specified. The name of the boot program(s) to be installed can be selected in a variety of ways. First, the names can be specified explicitly via the --bb and --ss flags. On machines with only a single level of boot program, --bb is the name of that program. For machines with a two-level bootstrap, --bb indicates the pri- mary boot program and --ss the secondary boot program. If the names are not explicitly given, standard boot programs will be used. The boot pro- grams are located in _/_u_s_r_/_m_d_e_c. The names of the programs are taken from the ``b0'' and ``b1'' parameters of the disktab(5) entry for the disk if _d_i_s_k_t_y_p_e was given and its disktab entry exists and includes those param- eters. Otherwise, boot program names are derived from the name of the disk. These names are of the form _b_a_s_e_n_a_m_eboot for the primary (or only) bootstrap, and boot_b_a_s_e_n_a_m_e for the secondary bootstrap; for example, _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d if the disk device is _s_d_0. The first of the three boot-installation forms is used to install boot- strap code without changing the existing label. It is essentially a read command with respect to the disk label itself and all options are related to the specification of the boot program as described previously. The final two forms are analogous to the basic write and restore versions ex- cept that they will install bootstrap code in addition to a new label. FFIILLEESS /etc/disktab /usr/mdec/_x_xboot /usr/mdec/boot_x_x EEXXAAMMPPLLEESS disklabel sd0 Display the in-core label for sd0 as obtained via _/_d_e_v_/_r_s_d_0_c. disklabel -w -r /dev/rsd0c sd2212 foo Create a label for sd0 based on information for ``sd2212'' found in _/_e_t_c_/_d_i_s_k_t_a_b. Any existing bootstrap code will be clobbered. (Normally you do not want to use the --rr flag though.) disklabel -e -r sd0 Read the on-disk label for sd0, edit it and reinstall in-core as well as on-disk. (Normally you do not want to use the --rr flag though.) Existing bootstrap code is unaffected. disklabel -R sd0 mylabel Restore the on-disk and in-core label for sd0 from information in _m_y_l_a_b_e_l. Existing bootstrap code is unaffected. disklabel -B sd0 Install a new bootstrap on sd0. The boot code comes from _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and possibly _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d. On-disk and in-core la- bels are unchanged, but on some systems other information may be de- stroyed. Use with care. disklabel -w -B /dev/rsd0c -b newboot sd2212 Install a new label and bootstrap. The label is derived from disktab in- formation for ``sd2212'' and installed both in-core and on-disk. The bootstrap code comes from the file _/_u_s_r_/_m_d_e_c_/_n_e_w_b_o_o_t. SSEEEE AALLSSOO disklabel(5), disktab(5) DDIIAAGGNNOOSSTTIICCSS The kernel device drivers will not allow the size of a disk partition to be decreased or the offset of a partition to be changed while it is open. Some device drivers create a label containing only a single large parti- tion if a disk is unlabeled; thus, the label must be written to the ``a'' partition of the disk while it is open. This sometimes requires the de- sired label to be set in two steps, the first one creating at least one other partition, and the second setting the label on the new partition while shrinking the ``a'' partition. On some machines the bootstrap code may not fit entirely in the area al- located for it by some filesystems. As a result, it may not be possible to have filesystems on some partitions of a ``bootable'' disk. When in- stalling bootstrap code, ddiisskkllaabbeell checks for these cases. If the in- stalled boot code would overlap a partition of type FS_UNUSED it is marked as type FS_BOOT. The newfs(8) utility will disallow creation of filesystems on FS_BOOT partitions. Conversely, if a partition has a type other than FS_UNUSED or FS_BOOT, ddiisskkllaabbeell will not install bootstrap code that overlaps it. NNOOTTEESS On i386 machines, installboot(8) is normally used to install boot code. The --BB option to ddiisskkllaabbeell can still be used to install old style boot code, but this usage is deprecated. BBUUGGSS When a disk name is given without a full pathname, the constructed device name uses the ``a'' partition on the tahoe, the ``c'' partition on all others. In --EE mode, ddiisskkllaabbeell is far too quick to shuffle partitions around; it should keep a free block list and only move partitions around with the user's permission. Also, in --EE mode, partitions outside the OpenBSD portion of the disk should be changeable. 4.2 Berkeley Distribution October 27, 1997 5 $OpenBSD: ar_io.c,v 1.18 1998/09/20 02:22:21 millert Exp $$OpenBSD: ar_subs.c,v 1.14 1998/09/20 02:22:21 millert Exp $$OpenBSD: buf_subs.c,v 1.7 1997/09/01 18:29:46 deraadt Exp $ $OpenBSD: cache.c,v 1.7 1999/04/08 03:50:58 deraadt Exp $$OpenBSD: cpio.c,v 1.5 1997/07/25 18:58:28 mickey Exp $$OpenBSD: file_subs.c,v 1.13 1997/09/01 18:29:48 deraadt Exp $$OpenBSD: ftree.c,v 1.9 1998/06/09 07:28:41 deraadt Exp $$OpenBSD: gen_subs.c,v 1.8 1997/09/01 18:29:51 deraadt Exp $$OpenBSD: getoldopt.c,v 1.3 1997/09/01 18:29:52 deraadt Exp $$OpenBSD: options.c,v 1.35 1998/12/07 23:45:46 deraadt Exp $abcdfiklnoprstuvwxBDEGHLPTUXYZ@mYnr`s[YHLF<8L^Y^``ah[YHLF<0ndYeth\`i8[YHLF<(ne eXeth\hli8[YHLF< (x HLF(`LHLF<$OpenBSD: pat_rep.c,v 1.11 1997/09/01 18:29:56 deraadt Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.14 1998/09/20 02:22:22 millert Exp $4H$OpenBSD: sel_subs.c,v 1.7 1997/08/17 23:05:09 millert Exp $$OpenBSD: tables.c,v 1.10 1998/07/03 06:01:20 deraadt Exp $$OpenBSD: tar.c,v 1.14 1998/10/19 05:46:12 millert Exp $$OpenBSD: tty_subs.c,v 1.5 1997/07/25 18:58:39 mickey Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.38 1999/02/24 21:02:41 kjell Exp $8t. ;@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.8 1997/06/18 18:37:56 kstailey Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. X`@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ifconfig.c,v 1.22 1999/02/24 21:26:03 deraadt Exp $7`m `m `xl`hl``m `Xm `Pm `Hm `@k`8k`0k`(kx` m`k`k`h________7_m _m _ m _m _@m _m _xp8_hq _Xq_Hr_@rkl`X i@i @`T i@i @ @` i@i @`h i@i @`,0iti s sx@sh@s``sXuuuxup#uh#uX#uP#uH$u@$u0$u($u %u%u%u%t&t&t't't(t(t)t)t*t*t+tp+th,tX,tP,tH-t8-t0-t(CtCtDtDsEsEsFsFscscsdsdseuPesv`vX vH v@v8v0v(vvv@u@u@u@u@u@u`u`u P p ` P p ` P p ` 0 $OpenBSD: cmp.c,v 1.3 1997/01/03 22:36:07 millert Exp $$OpenBSD: stat_flags.c,v 1.3 1999/02/14 19:58:10 millert Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.12 1999/02/24 16:48:02 aaron Exp $P.m$OpenBSD: print.c,v 1.10 1999/02/20 18:59:25 deraadt Exp $$OpenBSD: util.c,v 1.4 1999/02/20 18:59:26 deraadt Exp $@(#) Copyright (c) 1993 The Regents of the University of California. All rights reserved. ǘǐLjǀxph`XPXH80 ȸȰȠȐȈxhXH8( ǸǰǨǠxp`ɀʈʀxphXPH@80( ɸɰɨɠɘɐɈʰʠʐ@0 ˸˨˘ˈp`P8(Ḧ̘xh`Xn o%p<p\plqd r\qrlsxpph`P@8(p`  s4t u$u<uL uuuhwww@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cksum.c,v 1.4 1997/06/28 22:24:24 grr Exp $$OpenBSD: crc.c,v 1.2 1996/03/27 19:32:21 niklas Exp $$OpenBSD: print.c,v 1.2 1996/06/26 05:32:03 deraadt Exp $$OpenBSD: sum1.c,v 1.2 1996/03/27 19:32:22 niklas Exp $$OpenBSD: sum2.c,v 1.2 1996/03/27 19:32:23 niklas Exp $<$OpenBSD: termcap.c,v 1.1 1998/11/16 03:08:41 millert Exp $ @ 0 (   zzzzzzzzzzzz e j   ky JKYdu f   bvz!w"F2R r u'g<<p%{{}}{}(())()[[]][]#$G>>P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:p:x&-/:ttso_|%v !+ HhVq:q:QZZ  lhbwixX  0 $ k j  is a directory is not a regular file||a $@ $ b x  $ $B # #c  #x #X #0d # "e " " "f  " "hg "H " !h ! !HA 0 ! !`i  !@ !( !j kH (lH m l n" h h Ho p 8O T (pH P  q    r!  Xs! @  S!  t d T @ u" p   V ,w! P (x$ H  XA D  y <  pz  X 8? | p (press RETURN)... (interrupt to abort)?n?f%f .?m(file %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(file %i of %m) .?e(END) ?x- Next\: %x.:(?pB%pB\%:byte %bB?s/%s..).%t?f%f .?n?m(file %i of %m) ..?ltline %lt?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(file %i of %m) .?ltline %lt?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%t P290@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $  @(#)getmntopts.c 8.3 (Berkeley) 3/29/95$Id: dfa.c,v 1.1.1.1 1995/10/18 08:40:17 deraadt Exp $ r o r p r p0 r ph r p rx p rh q rX qH rH q r8 q r( q$Id: grep.c,v 1.2 1997/08/06 23:44:11 grr Exp $GNU grep version 2.0$OpenBSD: getopt.c,v 1.2 1997/02/17 09:16:31 niklas Exp $?$Id: kwset.c,v 1.1.1.1 1995/10/18 08:40:17 deraadt Exp $$Id: obstack.c,v 1.1.1.1 1995/10/18 08:40:17 deraadt Exp $$NetBSD: regex.c,v 1.4 1995/04/23 08:36:17 cgd Exp $ p P 0  x P (  $Id: search.c,v 1.1.1.1 1995/10/18 08:40:18 deraadt Exp $ T V Z4 T V Z4 T V Z4 T Xl Z4 S Xl Z4 S Xl Z4 S ]P ] S ]P ]@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: basename.c,v 1.3 1997/08/17 21:25:01 millert Exp $@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.7 1999/02/27 07:59:30 deraadt Exp $@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: pwd.c,v 1.5 1997/01/15 23:40:24 millert Exp $@(#) Copyright (c) 1983, 1990 The Regents of the University of California. All rights reserved. $OpenBSD: rsh.c,v 1.17 1998/03/25 19:53:21 art Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.5 1997/10/04 19:30:16 deraadt Exp $@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: slattach.c,v 1.5 1996/11/13 07:17:20 downsj Exp $% x h X@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.30 1999/02/24 22:56:01 angelos Exp $0123456789abcdef 0 Ɉ h @ ( Ƞ Ȁ ` @  Ǹ ǘ pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATICPROTO2PROTO1UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD           p h ` X P H @ 8 0        ! " # $ % & ' ( ) x* p+ h, `- P.$OpenBSD: cmds.c,v 1.29 1998/09/01 17:08:22 deraadt Exp $ @  x p h p ` X P H!p $OpenBSD: cmdtab.c,v 1.12 1998/12/24 17:00:12 aaron Exp $send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macroset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagerenter passive transfer modetoggle use of PORT cmd for each data connectiontoggle preservation of modification time of retrieved filestoggle transfer progress meterforce interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose mode ?  ?x @H ?p $ ? ? ( ? \ ? ?X # ? (H ?x0 0 ?pP 2 ?h ! ?`` $ ?X ( ?P L ?H   ?@8 0 ?0` $ ?(X # ?  ? 8 ? < ? X ? d > L >P 4 >p #( > > t > ; >  > 0 > 5 > 0 >(  >X  >p p >  > > 9 >x ; >p 0 >h 0 >`( ; >X` 0 >P * >H ( >@ 8 >8 ; >0 1 > h > X >  > % = =(  =X # =x  = < =  =  = =( 3 = # =P  =x : = 2h = =8  =x H =pP 8 =hp 0 =` P =X 2( =P 4 =H P =@  =8   =08 " =(X  = x  =P 4R$OpenBSD: domacro.c,v 1.7 1997/07/25 21:56:19 millert Exp $$OpenBSD: fetch.c,v 1.24 1999/02/09 03:43:48 deraadt Exp $$OpenBSD: ftp.c,v 1.33 1998/12/13 21:01:29 millert Exp $@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.43 1998/11/21 02:58:37 d Exp $$OpenBSD: ruserpass.c,v 1.11 1998/03/30 06:59:35 deraadt Exp $      $OpenBSD: util.c,v 1.21 1998/09/22 04:42:49 deraadt Exp $A.A.>?P@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.8 1997/08/20 05:34:24 millert Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.14 1998/08/07 20:17:32 deraadt Exp $$OpenBSD: buf.c,v 1.9 1998/07/03 06:01:17 deraadt Exp $!s$OpenBSD: cbc.c,v 1.5 1997/06/18 19:22:35 kstailey Exp $@ $OpenBSD: glbl.c,v 1.7 1998/04/30 05:55:05 deraadt Exp $$OpenBSD: io.c,v 1.7 1997/02/01 12:03:07 tholo Exp $ 1 $OpenBSD: main.c,v 1.14 1998/05/18 20:36:14 deraadt Exp $ 1p 1xH$OpenBSD: re.c,v 1.7 1998/01/21 03:51:50 millert Exp $$OpenBSD: sub.c,v 1.6 1997/09/01 18:29:31 deraadt Exp $$OpenBSD: undo.c,v 1.4 1996/10/12 19:38:43 millert Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.12 1998/07/03 16:43:56 csapuntz Exp $T $OpenBSD: utils.c,v 1.13 1998/09/26 21:53:16 deraadt Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cut.c,v 1.6 1998/11/28 03:41:46 aaron Exp $ ɀ 8 Ȩ Ȑ Ȉ @ ǰ ǀ Ȉ 8 Ƹ ʀa pc hc Xd Hd @f 8h 0l (L n N q q r S t T v V 1 9 ɸZ ɰb P 0 ͐ `  ̠ h ( ˠ x P " h ` X P H @" h H ` Ȉ Ȉ Ȉ Ȉ       "| "P"""<           #+3;CScscc !1Aa  0@` ?? w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.7 1997/11/08 23:26:39 todd Exp $@(#) Copyright (c) 1988 The Regents of the University of California. All rights reserved. $Id: chroot.c,v 1.2 1996/08/29 03:32:50 deraadt Exp $$OpenBSD: dir.c,v 1.7 1997/10/06 20:22:31 deraadt Exp $ ... ...$OpenBSD: inode.c,v 1.13 1997/10/11 20:19:36 niklas Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.15 1999/03/01 07:45:17 d Exp $$OpenBSD: pass1.c,v 1.7 1999/03/01 07:45:17 d Exp $$OpenBSD: pass1b.c,v 1.4 1999/03/01 07:45:18 d Exp $$OpenBSD: pass2.c,v 1.7 1999/03/01 07:45:18 d Exp $$OpenBSD: pass3.c,v 1.3 1999/03/01 07:45:18 d Exp $$OpenBSD: pass4.c,v 1.4 1999/03/01 07:45:18 d Exp $$OpenBSD: pass5.c,v 1.7 1999/03/01 07:45:18 d Exp $$NetBSD: fsutil.c,v 1.2 1996/10/03 20:06:31 christos Exp $$OpenBSD: setup.c,v 1.6 1997/10/06 20:22:36 deraadt Exp $xph`XPH@80( ( 0XXXXXXXPH@XX8X0XXX$OpenBSD: utilities.c,v 1.7 1999/03/01 07:45:18 d Exp $4?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@$OpenBSD: append.c,v 1.4 1998/05/02 02:41:55 mickey Exp $$OpenBSD: fields.c,v 1.3 1997/06/30 05:36:16 millert Exp $$OpenBSD: files.c,v 1.5 1997/06/30 05:36:16 millert Exp $$OpenBSD: fsort.c,v 1.6 1998/05/02 02:41:56 mickey Exp $$OpenBSD: init.c,v 1.2 1997/06/16 02:21:56 millert Exp $$OpenBSD: msort.c,v 1.6 1997/06/30 05:36:17 millert Exp $@(#) Copyright (c) 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sort.c,v 1.11 1998/07/24 00:32:24 deraadt Exp $ /dev/stdinw$OpenBSD: tmp.c,v 1.2 1997/06/16 02:21:57 millert Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.15 1998/06/03 16:20:24 deraadt Exp $P$OpenBSD: dkcksum.c,v 1.2 1996/06/23 14:30:05 deraadt Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.18 1999/04/10 04:09:23 millert Exp $ x@p @%s: can't read disk label; disk type must be specified$OpenBSD: mkfs.c,v 1.12 1999/04/10 04:09:23 millert Exp $>......$OpenBSD: getopt.c,v 1.3 1997/01/15 23:42:32 millert Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_kernfs.c,v 1.7 1998/12/21 16:14:40 mickey Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $$OpenBSD: acu.c,v 1.4 1997/09/01 23:24:23 deraadt Exp $$OpenBSD: acutab.c,v 1.2 1996/06/26 05:40:41 deraadt Exp $(P$ `r0t tpp`tt$OpenBSD: cmds.c,v 1.7 1997/09/01 23:24:23 deraadt Exp $<<@80$OpenBSD: cmdtab.c,v 1.2 1996/06/26 05:40:42 deraadt Exp $!4(<4>4t4xp4`"|4H $4 $LhW?O@NiAB CD  !"#$%E &'()*+,-./F 0123456789G :;<=>?@ABCH D E F GIJKjkLMKNIOP[lmcnoQRpqRSrZstuvwxSyz{|}~TPUQVTWD?J@$OpenBSD: read_bsd_terminfo.c,v 1.5 1999/03/02 06:23:29 millert Exp $ &ZlP|e  eP - e4P - eP( - e|e  e H|e  e H8|e  e - e|e  e|e  e@\ - e=A|e  eŠ - e@A|e  e`Tp|e  e ǸH|e  e - e|e  e - e|e  e@ - e$OpenBSD: truncate.c,v 1.6 1997/04/26 08:50:13 tholo Exp $$OpenBSD: tcsetpgrp.c,v 1.3 1997/07/25 20:30:15 mickey Exp $$OpenBSD: tcgetpgrp.c,v 1.2 1996/08/19 08:34:40 tholo Exp $$OpenBSD: tcflush.c,v 1.2 1996/08/19 08:34:39 tholo Exp $$OpenBSD: tcdrain.c,v 1.2 1996/08/19 08:34:38 tholo Exp $$OpenBSD: cfsetspeed.c,v 1.2 1996/08/19 08:34:37 tholo Exp $$OpenBSD: cfsetospeed.c,v 1.2 1996/08/19 08:34:37 tholo Exp $$OpenBSD: cfsetispeed.c,v 1.2 1996/08/19 08:34:36 tholo Exp $$OpenBSD: cfmakeraw.c,v 1.3 1998/08/20 19:45:57 deraadt Exp $$OpenBSD: cfgetospeed.c,v 1.2 1996/08/19 08:34:35 tholo Exp $$OpenBSD: cfgetispeed.c,v 1.2 1996/08/19 08:34:34 tholo Exp $`P8 ܀ހ@X$OpenBSD: vprintf.c,v 1.2 1996/08/19 08:33:13 tholo Exp $$OpenBSD: setbuffer.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: puts.c,v 1.2 1996/08/19 08:32:59 tholo Exp $$OpenBSD: fscanf.c,v 1.3 1997/07/25 20:30:09 mickey Exp $$OpenBSD: freopen.c,v 1.4 1998/11/10 22:10:21 deraadt Exp $$OpenBSD: fputc.c,v 1.3 1996/10/28 05:32:54 tholo Exp $$OpenBSD: fgetc.c,v 1.2 1996/08/19 08:32:27 tholo Exp $8/etc/rpc8x$OpenBSD: regexec.c,v 1.7 1997/04/30 05:51:10 tholo Exp $$OpenBSD: engine.c,v 1.4 1997/04/28 20:44:57 millert Exp $$OpenBSD: regerror.c,v 1.5 1998/03/19 00:30:10 millert Exp $54444444p4`4H4844333 33 33` 3P38 3(3 3222222p2H2@2$OpenBSD: regcomp.c,v 1.6 1998/08/14 21:39:35 deraadt Exp $88888h88`8X88P8(88 888787787x787686686686688=P=H=@=8=0=(= ===<< < < < < < < < < < <<: ?:@9[9\9\9]9^9^9_9x_9h`9X{9@{90|9 }9}9~8$OpenBSD: ethers.c,v 1.10 1998/11/18 23:28:54 deraadt Exp $xx:xx:xx:xx:xx:xx$OpenBSD: sethostent.c,v 1.4 1997/03/15 21:53:50 pefo Exp $o$OpenBSD: ns_ntoa.c,v 1.7 1997/08/24 21:25:48 millert Exp $$OpenBSD: ns_addr.c,v 1.4 1997/07/21 20:31:05 deraadt Exp $$OpenBSD: linkaddr.c,v 1.2 1996/08/19 08:29:27 tholo Exp $0123456789abcdef$OpenBSD: iso_addr.c,v 1.2 1996/08/19 08:29:23 tholo Exp $0123456789abcdef$OpenBSD: ipx_ntoa.c,v 1.2 1996/08/19 08:29:20 tholo Exp $xxxx.xx:xx:xx:xx:xx:xx.uuuuu$OpenBSD: ipx_addr.c,v 1.3 1997/07/09 01:08:39 millert Exp $$OpenBSD: inet_netof.c,v 1.3 1997/04/05 21:13:13 millert Exp $$OpenBSD: inet_makeaddr.c,v 1.3 1997/04/05 21:13:12 millert Exp $$OpenBSD: inet_lnaof.c,v 1.3 1997/04/05 21:13:11 millert Exp $$OpenBSD: getservbyport.c,v 1.3 1997/07/09 01:08:35 millert Exp $$OpenBSD: getservbyname.c,v 1.4 1998/11/20 11:18:44 d Exp $$OpenBSD: getprotoname.c,v 1.3 1997/07/09 01:08:32 millert Exp $$OpenBSD: getnetnamadr.c,v 1.10 1997/12/02 01:34:05 deraadt Exp $$OpenBSD: getnetbyname.c,v 1.5 1997/07/09 01:08:29 millert Exp $$OpenBSD: getnetbyaddr.c,v 1.5 1997/07/09 01:08:28 millert Exp $$OpenBSD: setlocale.c,v 1.6 1997/07/09 01:08:21 millert Exp $CCCCCCC$OpenBSD: morecrypt.c,v 1.9 1998/03/22 19:01:20 niklas Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ $OpenBSD: crypt.c,v 1.13 1998/03/22 19:01:18 niklas Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz$OpenBSD: _warnx.c,v 1.3 1996/08/19 08:21:38 tholo Exp $$OpenBSD: _warn.c,v 1.3 1996/08/19 08:21:36 tholo Exp $$OpenBSD: _vwarnx.c,v 1.3 1996/08/19 08:21:35 tholo Exp $$OpenBSD: _sys_siglist.c,v 1.2 1996/08/19 08:21:27 tholo Exp $$OpenBSD: _errx.c,v 1.4 1996/08/19 08:21:21 tholo Exp $$OpenBSD: _err.c,v 1.4 1996/08/19 08:21:19 tholo Exp $$OpenBSD: vis.c,v 1.4 1997/07/25 20:30:05 mickey Exp $$OpenBSD: utime.c,v 1.2 1996/08/19 08:27:24 tholo Exp $$OpenBSD: ttyname.c,v 1.6 1998/11/20 11:18:40 d Exp $$OpenBSD: times.c,v 1.2 1996/08/19 08:26:43 tholo Exp $$OpenBSD: signame.c,v 1.2 1996/08/19 08:26:11 tholo Exp $$OpenBSD: setmode.c,v 1.9 1998/11/18 23:28:34 deraadt Exp $$OpenBSD: setjmperr.c,v 1.2 1996/08/19 08:25:52 tholo Exp $$OpenBSD: sethostname.c,v 1.4 1998/05/13 08:51:00 deraadt Exp $$OpenBSD: raise.c,v 1.2 1996/08/19 08:25:33 tholo Exp $$OpenBSD: pwcache.c,v 1.3 1997/07/09 00:28:23 millert Exp $$OpenBSD: popen.c,v 1.9 1997/09/11 18:51:04 deraadt Exp $$OpenBSD: nlist.c,v 1.32 1998/10/04 17:24:17 millert Exp $$OpenBSD: nice.c,v 1.3 1998/05/06 23:11:43 deraadt Exp $$OpenBSD: glob.c,v 1.8 1998/08/14 21:39:30 deraadt Exp $$OpenBSD: getttyent.c,v 1.4 1997/07/09 00:28:22 millert Exp $$OpenBSD: getpass.c,v 1.5 1997/07/09 00:28:22 millert Exp $$OpenBSD: getmntinfo.c,v 1.3 1999/01/08 11:09:21 art Exp $$OpenBSD: getlogin.c,v 1.4 1998/11/20 11:18:39 d Exp $$OpenBSD: getloadavg.c,v 1.2 1996/08/19 08:23:39 tholo Exp $A$OpenBSD: getgrent.c,v 1.9 1998/11/20 11:18:37 d Exp $$OpenBSD: getbsize.c,v 1.6 1998/06/23 22:40:25 millert Exp $$OpenBSD: fts.c,v 1.18 1998/08/15 08:10:15 deraadt Exp $$OpenBSD: fstab.c,v 1.6 1997/07/09 00:28:19 millert Exp $$OpenBSD: errx.c,v 1.3 1997/07/25 20:30:02 mickey Exp $$OpenBSD: disklabel.c,v 1.4 1997/07/23 21:04:04 kstailey Exp $3333333333333334444p4h4`4P4H4@483404(4 444434444444444444444444$OpenBSD: devname.c,v 1.2 1996/08/19 08:22:18 tholo Exp $$OpenBSD: confstr.c,v 1.3 1996/09/15 09:30:55 tholo Exp $$OpenBSD: basename.c,v 1.2 1998/06/21 22:13:39 millert Exp $@$OpenBSD: alarm.c,v 1.3 1996/09/15 09:30:54 tholo Exp $@BB$OpenBSD: tcsetattr.c,v 1.2 1996/08/19 08:34:42 tholo Exp $K0KM8N@$OpenBSD: sscanf.c,v 1.3 1997/07/25 20:30:12 mickey Exp $$OpenBSD: fwrite.c,v 1.2 1996/08/19 08:32:50 tholo Exp $$OpenBSD: ftell.c,v 1.2 1996/08/19 08:32:47 tholo Exp $$OpenBSD: fgets.c,v 1.2 1996/08/19 08:32:33 tholo Exp $S$OpenBSD: regfree.c,v 1.3 1997/04/28 20:45:01 millert Exp $UP$OpenBSD: herror.c,v 1.4 1997/03/13 19:07:28 downsj Exp $YYYYpYP$OpenBSD: getservent.c,v 1.4 1998/03/16 05:07:00 millert Exp $$OpenBSD: getprotoent.c,v 1.3 1998/03/16 05:06:59 millert Exp $$OpenBSD: getnetent.c,v 1.8 1998/03/16 05:06:57 millert Exp $$OpenBSD: gethostnamadr.c,v 1.31 1998/11/20 11:18:44 d Exp $:$OpenBSD: md5crypt.c,v 1.9 1997/07/23 20:58:27 kstailey Exp $./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz$OpenBSD: verrx.c,v 1.2 1996/08/19 08:27:32 tholo Exp $$OpenBSD: waitpid.c,v 1.3 1997/07/25 20:30:06 mickey Exp $$OpenBSD: wait.c,v 1.2 1996/08/19 08:27:41 tholo Exp $$OpenBSD: siglist.c,v 1.2 1996/08/19 08:26:05 tholo Exp $$OpenBSD: getpwent.c,v 1.14 1998/08/14 21:39:29 deraadt Exp $H$OpenBSD: getcwd.c,v 1.5 1998/08/14 21:39:26 deraadt Exp $$OpenBSD: getcap.c,v 1.16 1999/02/25 21:40:17 millert Exp $$OpenBSD: exec.c,v 1.8 1998/08/14 21:39:23 deraadt Exp $$OpenBSD: err.c,v 1.4 1997/07/25 20:30:01 mickey Exp $P0$OpenBSD: vfscanf.c,v 1.6 1998/01/20 21:25:39 millert Exp $  $OpenBSD: ungetc.c,v 1.2 1996/08/19 08:33:11 tholo Exp $$OpenBSD: rewind.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: fseek.c,v 1.2 1996/08/19 08:32:46 tholo Exp $$OpenBSD: fread.c,v 1.2 1996/08/19 08:32:44 tholo Exp $!$OpenBSD: res_query.c,v 1.12 1998/08/31 18:15:29 deraadt Exp $$OpenBSD: res_mkquery.c,v 1.8 1997/04/13 22:37:21 provos Exp $$OpenBSD: res_debug.c,v 1.9 1998/03/19 00:30:06 millert Exp $ d'B@;p$OpenBSD: res_data.c,v 1.1 1997/03/13 19:07:36 downsj Exp $uuuuuuuuuuuxuhu`uPu@u8vHv@v0v vvuuuvvuuuuu$OpenBSD: nsap_addr.c,v 1.4 1997/07/09 01:08:45 millert Exp $$OpenBSD: inet_pton.c,v 1.2 1997/04/13 05:08:24 deraadt Exp $$OpenBSD: inet_ntop.c,v 1.1 1997/03/13 19:07:32 downsj Exp $$OpenBSD: inet_ntoa.c,v 1.2 1996/08/19 08:29:16 tholo Exp $$OpenBSD: inet_network.c,v 1.7 1997/07/09 01:08:37 millert Exp $$OpenBSD: md5c.c,v 1.11 1997/07/23 21:17:56 kstailey Exp $$OpenBSD: verr.c,v 1.2 1996/08/19 08:27:30 tholo Exp $$OpenBSD: warnx.c,v 1.2 1996/08/19 08:27:50 tholo Exp $$OpenBSD: warn.c,v 1.3 1997/07/25 20:30:06 mickey Exp $$OpenBSD: toupper_.c,v 1.2 1996/08/19 08:26:56 tholo Exp $`$OpenBSD: syslog.c,v 1.8 1998/03/19 00:30:03 millert Exp $$OpenBSD: sleep.c,v 1.7 1997/04/25 04:20:41 tholo Exp $$OpenBSD: getdomainname.c,v 1.3 1998/05/13 08:50:55 deraadt Exp $Xp`  @(#)strftime.c 7.57x@(#)localtime.c 7.66$OpenBSD: localtime.c,v 1.17 1999/03/09 23:06:12 pjanzen Exp $WILDABBR @ @@(#)asctime.c 7.9$OpenBSD: asctime.c,v 1.6 1999/01/29 07:09:26 d Exp $@X$OpenBSD: strtouq.c,v 1.4 1996/08/19 08:33:53 tholo Exp $$OpenBSD: strtoq.c,v 1.4 1996/08/19 08:33:52 tholo Exp $$OpenBSD: wbuf.c,v 1.4 1997/05/31 22:41:32 tholo Exp $$OpenBSD: vsnprintf.c,v 1.5 1998/07/27 02:28:28 millert Exp $$OpenBSD: sprintf.c,v 1.4 1998/01/12 06:14:31 millert Exp $$OpenBSD: setbuf.c,v 1.2 1996/08/19 08:33:04 tholo Exp $$OpenBSD: perror.c,v 1.3 1998/09/10 06:44:53 deraadt Exp $$OpenBSD: fputs.c,v 1.2 1996/08/19 08:32:43 tholo Exp $\x8$OpenBSD: res_send.c,v 1.8 1998/03/19 00:30:08 millert Exp $$OpenBSD: res_init.c,v 1.16 1998/03/16 05:07:01 millert Exp $$OpenBSD: res_comp.c,v 1.8 1997/07/09 01:08:49 millert Exp $$OpenBSD: inet_addr.c,v 1.5 1997/04/05 21:13:10 millert Exp $$OpenBSD: vwarnx.c,v 1.2 1996/08/19 08:27:39 tholo Exp $$OpenBSD: vwarn.c,v 1.2 1996/08/19 08:27:38 tholo Exp $$OpenBSD: tolower_.c,v 1.2 1996/08/19 08:26:52 tholo Exp $8$OpenBSD: time.c,v 1.2 1996/08/19 08:26:39 tholo Exp $$OpenBSD: gethostname.c,v 1.3 1998/05/13 08:50:58 deraadt Exp $!h!"h"#P#%x%'$OpenBSD: setvbuf.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: printf.c,v 1.3 1997/07/25 20:30:10 mickey Exp $$OpenBSD: fopen.c,v 1.2 1996/08/19 08:32:41 tholo Exp $*,-.l./h00|1815p$OpenBSD: send.c,v 1.2 1996/08/19 08:29:52 tholo Exp $7p79`$OpenBSD: catopen.c,v 1.8 1996/09/15 09:31:23 tholo Exp $$OpenBSD: catgets.c,v 1.5 1996/09/15 09:31:22 tholo Exp $$OpenBSD: catclose.c,v 1.4 1997/07/09 01:08:57 millert Exp $@PJKKLX<MNQ`W0VW WW8XPY[D[[L[T[\\h\](^D^^^_(\]l]^D^^^_X\_`_`cm$OpenBSD: opendir.c,v 1.6 1998/08/15 08:10:14 deraadt Exp $$OpenBSD: getpagesize.c,v 1.2 1996/08/19 08:23:54 tholo Exp $$OpenBSD: closedir.c,v 1.3 1998/11/20 11:18:37 d Exp ${X{|x$OpenBSD: seekdir.c,v 1.3 1997/09/22 05:09:39 millert Exp $$OpenBSD: telldir.c,v 1.2 1996/08/19 08:26:35 tholo Exp $$OpenBSD: readdir.c,v 1.3 1998/11/20 11:18:39 d Exp $$OpenBSD: fdopen.c,v 1.2 1996/08/19 08:32:20 tholo Exp $$OpenBSD: ftruncate.c,v 1.7 1998/11/20 11:18:52 d Exp $$OpenBSD: rget.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: refill.c,v 1.3 1996/08/19 08:33:00 tholo Exp $$OpenBSD: flags.c,v 1.3 1996/08/19 08:32:37 tholo Exp $$OpenBSD: fclose.c,v 1.2 1996/08/19 08:32:19 tholo Exp $$OpenBSD: db.c,v 1.3 1999/02/15 05:11:23 millert Exp $$OpenBSD: hash.c,v 1.7 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_open.c,v 1.6 1999/02/15 05:11:22 millert Exp $$OpenBSD: bt_get.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: bt_conv.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: bt_close.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: snprintf.c,v 1.6 1998/01/12 06:20:56 millert Exp $$OpenBSD: mktemp.c,v 1.13 1998/06/30 23:03:13 deraadt Exp $$OpenBSD: hash_log2.c,v 1.4 1999/02/15 05:11:24 millert Exp $$OpenBSD: hash_func.c,v 1.5 1999/02/15 05:11:24 millert Exp $8$OpenBSD: hash_buf.c,v 1.7 1999/02/15 05:11:24 millert Exp $$OpenBSD: bt_put.c,v 1.6 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_delete.c,v 1.5 1999/02/15 05:11:22 millert Exp $@(#)bt_split.c 8.10 (Berkeley) 1/9/95$OpenBSD: bt_seq.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_search.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_utils.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_overflow.c,v 1.5 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_page.c,v 1.5 1999/02/15 05:11:23 millert Exp $$OpenBSD: mpool.c,v 1.6 1999/02/15 05:11:25 millert Exp $$OpenBSD: fprintf.c,v 1.3 1997/07/25 20:30:09 mickey Exp $ 0000000000000000$OpenBSD: fvwrite.c,v 1.8 1998/11/20 06:13:26 millert Exp $$OpenBSD: umoddi3.c,v 1.2 1996/08/19 08:30:48 tholo Exp $$OpenBSD: qdivrem.c,v 1.2 1996/08/19 08:30:42 tholo Exp $$OpenBSD: isnan.c,v 1.3 1996/08/19 08:17:39 tholo Exp $$OpenBSD: isinf.c,v 1.3 1996/08/19 08:17:38 tholo Exp $;sd0p ?rsd0p @sd1a Arsd1a Bsd1b Crsd1b Dsd1c Ersd1c Fsd1d Grsd1d Hsd1e Irsd1e Jsd1f Krsd1f Lsd1g Mrsd1g Nsd1h Orsd1h Psd1i Qrsd1i Rsd1j Srsd1j Tsd1k Ursd1k Vsd1l Wrsd1l Xsd1m Yrsd1m Zsd1n [rsd1n \sd1o ]rsd1o ^sd1p _rsd1p `sd2a arsd2a bsd2b crsd2b dsd2c ersd2c fsd2d grsd2d hsd2e irsd2e jsd2f krsd2f lsd2g mrsd2g nsd2h orsd2h psd2i qrsd2i rsd2j srsd2j tsd2k ursd2k vsd2l wrsd2lxsd2m yrsd2m zsd2n {rsd2n |sd2o }rsd2o ~sd2p rsd2p sd3a rsd3a sd3b rsd3b sd3crsd3c sd3d rsd3d sd3e rsd3e sd3f rsd3f sd3g rsd3g sd3h rsd3h sd3i rsd3i sd3j rsd3j sd3k rsd3k sd3l rsd3l sd3m rsd3m sd3n rsd3n sd3o rsd3o sd3p rsd3p sd4a rsd4a sd4b rsd4b sd4c rsd4c sd4d rsd4dsd4e rsd4e sd4f rsd4f sd4g rsd4g sd4h rsd4h sd4irsd4i sd4j rsd4j sd4k rsd4k sd4l rsd4l sd4m rsd4m sd4n rsd4n sd4o rsd4o sd4p rsd4p xd0a rxd0a xd0b rxd0b xd0c rxd0cZxd0d rxd0d xd0e rxd0e xd0f rxd0f xd0g rxd0g xd0hrxd0h xd0i rxd0i xd0j rxd0j xd0k rxd0k xd0l rxd0l xd0m rxd0m xd0n rxd0n xd0o rxd0o xd0p rxd0p xd1a rxd1a xd1b rxd1b xd1c rxd1c xd1d rxd1d xd1e rxd1e xd1f rxd1f xd1g rxd1g xd1h rxd1h xd1i rxd1i xd1j rxd1jZxd1k rxd1k xd1l rxd1lPxd1m rxd1m xd1n rxd1n xd1o rxd1o xd1p rxd1p xd2a rxd2a xd2b rxd2b xd2c rxd2c xd2d rxd2d xd2e rxd2e xd2f rxd2f xd2g rxd2g xd2h rxd2h xd2i rxd2i  xd2j !rxd2j "xd2k #rxd2k $xd2l %rxd2l &xd2m'rxd2m (xd2n )rxd2n*xd2o +rxd2o ,xd2p -rxd2p.xd3a /rxd3a0xd3b 1rxd3b 2xd3c 3rxd3c 4xd3d 5rxd3d 6xd3e7rxd3e 8xd3f 9rxd3f :xd3g ;rxd3g <xd3h =rxd3h >xd3i ?rxd3i @xd3j Arxd3j Bxd3k Crxd3k Dxd3l Erxd3lFxd3m Grxd3m Hxd3n Irxd3nJxd3o Krxd3o Lxd3p Mrxd3pNxy0a Orxy0a Pxy0b Qrxy0b Rxy0c Srxy0c Txy0d Urxy0d Vxy0e Wrxy0e Xxy0f Yrxy0f Zxy0g [rxy0g \xy0h ]rxy0h ^xy0i _rxy0i `xy0j arxy0j bxy0k crxy0k dxy0l erxy0l fxy0m grxy0m hxy0n irxy0n jxy0o krxy0o lxy0p mrxy0p nxy1a orxy1a pxy1b qrxy1b rxy1csrxy1c txy1d urxy1d vxy1e wrxy1e xxy1f yrxy1f zxy1g {rxy1g |xy1h^}rxy1h ~xy1i rxy1i xy1j rxy1j xy1k rxy1k xy1l rxy1l xy1m rxy1m xy1n rxy1n xy1o rxy1o xy1p rxy1p xy2a rxy2a xy2b rxy2b xy2c rxy2c xy2d rxy2d xy2e rxy2e xy2f rxy2f xy2g rxy2g xy2h rxy2h xy2i rxy2i xy2j rxy2j xy2krxy2k xy2l rxy2l xy2m rxy2m xy2n rxy2n xy2o rxy2o xy2p rxy2p xy3a rxy3a xy3b rxy3b xy3c rxy3c xy3d rxy3d xy3e rxy3e xy3f rxy3f xy3g rxy3g xy3h rxy3h xy3i rxy3i xy3j rxy3j xy3k rxy3k xy3l rxy3l xy3m rxy3m xy3n rxy3n xy3o rxy3o xy3p rxy3p cd0arcd0a cd0b rcd0b cd0crcd0c cd0d rcd0d cd0e rcd0e cd0f rcd0f cd0g rcd0g cd0h rcd0h cd0i rcd0i cd0j rcd0j cd0k rcd0k cd0l rcd0l cd0m rcd0m pcd0nrcd0ncd0orcd0ocd0p rcd0p nst0 est0 enst0 rst0 nrst0 erst0 enrst0  st1nst1 est1 enst1 rst1 nrst1 erst1 enrst1 rd0a rd0c rrd0a rrd0c fd0a fd0b fd0c rfd0a rfd0b rfd0c fd0Ba fd0Bb fd0Bcrfd0Ba rfd0Bb rfd0Bc fd0Ca fd0Cb fd0Cc rfd0Ca rfd0Cb rfd0Cc fd0Da fd0Db fd0Dc rfd0Da !rfd0Db "rfd0Dc #fd0Ea $fd0Eb %fd0Ec &rfd0Ea 'rfd0Eb (rfd0Ec )fd0Fa *fd0Fb +fd0Fc,rfd0Fa -rfd0Fb .rfd0Fc /fd0Ga00fd0Gb 1fd0Gc 2rfd0Ga 3rfd0Gb 4rfd0Gc 5fd0Ha 6fd0Hb 7fd0Hc 8rfd0Ha 9rfd0Hb :rfd0Hc ; uk0< uk1= ss0> scan0܀? ss1@ scan1܀Attyp0 Bptyp0!Cttyp1 Dptyp1 Ettyp2 Fptyp2 Gttyp3 Hptyp3 Ittyp4 Jptyp4 Kttyp5 Lptyp5 Mttyp6 Nptyp6 Ottyp7 Pptyp7 Qttyp8 Rptyp8 Sttyp9 Tptyp9 Uttypa Vptypa Wttypb Xptypb Yttypc Zptypc [ttypd \ptypd ]ttype ^ptype _ttypf `ptypf avnd0a brvnd0a cvnd0bdrvnd0b evnd0c frvnd0c gvnd0d hrvnd0d ivnd0e jrvnd0e kvnd0f lrvnd0f mvnd0g nrvnd0g ovnd0h prvnd0h qvnd0i rrvnd0i svnd0j trvnd0j uvnd0k vrvnd0k wvnd0l xrvnd0l yvnd0m zrvnd0m {vnd0n |rvnd0n }vnd0o ~rvnd0o vnd0p rvnd0p svnd0a rsvnd0asvnd0b rsvnd0bsvnd0c rsvnd0csvnd0d rsvnd0dsvnd0e rsvnd0esvnd0f rsvnd0fsvnd0g rsvnd0gsvnd0h rsvnd0hsvnd0i rsvnd0isvnd0j rsvnd0jsvnd0k rsvnd0ksvnd0l rsvnd0lsvnd0m rsvnd0msvnd0n rsvnd0nsvnd0o rsvnd0osvnd0p rsvnd0pvnd1a rvnd1a vnd1b rvnd1bvnd1c rvnd1c vnd1dprvnd1d vnd1e rvnd1epvnd1f rvnd1fpvnd1g%rvnd1gvnd1h rvnd1h vnd1i&rvnd1i vnd1j rvnd1j vnd1k rvnd1k vnd1l rvnd1l vnd1m rvnd1m vnd1n rvnd1n vnd1o rvnd1o vnd1p rvnd1p svnd1a rsvnd1asvnd1b rsvnd1bsvnd1c rsvnd1csvnd1d rsvnd1dsvnd1e rsvnd1esvnd1f rsvnd1fsvnd1g rsvnd1gsvnd1h rsvnd1hsvnd1i rsvnd1isvnd1jrsvnd1jsvnd1k rsvnd1ksvnd1l rsvnd1lsvnd1m0rsvnd1msvnd1n rsvnd1nsvnd1o`rsvnd1osvnd1p rsvnd1pvnd2a rvnd2a vnd2b `rvnd2bvnd2c rvnd2c vnd2d rvnd2dvnd2e rvnd2e vnd2f rvnd2f vnd2g rvnd2g vnd2h rvnd2h vnd2irvnd2i vnd2j rvnd2j vnd2k rvnd2k`vnd2l rvnd2l vnd2m(rvnd2m vnd2n rvnd2n vnd2orvnd2ovnd2p rvnd2p svnd2a rsvnd2asvnd2b`rsvnd2bsvnd2c  rsvnd2c svnd2d  rsvnd2d svnd2e  rsvnd2esvnd2f rsvnd2fsvnd2g rsvnd2gsvnd2h rsvnd2hsvnd2i rsvnd2isvnd2j rsvnd2jsvnd2k rsvnd2ksvnd2l rsvnd2lsvnd2m rsvnd2msvnd2n rsvnd2n svnd2o !rsvnd2o"svnd2p #rsvnd2p$vnd3a %rvnd3a &vnd3b 'rvnd3b (vnd3c )rvnd3c*vnd3d +rvnd3d ,vnd3e -rvnd3e .vnd3f /rvnd3f 0vnd3g. 1rvnd3g 2vnd3h 3rvnd3h4vnd3i 5rvnd3i 6vnd3j 7rvnd3j 8vnd3k 9rvnd3k :vnd3l ;rvnd3l <vnd3m =rvnd3m >vnd3n ?rvnd3n @vnd3o Arvnd3o Bvnd3p Crvnd3p Dsvnd3apErsvnd3aFsvnd3b Grsvnd3bHsvnd3cIrsvnd3cJsvnd3d Krsvnd3dLsvnd3e Mrsvnd3eNsvnd3f Orsvnd3fPsvnd3g Qrsvnd3gRsvnd3h Srsvnd3hTsvnd3i Ursvnd3iVsvnd3j Wrsvnd3jXsvnd3k Yrsvnd3kZsvnd3l[rsvnd3l\svnd3m ]rsvnd3m^svnd3n _rsvnd3n`svnd3oarsvnd3obsvnd3p crsvnd3pdsound0 eaudio0 fmixer0 g audioctl0 htun0(Pitun1 jtun2 ktun3 lccd0a mrccd0a nccd0b orccd0b pccd0c qrccd0c rccd0d srccd0d tccd0e urccd0e vccd0f wrccd0f xccd0gyrccd0g zccd0h {rccd0h |ccd0i }rccd0i ipl~ccd0jrccd0j ccd0k"rccd0k ccd0l rccd0l ccd0m rccd0m ccd0n rccd0nccd0o rccd0o ccd0p rccd0p ccd1a rccd1a ccd1b rccd1b ccd1c rccd1c ccd1d rccd1d ccd1e'rccd1e ccd1f rccd1f ccd1g rccd1g ccd1hrccd1h ccd1i rccd1i ccd1j rccd1j ccd1k rccd1k@ccd1l rccd1l ccd1m rccd1m ccd1n rccd1n ccd1o rccd1o ccd1p rccd1p ccd2a rccd2a ccd2b rccd2b ccd2c rccd2c ccd2d rccd2dccd2e rccd2eccd2frccd2f ccd2g rccd2gccd2h rccd2hccd2i rccd2iccd2j rccd2j ccd2k rccd2k ccd2l rccd2l ccd2m rccd2m ccd2n rccd2n ccd2o rccd2o ccd2p rccd2p ccd3a rccd3a ccd3b rccd3b ccd3c rccd3cccd3d rccd3d ccd3erccd3e ccd3f rccd3f ccd3g rccd3g ccd3h rccd3h ccd3irccd3i ccd3j rccd3j ccd3k@rccd3k ccd3l rccd3l ccd3m rccd3m ccd3n rccd3n ccd3o rccd3o ccd3p rccd3p bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8!bpf9 ipnat ipstateipauth bwtwo0cgtwo0 cgthree0cgfour0 lkmcgsix0 cgeight0  cgfourteen0tcx0 !random "srandom#urandom$prandom%arandom&hxfs0 @y< @ 0~M0{%`@!R>L `@$<@!D  @65@ @@! ^` `@2@`$`@2@` 2 @ + @ 2&`@ @x @: :` =` `  @x @& &` 2 @ "@  @ "@ " @ "  @@@a>'䶐"@ '  >J@ "א@c` #` @%=    @ @+; >` `L` G@D @+: ` 88` 3@+:` Lג !@y "  0" 0` $ 0@   0@ " 0L$``L  `0@  @@ @G "v `0"  `0 $`0@4 %8`  "@@& `/ $.$ `p`t $&$  @ "A `0 `d$`0``0 >'ℐ"0~< , K$ `t "@& 耤  $>Jc`0 @#`0 " `0"2`@`0 $`0@ `@$ " @ 8     !>Jc`8 #`8   @$ , cD , 4` @<   $ @ # "Ӱ `0"J>`0 $`0@ >>KS #5 @wl @  %#$@u " `0"2 `0 $`0@c " K$  "Ѐ > 耢 ?` <$`` * : ` 4`.$@ (,`@` '$K  $$@, $ 0" 0` $ 0@  0@ " 0J$`@" " @ 8   >'"@  ``H'Ɣ@@ " ` @ 2 @  `0 $`0>'ǐ"@ J    nfs_write modenfs_write proc0    |`!D>*:" 2 @>#p@"@>*."(  `  ?`4`" @b @ "`  $` @   $`x0 x`= 6p l` ` ` B 2`¾ X J0T 0h" 0J4@ho!6>L `@$ `!D  @` @2'` @B! ,` `@ `$`@`   @J ` <`` >J c '@Ș`@u0c`$ "`$@"ߕ=  % 8   @(: @ "ݰ  l?2`@ 6@$ l`4`= ` B 8 2 d` =  B<``@g d 4$ , ` 6 $ ,{ ɐ !;>L `@$ `!D  @` @* @ ! 2` `@ `$`@` I> @ o` <` H  d $$ ` `8$ ` d * $ d$ d t "  ` ` & ` p d@  ` d $ p 8  d t@ $ p $ t 0 ?$ 0` 2$ , $ ,{j (`  @P "0! $ , 0 " 0@Hi   㿘 !D @!Ip 2#> @`  aX I_+  "   IS nfsvinval㿘 !D @ | >!X!*  4   >,b "  "   @`G 28     4  @`1  ? 4 ?4 ސ   b 䀧  ? 4 ?4 Ȑ  㿘> 耢 V>.">"   ". 0@ h?2& "& @ 6@& h 0@  l& 02 & "& @ 6@& l& & " ""ˍ # `L$ 0D @2  0 & 0H /*% \cҐH 0J  Process killed due to text file modification nfs_doio: type %x unexpected h  \' !D  |'$$$ 0@- <$' H' T ; 2`* @ *` < 0@ $>J# @# ɢ'$>J,Ț`@ , 0@" d <$' H'$ @ >J "  @ "k @ T82* * <>J# @u#  $& p" < T ; 2`* *`  <"@ "@  @ 8 H@#3@& t& tk` g`@!>L @$@ !D  @6 @ @>-$@ >-@!I`T@C>-   :&  <>J# 4@# 4-<"< P ; 2`* @ *` <@@@@6 #@@@*@%@@@@ `@>-! `"~ 0& 4(& 0x `" $' T82`* *`  `: @ C < H ` '$>Jc`( "`(  0  @` ''̘̐ 0@@& 0@ ̀  0  0 ?& 0` 0@*@& 0`& 0 "` 0 & 0 0 `H /*%bWH 0" 0$& 0" & d 0(& 0$& 4ྐ 4& d& `Ȁ`& @@ro Hnfs_boot: no suitable interfacenfs_boot: using network interface '%s' nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%drevarp failed, error=%dnfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: bootparam whoami, error=%dnfs_boot: server_addr=%s hostname=%s X> !L ">M#H   4    2 4 2 >.ܗ#@ؒY >.#` , ">.܄#0a " >.y#a 7蒒 >.k#ȐAޒ >.b#!>/ RL'Ēݿ@!  / ,  a ֱ$  >/D ,Ȑ@!q //ɐ?'>%!"`@x ">/- @!>/ hR'Ē> ݉ؐ  nfs_boot: bootparam get %s: %dnfs_boot: mountd %s, error=%dnfs_boot: portmap NFS/v2, error=%d㻘@ >/"@j >/#ab Ȗ >/#(ޒ @ Ѵi :. O  : . @.`J@  .nfs_boot: bootparam_whoami: bad reply 㿐 $ ' " ab$ $ $ 'ab"  $  o4`Ԗ  >`  (  %' ' >% ">  a4` $` '>W">.a ' '>0ϐ @ H "% %nfs_boot: bootparam_getfile: bad reply 㿈>% > >!؀  '@ 96 "@4 ab  l ) Y't '쒒 '#' f耢  '@ I  . .&>0r!$ 㿐#ab   0@ '& b  $ `  H` #   'W $ '   0 H$s㿘>!t>W >"c8     㿐>#p>Wa> 8* @    2T 2 @ 2   W  2O& 2  >)UҖ " !&AWɐ G @!$|$ `"` @2@T`2 @`@Ô @`2` $" $@$   $  $  4 & nfs_inactive: pushing active㿘>#p ># `|R` >1Z~"x  @  `$`    @W w ` 4`  t  nfs_reclaim: pushing active㿘 >c``|` !DT` >1#XZF `"  2"  "@!"`@ ` @ & "`   @ & "``@ 2T  " T *  T @   G`| $`| Nqnfs server, too many leases nqsrvnumlnfs_nqlease.c: Phoney lpp\  @ d`> @>"$@8&@p 1`:H /* !  H>JcaD "aD9  `d'x`h'|  `$€  H 00>.!>O @L*`  x @2| $@2  (@ "' 8 x0% H }  `   @`  U"C   2? K@P  E      @< 0  2 @ "   2@ 9   T 0 $@@ T@ @0 `@ $7 @O@@ 32 @@   %@%@ $7 H 0g H 0^ >J#<#>b(@>2 '>K9>2㤒  þ <b(@㤐 < /d @ <  $7  @K' 8x' |' $ (? 2>2s '" $' % HH /* ! @@TH 0 %@>J#< @@"<"@ x'  ?  #\#` #d 㿘>'!$6"@ >  A6`& `6  @2  沔"` & `6& (6`D &`D>L> ? >) " "  >)c$" ">)  $>) 2 >)㨀 2 ""  "  >) "c""   2 " 㿐? !)@ >'">  2  @   `0 2` `  2'' @l}build > MLENmbuf siz=%d Bad nfs svc reply0'D'L'P'T``  >#P>H 8 LP "k4#2i @3  ` 3  4 H /* ' , 6 ,H 0 $$  $ 4  j   * $  *">'"2 >    `0 "* ``  U@ 4    @_@E @D`d'`h%  `$€` ``$`` @  "@` 3` ``  ?&@ * `  2H /* '  6 H 0 """2  $@ `$` '`   $` ` ' "@` "  !@( #\>4!(  >4֤!8#`#d#h#l#pT#   @`V / 2  ?" 4  ?"    ?"`"   h "   " ? "  0  @@ @ $ @N, "@W @"BH /* 'T *`@`?2`H 0   "&T H /* ' >O @"@> !2` ?* *   >- P"@  "P & H 0 T * @m2 "   2nqexp㿘>L  @$      # `  >5 ` 6  >L@ 2 "   `2㿘>)##@ ö >H 8`>L` ``  `?#ߐ @4`u``2 b 2`d {> T 2 ` {4`>"  &㨀@` %"` ` @`"`@`"``"``@"@`8" H`  >#P` b G(H /* ' R *`@`?2`H 0  ` "( H /* '`>O @"@> !2` ?* *   >-  P"@   "P & H 0  R *`@ ("@qI 2  0 "   2u /p 0>Jca<?"a<@2E`㾸`,`0`@``LX`8'T 5'P``  "  ` 'PTP @c7L e L@  H$`T#\<#`8#d  H,@R@  g  T`L ؀ H"x T  P@"@  ` 'PTP @cL 0 L e `L T  P@"@  TP@ca   0'PT  P@"@  `'PTP @bԘL  02L 4@`$`\0#\`L`@h#` <$`T#\#`8#d ,@Q@    0`L e H" 0 #"`\4QQ $`T#\<#`8#d  ,@Q@  ϐ  `\`L @ H `\,4@#\#`~#d4k?Q!4  $`T`L   d , d,@<#\#`8@QI#d    <`L  H2   $ @  "@` 86<  ?" .8 >cT  2H /* '>H`8` 2`H 0 """2 В <"'<" '88<` '8,# #@`\`#@@`  #@D<#`  $ @  "@`S 86  ?" S.8 >cTF  2H /* '>H`8` 2`H 0 """2 { <"'<" '88<T'8 T@gJ# ( ,  0 @ L 8' 6'``  "  ` ' @a~ N@   H& T#\#`#d  H@Pf`   L H   @"@  ` ' @aH  ﬔ  L   @"@ @a   wX  "F6'l >.! @>O L*`  @2 $@2  (@  "2,    Ք Ơ 2  `"  `@ 2`    ?#ߐ @6H p  $>J c`D @[#` | 'R`  ?   $  @  "@  f |   ?$4^ |  $ @  "@   9  ?"1 >cT  2H /* '>H`8` 2`H 0 """2 :  l>4 !"'" '` "`  |R '#?"? |`R` `R`@`В   $ @  "@` 6  ?" . >cT  2H /* '>H`8` 2`H 0 """2 Ւ "'" '  '` #`##\>L@L]#` B .  @"@ | ' @_Ҙ ( >L  @#\@'ܐܒ@a  !0   D>J c`D @Y#` |`'R`  ? ``$`` @  "@  d |``  ?$@4\ |  $ @  "@   9  ?"1 >cTՔ  2H /* '>H`8` 2`H 0 """2    l>4ې!"'" ' "  |@R '"@` ? "? |R`R`@_ "\0]      #\#`#d#h#l#p@Z^ T`/  2   ?" 4  ?"    ?$ `$  o  "      $    ? "''\ @Q P`@HD\ @Qǐ㼐'L'P $ ,$ 0$ @@R   0 @ D'L 'P  L 7``  "  ` 'PLP @^ P @   H$ T#\ #`#d  H@Mk`   L L  HLk L  P@"@  ` 'PLP @^M   찔  L L  P@"@  PL@^   {0<'Pv`  0/$` (" 2` `@2  $`"` ` ``"``"" ` 2`$`" $`M cld kerbnqnfstimrX@;  @27@><π!!   Ā4 Ѐ@4z Ȁ 2 s 2 &  & &  @& @ $&  Q & @2  )>La>/# 2  P "}  8  ''''@HԐq  B  K 2a &  @X@ & "`  @"`ྀ H&  @ @djLA&  " @" @2  & Z & @2 @">!X@p  Ȓ!><2 W @Ca 䀢` "`  "@`"`& "@ ے 3 2Ւ #"  #X` X ` " `  ` `  `" ``@2` `߄ 2`"`:`     $ 2 2 "`"`  2 "  " "`"`  2 " nfs㿘>>`#p@"H /* !>)## " 2H 0 >2!X!X, >JH  >=c @  2!D! @ `"``@ 2`Hِnqlc㿘  " !>> 6   ͖     ?#` @6 㿘 ?# @`6 _build > MLEN,0@ L8'T 5'P``  "    'PTP @[ɘL e L  H$T#\<#`8#d  H@J@   TL  H"1 T  P@"@    'PTP @[L 0 L L T  P@"@  TP@[   0'PT  P@"@   'PTP @[fL  0L0#\ 4L`@a|#` ".L  $T#\<#`8#d #\<#`8#d @J5@ ~ L  H  <@`78 ` !40@Be 2 4`@   @   0@BS 2,@4`@   @   @0@BA 2,@X4cĖI4  $TL  #\<#`8#d #\<#`8#d \@IϚ@  L  HX<@_ј8<  $ @  "@` 86<  ?" .8 >cT  2H /* '>H`8` 2`H 0 """2 R <"'<" '88<  '8 " $㾸 , 0 @  LX 8'T 5'P``  "  ` 'PTP @ZXL O L@  H$ T#\<#`8#d  H,@I?@`   T ... ... . ..misckeymaps @ 7y   @@7yҪ@@P^<@`bT U7y\@(A7yQ7yQ7yx?dGC7y xp7y xp7y  }UA7y 07yn7yn V!7y<h7y<h7y< "ڠn/c˫a7y<'(7y<'(7y='(X5!7y<z7y<z7y=(na7y<u7y<u7y='(Xz!7y<7y<7y=(na7y<7y<7y='(X_!7y<ku7y<ku7y=(n a7y7y=H>7y=(nVa7y=C7y=C7y=( !7y= Ә7y= Ә7y=(n`0a7y=7y=7y=(?X!7y=hX7y=hX7y=(n圠a7y=2w7y=2w7y? h0VG7y>G7y? h2=!7y>7y>7y? hn2@ba7y>ܘ7y>ܘ7y? h3$dfr!7y>7y>7y? hn3\Oa7y>7y>7y? h4._!7y> 7y> 7y? hn4U?a7y> wh7y> wh7y? h5l0 !7y>/07y>/07y? hn5Q@wa7y>} (7y>} (7y? h6ڀA!7y>1X7y>1X7y? hn6n|/a7y>P7y>P7y? h7~ !7y>r7y>r7y? hn7o/a7y>m7y>m7y? h8e !7y>@7y>@7y? hn8ta7y>87y>87y? h9;u3!7y>!c]7y>!c]7y? hn9.va7y>$^=7y>$^=7y? h:'!7y>&'7y>&'7y? hn:?a7y>)"Ҡ7y>)"Ҡ7y? h;ˎ!7y>*S7y>*S7y? hn;a7y>-N7y>-N7y? h<!7y>/7y>/7y? hn<_a7y>2i7y>2i7y? h=9i!7y>3D7y>3D7y? hn=ka7y>7p7y>7p7y? h>j+!7y>87y>87y? hn>F-a7y?7y?7y? h?8 !7y?˄7y?˄7y? hn?Y.a7y?p7y?p7y@(J8y!7y?۠7y?۠7y@(J8na7y?ظ7y?ظ7y@(J8G !7y?p`7y?p`7y@(J8n'na7y?MX7y?MX7y@(J8 ֽ!7y?r7y?r7y@(J8nSj$a7y?!a7y?!a7y@(J8U?!7y?"H7y?"H7y@(J8nRka7y?%(7y?%(7y@(J8>z!7y?'W7y?'W7y@(J8nO\a7y?*R|7y?*R|7y@(J8p!7y?+7y?+7y@(J8n2a7y?.~7y?.~7y@(J8f!7y?0H67y?0H67y@(J8nõa7y?3C7y?3C7y@(J8}|!7y?5 ˘7y?5 ˘7y@(J8n@%a7y?87y?87y@(J8͕!7y?98Ѩ7y?98Ѩ7y@(J8n&-a7y@1w87y@1w87y@(J8Y !7y@bh7y@bh7y@(J8n2a7y@]y`7y@]y`7y@(J8T[[!7y@'1(7y@'1(7y@(J8nZa7y@ " 7y@ " 7y@(J8as}!7y@ S3P7y@ S3P7y@(J8n-a7y@NH7y@NH7y@(J8@Dz!7y@7y@7y@(J8n ؆ha7y@7y@7y@(J8od;!7y@`7y@`7y@(J8nVHra7y@=7y@=7y@(J8 !7y@b7y@b7y@(J8na7y@p7y@p7y@(J8sP5!7y@7y@7y@(J8nf2!7y@-q7y@-q7yAȎE87!7y@0N7y@0N7yAȎE0!7y@3+7y@3+7yAȎE!7y@7m7y@7m7yAȎE>!7yA#7yA#7yAHo!7yA7yA7yAxoh!7yAi2X7yAi2X7yAWoO݈d!7yA%p7yA%p7yA&o ua7yB7yB7yC5X I!7yB(7yB(7yC5XyABa7yB 7yB 7yC5X T1!7yB 7yB 7yC5XFba7yB 7yB 7yC5X ѷ!7yB|?7yB|?7yC5Xm6a7yBw7yBw7yC5X 3kg!7yBA7yBA7yC5Xkyڦa7yB"7yB"7yC5X ! !7yBlx7yBlx7yC5XbRa7yBgp7yBgp7yC5X g~!7yB1o87yB1o87yC5Xa7yB ,L07yB ,L07yC5X !7yB!]q`7yB!]q`7yC5X^a7yB$7yB$7yC5X V!7yB&" 7yB&" 7yC5X8a7yB)7yB)7yC5X ^!7yB*7yB*7yC5XQP/na7yB-{7yB-{7yC5X 1KW!7yB/37yB/37yC5X 4Be*a7yB27yB27yC5X Ml!7yB4oH7yB4oH7yCͩ @jma7yB7j@7yB7j@7yC5X ֧)u!7yB8p7yB8p7yCͩ a7yB;h7yB;h7yC5X !7yCř7yCř7yCͩ a7yCv7yCv7yC5X YD!7yC-7yC-7yCͩ a7yC 7yC 7yC5X \;!7yC 07yC 07yC̞ͩ$a7yCI7yCI7yC5X *F!7yCz7yCz7yCͩ=Ia7yC#%@7yC#%@7yD8Ԡ c)!7yC$Vp7yC$Vp7yD91g8UVAa7yC'C7yC'C7yD8Ԡ g7!7yC)h07yC)h07yD91g8<a7yC,I7yC,I7yD8Ԡ 6=!7yC-7yC-7yD91g8fja7yC07yC07yD8Ԡ ]Y!7yC27yC27yD91g8nWSa7yC5r7yC5r7yD8Ԡ a!7yC6З7yC6З7yD91g8a7yC9t7yC9t7yD8Ԡ 58!7yC;,7yC;,7yD91g8_ra7yD?x7yD?x7yD8Ԡ S=!7yD(7yD(7yD91g8uHCa7yD 7yD 7yD8Ԡ S0$W!7yDP7yDP7yD91g8"*a7yD ~l7yD ~l7yD8Ԡ ڗm!7yD 7yD 7yD91g8fa7yDo7yDo7yD8Ԡ aH+6!7yDt&7yDt&7yD91g8rMa7yDo7yDo7yD8Ԡ !7yD87yD87yD91g8a7yD3p7yD3p7yD8Ԡ S !7yDd7yDd7yD91g8OBa7yD107yD107yD8Ԡ 4֣!7yD )V`7yD )V`7yD91g8ia7yD#$3X7yD#$3X7yD8Ԡ ާ!7yD$ 7yD$ 7yD91g8Qa7yD'7yD'7yD91g8 k-P!7yD)7yD)7yD91g8'9a7yD,`7yD,`7yD91g8 N!7yD-ޅ7yD-ޅ7yD91g8^u5a7yEp7yEp7yF^h xW!7yE]87yE]87yF^h HUa7yE :07yE :07yF^h !U!7yE _`7yE _`7yF^h!6ja7yEw7yEw7yF^h "|!7yE 7yE 7yF^h"ja7yE7yE7yF^h #3W!7yEm7yEm7yF^h#3Va7yEhe7yEhe7yF^h $ނ!7yE2!7yE2!7yF^h$?B@a7yE,7yE,7yF^h %'˒ !7yE^#7yE^#7yF^h%M"ha7yE!Y7yE!Y7yF^h &8!7yE#"p7yE#"p7yF^h&A׼a7yE&h7yE&h7yF^h '˼!7yE'M07yE'M07yF^h'3T a7yE**(7yE**(7yF^h (^!7yE,OX7yE,OX7yF^h($"a7yE/7yE/7yF^h ) IZ!7yE07yE07yF^h),ha7yE4kW7yE4kW7yF^h *M!7yE5|7yE5|7yF^h*a7yE9/P7yE9/P7yF^h +R!7yE:a7yE:a7yF+}- a7yF$x7yF$x7yF^h ,U*!7yF@7yF@7yF,Ta7yF 7yF 7yF^h -&5!7yFP7yFP7yF- Upa7yF H7yF H7yF^h .t!7yF {w7yF {w7yF. a7yFvT7yFvT7yF^h /՘/!7yF@ 7yF@ 7yF/a7yF$P7yF$P7yHV 0XH+!7yF&7yF&7yHV0~#%a7yF)7yF)7yHV 1%Q!7yF*@7yF*@7yHV1|a7yF-ی87yF-ی87yHV 2䕴 !7yF/G7yF/G7yHV2Ԧa7yF2$7yF2$7yHV 3k*T!7yF4iܨ7yF4iܨ7yHV3a7yF7d7yF7d7yHV 4]D !7yF87yF87yHV4ra7yG`7yG`7yHV 5!7yG7yG7yHV50< a7yG7yG7yHV 6{!7yG>P7yG>P7yHV6a2a7yG 07yG 07yHV 7xk!7yG H7yG H7yHV7}Fa7yGC7yGC7yHV 8>"!7yGt 7yGt 7yHV8&Ta7yGH7yGH7yHV 9^5Y!7yG9m7yG9m7yHV9)a7yGep7yGep7yHV :!7yG/'7yG/'7yHV:x`a7yG›H7yG›H7yHV ;C­!7yG $7yG $7yHV;9a7yG#U87yG#U87yHV <4Ѹ!7yG&7yG&7yHV<a7yG)(7yG)(7yHV =j!7yG,Y7yG,Y7yHV= a7yG/7yG/7yHV >Z\{!7yG2`7yG2`7yHV> a7yG57yG57yHV ?k!7yG7P7yG7P7yH?$!7yHc 7yHc 7yH-iYC̨!7yH#G7yH#G7yH$i!7yH-ؖh7yH-ؖh7yH/ iР!7yH87yH87yH90i&l!7yI7yI7yIiD!7yI-7yI-7yIxiS?a!7yI|`7yI|`7yIiM!7yI'H7yI'H7yI(y(i:!7yI1j7yI1j7yI34Bi}S!7yJ"@7yJ"@7yJ^i r!7yJ`P7yJ`P7yJ`P;$!7yJ*7yJ*7yJ*;!7yJx7yJx7yJx;Vw!7yJV@7yJV@7yJV@;!7yJ3Z7yJ3Z7yJ5PHh!7yJ:=7yJ:=7yKr!7yK7yK7yKH7'b!7yK t 7yK t 7yK 1'D!7yK]7yK]7yK3@CϾ!7yK%|!`7yK%|!`7yK&F@eg L  H" T  P@"@  ` 'PTP @Z#L  L 膔  L 0T  P@"@  TP@Z   P0Ɛ'P0#\ 4 L`@` #` <$ T#\#`8#d ,@H@` -  L 4 \ , 8@#\#`#d4bH4  $ T L   ,  L  D T ,@<#\#`8@H#d`    L  H " L\  D T<  $ @  "@   48  ?", >cT  2H /* '>H`8` 2`H 0 """2 ) <"'<" '88< L  `T`D"  L 8 T D'8@^P ,0 @L8'쨊 5'``  "   ' @Y䖒    H$T#\#`#d  H@H؀` O  L ހ H"*   @"@   ' @X䖒  M L   @"@  @YI   0'E {  @"@   ' @X䖒 { >2aP   @"@   ' @X䖒 a  /7  @"@   ' @X䖒 I >2aP   @"@   ' @Xl䖒 / '  @"@   ' @XU䖒  >2aP   @"@   ' @X;䖒  '  @"@   ' @X$䖒  >2aP    @"@   ' @X 䖒 Ͱ    @ ?  @"@   ' @W䖒    &  @"@   ' @WҘ䖒  ' >L   '*`" *  * '  @"@   ' @W䖒 q   &  @"@   ' @W䖒 W ' >L   'đ*`" *  * '  @"@   ' @Wp䖒 3  b  @"@   ' @WX䖒  'I'  @"@   ' @W?䖒  0g?# @@" /7>K"@ 2' 2'  :? "'' "'*`" *  * ''Ȑ#\ ̖L`@]%#` (L  $T#\#`#d #\#`#d @Eߚ؀` ( L  H#\ \ 8#\#`#d @̒8_   l@ p@ # *EcL $T   xĚ؄#\#`@E#d` ِ eL i Hg^#\??2`@Ȁ '   < 0`@    Ș@= _K_, E ̀ $TL    D xĚ؄#\#`@E5#d` ~  L  H  #\8@ZN   $ @  "@`C 6  ?" C.А >cT|  2H /* '>H`8` 2`H 0 """2  "'" 'АԖD' D@[# , 0 @Lp8' 5'``  "  ` ' @U 2g @  H$T#\#`#d  H@D`   L # H"   @"@  ` ' @U~ 22   L   @"@  @Uݔ   '  @"@  `' @UO  0@ 4 ? $ H $T#\#`#d @D.` w " 'L  H '' 'ؐ#\#`#dL`@X#h` ` ]ٖD ,L  $T#\#`#d  `  X#\#`#d @C` ) iL j Hhb \ 8#\#`#dCӒ @  @ `d%`h%   `$€  ]Cb  $TL  ` `  `" D X2 X#\#`@C#d` ʐ  L  H  @Y `P  $ @  "@` 6  ?" . >cTɔ  2H /* '>H`8` 2`H 0 """2   "'" ' ` ' ` #  L#@  $ @  "@` 6   ?" . >cT{  2H /* '>H`8` 2`H 0 """2   "'" ' @ '  # <` @Xؘ@XҘ0M  $ @  "@`C 6  ?" C. >cT  2H /* '>H`8` 2`H 0 """2  R "'" 'D' D@Y!# 8'L'P' ,0@L'8''' A'``  "   ' @SKܖ [  * HL  $T̒P #\̒ HP#\#`#d@B&  o  L  H"   @"@   ' @S ܖ  ܐ m L    @"@  @Sh   70' '>H 83>- >cTY  4 H /* '  6 H 0 $$  $ 4    H /* 'cP     cP$ >O @" > !2`  *  ?&  &cPH 0  "  $ ($ $ $  4   2(  l d$ & $($"$ $ `% '%  '%%  =%% %%#\ L`@X}#` 8 L $T̒P#\#`#d ̒P#\#`#d @A,  u L  H  @W. @ `  L \  L8#\#`#d],ĒHLZΔ@Ā " $T ; $TL  `  \P#\#`@@#d   "L  H` H@VҘȀ 2Y ` $  $"@ @Uє"  $ @  "@` 6  ?" .Ȑ >cT  2H /* '>H`8` 2`H 0 """2  E "'" '̒ 'Ȑ " ""nfsrv_read iov㾀'H'L'P  ,' 0 @' L 8'4'0 6'``  "  ` '040 @Q=,  ,@  H' TP H#\#`#dH  @@# `  l  4 L # H"N 4  0@"@  ` '040 @Q, i ,j  L 4  0@"@  40@Qe   0O'0 4  0@"@  ` '040 @P՘, 7 ,@`   @ 4  0@"@  ` '040 @P,  ,@ 4  0@"@  `'040 @P,   0,@ L  ' < @  H4  H' TP H#\#`#dH  @?o `    L o Hm#\  LH`@V#` 2 L ' TP#\#`#dH   P#\#`#dH   @?3`  |  L 4 H2 ,  @       $ L  \ HL 8 #\ #`#dL!@7K   L @@7B LXǒ8 '  P> L ' T  TP P:` E 8TT " ' T L    ? d PH  P#\#`@>#d`P  P ' L  H"Ӱ Q  $ @  "@`c 6  ?" c. >cT  2H /* '>H`8` 2`H 0 """2  , "'" '`d' >2!P`d" $@`'L`T  $ @  "@`G 6  ?" G. >cT  2H /* '>H`8` 2`H 0 """2 ݒ "'" '`H''` `D H"`  ? @{>H 8;>-      $ @  "@  ?$  $  [ >cTL  4 H /* '  6 H 0 $$  $ 4   H /* 'cP    cP$ >O @" > !2`  *  ?&  'cPH 0  " $ $ ($ $ $  4 $ &4 -    @+ 2 >H#8     $ @  "@  ?$   $    ##    $    8   WOI   LW8 :' " r< ' T L    XH  P#\#`@=#d`  Q  L  H8@S -  <@S8%@ 4 ?@ @%@ @Q"$@@`>2!P>."$@`$@('L ' ,  0' @  L 8''Ѐ` '& `5'``  "   'АԒД @M̖    H% T#\#`#d  H@<` ΐ   L ˀ H"^   В@"@   'АԒД @Mi̖ T ̐̔  L `  В@"@  Ԓ@Mǔ   0:'Ѐ`#  В@"@   'АԒД @M8̖ #     @ '  В@"@  'АԒД @M̖  \0̄   @ 0 @ ,Ѐ   #@ " " @   " " " `" ""@"   2ۀ   L  % T#\#`#d #\#`#d  i#\  L`@R#` ` L  % T#\#`#d #\#`#d ܖ8LUf' @ `      L  \ L 8#\#`#d L@3  2;! L % T `  x#\#`#d@;M`   L  H#\8@P 1 - %%` ""@ "``2   % %%%=UK>JH "HLTؔ: " % T L `  `  `" L `2 #\#`@:#d` $ ` L " H `g#\8@P( 2   $ @  "@` 6  ?" . >cT!  2H /* '>H`8` 2`H 0 """2 V "'" ' ' "    >@!P !P N   $ @  "@`C 6  ?" C. >cTǔ  2H /* '>H`8` 2`H 0 """2  "'" 'D' D@P# nfsrv_write: nd_mrep not freeh'D'L'P &D '% , 0 @ L'' & (& 4 & H>>L883`+ +`@ b 2`* *` b2*@*@ D 4`, @'؞,`'ة: EB L B>``  " ' @J  , H L  & TP #\ HP#\#`#d@9 `P P' L H  @"@   ' @J{ S  hߔ  L   @"@  @Jڔ  0:'#  @"@   ' @JK #    @ >  & H  @"@   ' @J*  o0; >    & P8@ B @ $>     " " # @  # "  # @ @#@"@#   ‣  @.2  & T#\#`#d  #\#`#d  @8˚ #\8@N%& ,  >& 4H /* !  H  @8  @8"  H &   "`$$   &  H "`$' H H& $ , k  t *   h h@     h0  h@|     @4 h  @ h"4 &  "`$&  / @*h @#h h@I  L L `` `@   @; P 2߰@aڰ &  "`%& H 0+>L``;3`+ +`@ b 2`* *` b2*@* @ 0(@```(: DH /* ! H    2 4   4 2߰" $ $$$ $ "@ `"  "`  "@H 0 ' h  L , ` 8& ,#\ L`@N#` 2'8LQ~ @     2 H L  \ L 8#\#`#d L@/Κ  H    &&& >  "@`7& @   2` 2 &+` ڔ &` " "@ "`` 2 2Q>JH`"HO  LQ '6>#P>H 8& T x #\#`@7#dǐ#\8@Lr& T  " L `2 #\#`@6#d]#\8@LR "$  @ "  3`   ?" + `N  2H /* '  5 H 0 """2  "'" '`  "`  P'  H >@!P !P L  "$  @ " C 3  ?" C+ `  2H /* '  5 H 0 """2 1 "'" 'D' D@M#  ,`& 4>O XH /* !   > H &  H "`$' H H& $ (   `" $ $"`$ $ "@H 0 H /* !   < H $  H "`$' H H$ $H 0+>L 2H 0H /* ! H   4 "  ` $"`$ $ " 4P%D% 2 4H 0 nfsrv_coalesce: bad off㿘``"``"```"@` `"`$`$"`$`$` "@` @4  ` @ ` @`>SH!$ ,n`, ,@ 2@`,"@`> `,`H` &`,`2 ( H 2 (& H ( &`  (` "`$& ( (&`$㽨  ''`,`0'$`8``@P`L'D''@`L 5 `  "   '@D@ @FT< 2 < , H%`T#\#`(#d  H @5;0    D`L T H"u D  @@"@   '@D@ @F< 2c <Ԃ `L D  @@"@  D@@F~  "DJ '@D  @@"@   '@D@ @E< 24 < 4 ? $ H ,%`T#\#`(#d  @4Қ0   " '`L 뀦 H  ' ' '@#\$#`#d`LD`@I5#h$` 8N|'4 '$ :`L  %`T#\,#`(#d    x#\,#`(#d  @40  ɐ (`L  H(#\8@IϚ,$  402%D  @@"@   '@D@ @ER< 2 < "     'T ' Dk D  @@"@   '@D@ @E)< 2m <>2aP D  @@"@   '@D@ @E< 2S < /7D  @@"@   '@D@ @D< 2; <>2aP D  @@"@   '@D@ @Dݘ< 2! <'D  @@"@   '@D@ @DƘ< 2  <>2aP D  @@"@   '@D@ @D< 2 <'D  @@"@   '@D@ @D< 2ٰ <>2aP  D  @@"@   '@D@ @D{< 2 <   @ ?D  @@"@   '@D@ @D]< 2 <  &D  @@"@   '@D@ @DC< 2 <' >L   '*`" *  * 'D  @@"@   '@D@ @D< 2c <  G D  @@"@   '@D@ @D< 2H <','>L   'đ*`" *  *  'D  @@"@  ` '@D@ @Cޘ< 2" < HA   7 >'  @@"@  '@D@ @C< < $>#82` `< ' ' /` 7``  `    :?  ``02`L `\ `8 #\0#`ۇ#dK 4~ `- 0&H͔ LKٰ ``  ' . "*'2aR N1%`T  0,#\#`(@2*#d  s k`L D Hec '`L `\  `80#\#`#dKo "!'2"%`T  ,#\#`(@1#d  < " '`L  H- '''?c ,>'   %`T  0,#\#`(@1#d    `L ဦ H" ̒ @@y11j M%`T   0,#\#`(@1#d   [`L  HV ԰ 1 MԒ1> F1 11,M??,   @) `L `\ `8 #\0#`\#d/ ?K1  0 @ @`d&`h& `$€ J0ݐ`  ؐH@$  2 ؔ$J'1+$ %`T`L     " D T2 x 0,#\#`(@0#d  4 `L  Hh \(,  $ @  "@`# 6(  ?" #. >cT:  2H /* '>H`8` 2`H 0 """2 o ,"'," '(( ,$'( >2aP$#   ,@F((#\8@Eܚ, ,  $ @  "@` 6(  ?" . >cT֔  2H /* '>H`8` 2`H 0 """2   ,"'," '(( ,@ '(   ϗ# ,  $ @  "@`C (6  ?" C.( >cT  2H /* '>H`8` 2`H 0 """2  ,"'," '((,D'( D@F# # "/ / L@/ /}  /w㽸  ,',08P@'L'L 5'H``  "   'HLH @@D 2n D 4 H$T#\#`0#d  H(@/8` ʐ  LL  H" L  H@"@   'HLH @@eD 29 DȔ L L  H@"@  LH@@Ĕ  "L  'HL  H@"@   'HLH @@6D 2  D 4 ? $ H 4$T#\#`0#d (@/8` a " 'L  H; ' ' 'H#\,#`#dLL`@Cz#h,` 8HÖ 5LL  $T#\4#`0#d #\4#`0#d x(@.Ϛ8`  0L Ҁ HА0#\8@D4,  .՞  H@"@   'H @?D { D> `*` ?    .  #,KL  H@"@   'HLH @?zD N D>2aP L  H@"@   'HLH @?`D 4 D /7L  H@"@   'HLH @?HD  D>2aP L  H@"@   'HLH @?.D  D'L  H@"@   'HLH @?D  D>2aP L  H@"@   'HLH @>D Ѱ D'L  H@"@   'HLH @>D  D>2aP  L  H@"@   'HLH @>̘D  D   @ ?L  H@"@   'HLH @>D  D  &L  H@"@   'HLH @>D h D' >L   '*`" *  * 'L  H@"@   'HLH @>pD D D  '?L  H@"@   'HLH @>UD ) D' >L   'đ*`" *  * 'Ȑ? L  H@"@  'HLH @>.D  s4,D*  '  -9* Ib,̰ s '-*L \ 8(#\8#` #dF8 Y S a "L- I-,?L \ 8(#\8#`#dF, "',"'?# @'''’ @@ ,,] H 2ؐ@q @ `d%@`h%`  `$€` F\,>ؔ,FT,, $TL   (84#\#`0@,e#d`   L h Hf \04  $ @  "@`# 60  ?" #. >cT  2H /* '>H`8` 2`H 0 """2  4"'4" '00 4$'0 >2aP$#  q 4@B00#\8@AX4# ", , H1@+ +  + , 0@L8' 4'``  "  ' @< 2e   H$T#\#`#d  H@+    L  H"   @"@  ' @< 21   L   @"@  @<ߔ   '  @"@ ' @0#hD`` Cw) 'D A L  % T#\L#`H#d  `  #\L#`H#d <@)|P` Ő H L Ā H #\L8@>ʚ#\H40@>šD ԰ )y@ 6d  `@"@  '`d` @:H\ c \  H% T#\L#`H#d  H<@)/P` x  d L v H" d  `@"@  '`d` @:\ / \ w  L d  `@"@  d`@:s   0'`d  `@"@ '`d` @9\  ,3D\$%#) H' ' ,'`#\@#`#dh Ld`@=F#h@`` HB'4(Ґ '@  D((ȐDx  |`@   @ `  `@   @ 2`@` 25 4 2`@ D ``@ 2``D ``@` B @@` B @ Ā  @k "? 8| L  \ < 8P#\#`X#d L "  8#\#`K#d  L "  8#\#`;#d|xCDn(: 'Ґ "'͐D](,(*?" (%p D AҖ'8(D@ AȖ'0(@( ~ % T L ` `  <PL#\#`H@'#d`  ` L  H`H#\L8@=#\H40@=' D "@'@ "' 'p~ Ԁ '~ Cܒ''h  ,'0@PL8' '  4'``  "  '  @8f 2ʰ   H$T#\#`#d  H@'M    L Ԁ H"Ӱ    @"@  '  @82 2  ƕ L    @"@   @8  "L} 'L 5   @"@  '  @8 2e   H$T#\#`#d  H@& 1   L o H"n    @"@  '  @7͘ 21  0 L    @"@   @8,    '   @"@ '  @7  0( 4 ? $ H $T#\#`#d @&~ ǐ  L  H #\ L܄`@=#` 1L  $T#\#`#d   X`x#\#`#d @&A  L ɀ Hǐ @ 2 ' n' 'Ԑ 'ؐ#\#`#dL ܄`@:#h䀢` P?&& '䀦 G    @2  %L \ 8#\#`#dL " 8#\#`#dA B@% %  %?䀢 ?%%쀦 $TL     X2 x#\#`@%#d ֐ L  H@;#\P@:Ӛ 㽈  ','0'8@(L'$'' L 5 `  "   ' $  @6I 2O    H$T#\#`#d  H@%0` y  $L @ H"g $   @"@   ' $  @6 2 w L $   @"@  $ @6s  $ ' $   @"@   ' $  @5 2  4 ? $ H  $T#\#`#d @$ǚ`  " 'L ׀ H ' ' ' #\#`#dL$`@9*#h`  8>q'$ '  `"R I$   @"@   ' $  @5  >2aP $   @"@   ' $  @5e k  /7$   @"@   ' $  @5M S >2aP $   @"@   ' $  @53 9 '$   @"@   ' $  @5 " >2aP $   @"@   ' $  @5  '$   @"@   ' $  @4  >2aP  $   @"@   ' $  @4ј װ    @ ?$   @"@   ' $  @4    &$   @"@   ' $  @4  ' >L   '*`" *  * '$   @"@   ' $  @4u {   &$   @"@   ' $  @4[ a ' >L   'đ*`" *  * '$   @"@   ' $  @47 = $ wF H x 'h'l'  ?xh'p 't''  '$p@2{  2-@$   @"@  ` ' $  @3  A`7-@ "L# y ?2@" " " O` \ 8#\#`#d>  "2`*'''?c  '  Đ@ @ `d%`h% `$€ cTw  2H /* '>H`8` 2`H 0 """2 ݒ  "' " '  $' >2aP$#  c  @8#\8@7J )  !x  "!>"@! !  `!`xҒ 㽸  ,0',@LP8'L'H 5 ``  "   'HLH @2D 2L D 4 H$T#\#`0#d  H(@!8` ̐  LL  H"ɰ L  H@"@   'HLH @2gD 2 Dʔ L L  H@"@  LH@2Ɣ  "L 'HL  H@"@   'HLH @28D 2 D 4 ? $ H 4$T#\#`0#d (@!8` c " 'L H H` ' ' 'H#\,#`#dLL`@5~#h,`  8:Ŗ!  ', 9L  $T#\4#`0#d    x#\4#`0#d (@ ɚ8`  0L  H0#\8@64,   Ϟo LL  H@"@   'HLH @1D L D>2aP L  H@"@   'HLH @1D 2 D /7L  H@"@   'HLH @1jD  D>2aP L  H@"@   'HLH @1PD  D'L  H@"@   'HLH @19D  D>2aP L  H@"@   'HLH @1D ϰ D'L  H@"@   'HLH @1D  D>2aP  L  H@"@   'HLH @0D  D   @ ?L  H@"@   'HLH @0ИD  D  &L  H@"@   'HLH @0D f D' >L   '*`" *  * 'L  H@"@   'HLH @0D B D  DL  H@"@   'HLH @0wD ' D')'>L   'đ*`" *  * '  H@"@  'HLH @0RD  뗐,D /7  ';W0R3 L \ 8(#\8#`2#d: ,@ @ `d%@`h%`  `$€` 8ٖ, ؔ8ϖ, $TL       2 X 2 x(84#\#`0@#d`   L  H h \04  $ @  "@`# 60  ?" #. >cTt$  2H /* '>H`8` 2`H 0 """2 Y 4"'4" '00 4$'0 >2aP$#  ߒ 4@400#\8@3ƚ4 4  $ @  "@` 06   ?" .0 >cTs  2H /* '>H`8` 2`H 0 """2  4"'4" '00 4@ '0  # 4  $ @  "@`C 06  ?" C.0 >cTst  2H /* '>H`8` 2`H 0 """2 詒 4"'4" '004D'0 D@4x#  ":@ِ q    `,`0'`@``L`8'' 4 ``  "  ' @. 2e   H$`T#\#`#d  H@u  龐  `L G H"F   @"@  ' @.Z 21   `L   @"@  @.   '  @"@ ' @.,  p0 4 ? $ H $`T#\#`#d @   T " '`L ݀ Hܰ ' 'Ԑ 'ؐ#\#`#d`L`@1o#h` 6 ' 9`L  $`T#\#`#d    x#\#`#d @   `L  H#\8@2    @   2  2  %`L `\ `8#\#`Ő#d`L " `8#\#`Ń#d88@ 0  86/u $`T`L    x#\#`@;#d  脐 `L  H  #\8@1 p'L'P ,  0' @  LX 8','( A ``  "   '(,( @-$  $ * H L  & TP #\ HP#\#`#d@ߐ `( ` , L l`H" ,  (@"@   '(,( @,Ø$ Q $&  L  ,  (@"@  ,(@-!   07'(  ,  (@"@   '(,( @,$   $   @   (@"@  '(,( @,t$  繐$:    L'` > < # ##4#\   L`@2r#`   L & TP#\#`#d P#\#`#d  L   \ L 8#\#`(#d  L4`   @L@Q    L  & T r   XPh#\L7  p\ ''40'8 'cTo  2H /* '>H`8` 2`H 0 """2 ʒ "'" ' " '  ##K  $ @  "@` 6  ?" . >cToD  2H /* '>H`8` 2`H 0 """2 y "'" ' ' " >."#>2aP#p p B '' $ "  `'?' 4  '쀥`& T L   P#\   X  @@P#\#`@9#d`傐`  L ǀ`Hŀ V@/9  $ @  "@` 6  ?" . >cTn  2H /* '>H`8` 2`H 0 """2 㺒 "'" ' " '  ##  $ @  "@  p'  ?&f>H 81>- ` "Q  L ` `'"@ '耠@؀ n  &@&  >cP`n   6H /* ' 4H 0 &&&6 A H /* '#P   ђ #P&>O @" > !2`  *  ?$ &#PH 0 " &(&$&  6 2(  l d& % >2!P &s n  &@&  >cP`m  6H /* ' 4H 0 &&&6 ̒ H /* '#P   \ #P&>O @" > !2`  *  ?$ &#PH 0 " &(&$&  6 2(  l d& % & n  &@&  >cP`m$  6H /* ' 4H 0 &&&6 [ H /* '#P    #P&>O @" > !2`  *  ?$ &#PH 0 " &(&$&  6 2(  l d& % & n  &@&  >cP`l  6H /* ' 4H 0 &&&6  H /* '#P   y #P&>O @" > !2`  *  ?$ &#PH 0 " &(&$&  6 2(  l d& % &` n  &@&  >cP`l>  6H /* ' 4H 0 &&&6 u H /* '#P    #P&>O @" > !2`  *  ?$ &#PH 0 " &(&$&  6 2(  l d& % $ɔ$@` .  n  &@&  >cP`k  6H /* ' 4H 0 &&&6  H /* '#P   ~ #P&>O @" > !2`  *  ?$ &#PH 0 " &(&$&  6 2(  l d& %  t& n  &@&  >cP`kC  6H /* ' 4H 0 &&&6 z H /* '#P     #P&>O @" > !2`  *  ?$ &#PH 0 " &(&$&  6 2(  l d& % @# '? 'w  r  &@&  >cTj”  6H /* '>H`8` 2`H 0 &&&6  H /* '!>-#P   ߆ #P&>O @" > !2`  * >H`8` ?"` $#PH 0 " &(&$&  6 2(  l d& % >."& q  &@&  >cTjK  6H /* '>H`8` 2`H 0 &&&6 ߀ H /* '!>-#P    #P&>O @" > !2`  * >H`8` ?"` $#PH 0 " &(&$&  6 2(  l d& %  >2!P>."&  &&  &@& kf kc p'L ' ' ,' 0 @' L0 8'D 5'@``  "   '@D@ @%*< e <  H' T#\,#`(#d  H@0` Z  D L ! H" D  @@"@   '@D@ @$< 0 <X  L D  @@"@  D@@%T   0'@D  @@"@  '@D@ @$ǘ<   0a<   L @  ! >' < % %%4 #\ $ L`@*#` ' L  ' T#\,#`(#d #\,#`(#d 0$L-OH  L $ \ L 8#\0#`v#d$L @ @  "$$N LL/  h˔ '' '?'$'(',''' ' jP '$L, `$/5$L,H$L/̒   "  " 4 5$ "j# j   L' T  X 0,#\#`(#d@` A  L  HH,@(( }{$' T h 0,#\#`(@#d`H,@(ؘ(,  $ @  "@` ,6(  ?" ., >cTh$  2H /* '>H`8` 2`H 0 """2 Y ,"'," '(,( " '(  ##>."#>2!P#i i}   '' $ "   '?' 4  h''耦  ' T L   00,#\#`(@#d` g  L / H-H,@( (,  $ @  "@` ,6(  ?" ., >cTgl  2H /* '>H`8` 2`H 0 """2 ܡ ,"'," '(,( " '(  #,(#  $ @  "@   ?&>>H 8->- 8`")  $$      " 2@b   d!h!  `$€    +LL , ( ` `t '`'@4'쀠@'@(| '>2!P'p''x@ o't, ( $@&  >#P f  6H /* '  5 H 0 &&&6  H /* 'P   y P&>O @" > !2`  *  ?% %PH 0 " &(&$&  6 2(  l d& %@ >2!P$  n, ( $@&  >cP`f?  6H /* '  5 H 0 &&&6 v H /* 'P    P&>O @" > !2`  *  ?% %PH 0 " &(&$&  6 2(  l d& %@ $  n, ( $@&  >#P eΔ  6H /* '  5 H 0 &&&6  H /* 'P   ڕ P&>O @" > !2`  *  ?% %PH 0 " &(&$&  6 2(  l d& %@ $  n, ( $@&  >cP`e\  6H /* '  5 H 0 &&&6 ړ H /* 'P   # P&>O @" > !2`  *  ?% %PH 0 " &(&$&  6 2(  l d& %@ $  n, ( $@&  >#P d  6H /* '  5 H 0 &&&6  H /* 'P   ٯ P&>O @" > !2`  *  ?% %PH 0 " &(&$&  6 2(  l d& %@ $@s$  ,   p n, ( $@&  >cP`d_  6H /* '  5 H 0 &&&6 ٖ H /* 'P   & P&>O @" > !2`  *  ?% %PH 0 " &(&$&  6 2(  l d& %@ $@$ '? '$ r, ( $@&  >cTcҔ  6H /* '>H`8` 2`H 0 &&&6  H /* '!>-#P   ؖ #P&>O @" > !2`  * >H`8` ?"` $#PH 0 " &(&$&  6 2(  l d& %@ >."$  q, ( $@&  >cTc[  6H /* '>H`8` 2`H 0 &&&6 ؐ H /* '!>-#P    #P&>O @" > !2`  * >H`8` ?"` $#PH 0 " &(&$&  6 2(  l d& %@  >2!P>."$,   $& ( $@& dv ds `  , 0  @  L 8' 5'``  "   ' @@얒 d   H$ T#\#`#d  H@ '` p   L  H"   @"@   ' @ 얒 /  n  L   @"@  @j   0'  @"@   ' @ޘ얒  #0Ր#\ Ԗ L`@##` 1 L  $ T#\#`#d #\#`#d @ `   L  H#\8@! &k 'T8&_ AԀ  $ T L  #\#`#d #\#`#d @ j` س  L _ H]#\8@!܀ 2S   $ @  "@` 6  ?" .ܐ >cTa  2H /* '>H`8` 2`H 0 """2  "'" '`  "` >@!P'"!P "  ,  0  @  LX 8'T 5'P``  "  ` 'PTP @L O L@  H$ T#\<#`8#d  H@ ˚@   T L n H"P T  P@"@  ` 'PTP @L  L   L 0T  P@"@  TP@    ܐ0 'P0#\ 4 L`@"#` .4 L  $ T#\<#`8#d #\<#`8#d @ e@ ׮  L  H<@!g8  X 4% 4  $ T L  #\<#`8#d   X 4 #\<#`8#d @ @ g  L € H<@!8 2   4<  $ @  "@ 4  5<  ?".< >cT`c "  2H /* '>H`8` 2`H 0 """2՘ <"'<" '8<8`  4 "` 8 48 7'8` : `:   @ &@&``: `:   @ι &`&` `: `:   @Ϋ &`&`&``&`&` `&`$&`(`&`, &`0&@`&`` &``&` `&` ,  0  @  LX 8'T 5'P``  "  ` 'PTP @SL O L@  H& T#\<#`8#d  H@ :@` փ  T L o H" T  P@"@  ` 'PTP @L  L   L 0T  P@"@  TP@|   K'P0#\ 4 L`@!#` . L  & T#\<#`8#d #\<#`8#d @ Ӛ@`   L  H<@՘8 4# u4& T#\<#`8#d  @ @`<@8<  $ @  "@`/ <6`   ?" /.< >cT_  2H /* '>H`8` 2`H 0 """2 5 <"'<" '8<`  8 0"` `0R '8 """"" """?"" "$ "( ",㾰 ,  0  @  LX 8'T 5'P``  "  ` 'PTP @"L O L@  H$ T#\<#`8#d  H@ @` R  T L n H" T  P@"@  ` 'PTP @L  L P  L 0T  P@"@  TP@K   0'P0#\ 4 L`@#` .4 L  $ T#\<#`8#d #\<#`8#d @@`   L  H<@8  %, 4 %y(  4 %r$ 4 %k 4"J,4  $ T L  #\<#`8#d #\<#`8#d p@U@` Ԟ  L  H<@W8 2Y <  $ @  "@` 86<  ?" .8 >cT]  2H /* '>H`8` 2`H 0 """2 Ւ <"'<" '88<` '8, " ("@ "`$"`"` >.">2!P"`"`x!& T ,#\#`#d @֚` x T L  ,& T#\#`#d @` 8`2 @  < "  @    2&   @ߐ  !F`  !Z @" nfsconnfscon sotype㿘TX`$P  ٞP P` R $\  2 >cx\Ք  2H /* '>H`8`0 2`0H 0 """2    "    0#@ o >cp\ "  4 H /* '>H`8`, 2`,H 0 $$  $ 4 ڒ  $  * *"ن2H : >cx\p  2H /* '>H`8`0 2`0H 0 """2 ѥ  "   #@   "`\ B 90] H /* !`  >>Xtw*` `$ 2 ``" ``<@ X ` `$ `"`$  4`$H 00ȑH 0 A>!X*` 4`Z4`~4`Z4`~T  @ ! a !@ *  at* "` >" 1 >cx[ʔ  4 H /* '>H`8`0 2`0H 0 $$  $ 4   ?c  #@ #" ` R  22 >cx[  4 H /* '>H`8`0 2`0H 0 $$  $ 4  ʒ    # " !* a*`ⶒ %>2`X!`|@4`X@>!X@T4`|* $|$x$t$p$l$$$$$|$$$  ?4`H 0@/㿘%>K #>@'B  ?  bss >/#` `2@`$ @"`$@`2` 㿘 P & P% ؁nfs send error %d for server %s nfsd send error %d 㿘$`"ѹ C  P  `@&$ѯ 9 &$`\ R    "R   @? S `   >b$  @ &$>b ? # 2 short receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthEgad!! receive error %d from nfs server %s `>#p&"@  T" P@ϒ 0  $`" @ $  P``@%>J# 沔 – ``&` ``X " $  ? " @ 0 @ @ o}x'В 'Ԑ''''  ?'' @'Ȑ ؖ  ݚȰ #   # $  #"'Ȁ 耢  >`  "     P ꀦ s  *@ ! '̐ >`P> p # ' @'Ȑ ؖ ڢȰ #"'Ȁ "'Ȁ?"'Ȁ K耢G >̒`    "  = !''''Ȑ ؖ{Ā`Ђ #   # $ I #"'Ȁ   Ā 2'Ȁ  >&  " " '̀ C A?@ Q  &  >`ɖ @Ԓ 7 " 0&`2`*   А"@''''Ȑؖ Ȱ # $ 퀦 #"'" '̀ "&@0 nfsreply nil㿀 >J#->B>B!@ې  @ @  ? #\ P2 $ " '  @"@ ' ' @y䀢 >@a\ !  " $a( %a(a(`%a(>/#`>"` 2@` 2@$` $`>#( X$`* @*`"@`4*`"@`4*  @d  ?*  l` |:`@` :`*  l` |:`@`"" "`4* ?*  l"`4* ?*  |"`d"`h" >L`"$``"(`$ "`8"@"`  ?"@%4`$< @ @[ $$`$ ?$`$?$`$ "$$`4`* `8?* l:`"@ "l `4* `?* |:`"@ "|$`2_` ` @a$`%a$  $2  $   >B! $  is alive againnqnfstryH'D'H'L'X  D` @D W% % <DH% L% 4  '@$(  'Ԥ @9 ` Ԑܖ@## #\#`ܘ@" YX ΎH07W `@ *`*  '@LԖ#\#`H#d#h#l@#p܀` Y4 `T 0 2  ?" 4 ?"   ?$`$  Θ "   $ ? "% % @  e`h% (% ,% 8>L"(`  % $% $% >Jca "aH /* ! %>/c`% `""`>L`P `?`T  @(``@2H 0 `\ @  `P``΅ `\`@   $ @ `!%` $  % $H 0 ?% 8  H /* ! `"  "`>/"# "H 0  $  ?% $`?%` 2   $ >`p <@`    '-'``  " `  'ĐȒĔ @. 2 @>%`@ `@>M#82@ -$>O 2 `2 PАX"@ U ' `@$@#\@"&İ  `` Đ "  ?   @YĖ  0n'  Ē@"@` 'ĐȒĔ @͘ Z @   Ē@"@` 'ĐȒĔ @ B @ @@"' #$ F>L @>'>K7> 㤒 n^ `&>#- @ˮ F2@D@" X @\ @ `b @̺0^!J  Ē@"@` 'ĐȒĔ @\  @2D   @"@`|` 'ĐȒĔ @A ̰ @`@>L `@` @#\iX @\ @` @d W)   ] +Z W build > MLEN㿈>#T \Ux  4H /* '>H`8` 2`H 0 $$$ 4    8H /* '#>-cP   7 cP$ >O @" > !2`  * >H`8` ?"`  $cPH 0  " $ ($ $ $  4  >/c( $  $ I`X &>@!\ & >2>% @&  >O &.&  ?E$ >M#8&  "&`L @} `@U *  L"u&`@2`<    @ 2"Z&l?'p>G#'&  &&       $ @  "@`   3   ?$ 4,  >cTT  2H /* '>H`8` 2`H 0 """2 Ғ $ $    $ ` & && &J KHa a& LY [& & &      $ @  "@`  3   ?$ 4,  >cTT;  2H /* '>H`8` 2`H 0 """2 p $ $    $ `L ` &[&  & V& T&R&"O`L      $ @  "@` 4`  ?$ , >cTS  2H /* '>H`8` 2`H 0 """2  $ $  `  $ @n&&`L  U      $ @  "@`  3   ?$ 4,  >cTS  2H /* '>H`8` 2`H 0 """2 Ē $ $    $ `L & &`\ &@   &``F&      $ @  "@` 4   ?$ , >cTS<  2H /* '>H`8` 2`H 0 """2 q $ $   ` $ &$`"d ">Jca "a not responding㿘H /* !>/# ߮ >J#   $ 2 <@  2W $ 8 : $ 8(2 d> 4b* @  d ?*  l` |:`@` :`*  l` |:`@`  >c?* @@W  8 $ 4 $ $ $  ,@ > <@` $ $ $ , (@& T!  %!  $ r$ $ ` dl$ , di$ ,P"f?$ 8`hd\"" 4   &V(2   $ 2 @6I  沔Ɩ  "@       `@  ",?") #"&\ "!4$  $  ? ,$ $  d$ , d$ ,:  $!$  %  $ $!$$ 8 2( >,+>L`@``s",``>[= ⨩3`+ +`@ b 2`* *` b2*@* @ 0(@(: D``H`"@@8 @`8@@Z@`2`HH 0>>2a"7 `"`$" @ ` Ȅ*@(  nfsndlck㿘 @ ``<*  !$  ͔  >  $iҖ!2>!X * @@2` @ $nfs sndunlock㿘@@*@>~ @&*@&kQnfsrcvlk㿘 *  a    <  `>X $ia>!X * @2   $nfs rcvunlock㿘@*@>~D"@&*@&k 㿘 x `2   "m     ?  6  $ " ?@&  &  &     $ "&? @4;: $2`  ? 4   $   $   $  "  ?$ $@$` %`     Ȁ  $  2$ 0 2 Bad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad P 0  @ ,''``  " '  ( ' (@  2? $ X >7"쀢@ 0 ``  "    ' @ Ș 2" $ T$ L>2al  ݐ I>2!@>S `@Ӑ J   ɐ K` K$ T `2 $ L$ D`  `2 L` L L 2 L`( L L 2 > D!*` $ D   L>WaX ? $ L ``  "  ?   @ ϒ  0'  @"@    ' @ C   @ P 4 $  $  e``  " *     '@  z  @`4 " `@ 4 4 T `$ @Z  1#``  "  ?  '@ b  0D>G#Ȁ   x0&`  ? ' &`4 H  ?'ؐ ''`'А! 'Ԑ@ !    @"@    ' @  2 >GcȀ   ">} h   @"@  ` ' @  ۰   >}   aڔ  &a L @$ L` &`>}l    @"@    ' @ L 2 >GcȀ   ">}F [   @"@    ' @ (  '  @'` *   L 7>L 2  <      @     2  >L h` && h l@4 & h   pĀ@$ & h  @X  L  $ L $ T $ DD ;  D 6  @"@    ' @ Ø   L $ L  @"@   ' @   0  $ \ $ 0$ @nfs server %s: %s 㿘 " |;>bp|S|C h`0 'V @`$ "4`0沢"' '̐ԔؖИ Ρ̠  #Ѐ 2` #`0  `"@`8" &`$@&`8 2&` @O 9 `0 4&`0 1&`0"' '̐ԔؖИ jЀ`  (Ԁ`Д "`( "&`$" &`("     #2`0Ѐ 2'耦 `$ `0 @nfs getstream㿐`0  >z  $`0`< 2I`8`8 $`0`   F    & &   2    *   `& ? & `8?$`8 *@`$`<`0 `0 ?$`0`< !@ H`0`8`<@`$` $`<$`8@$`9 `/ `<  "q $``< "@& `< ""@& `<`0 #`$`<& $``8$`<"$`8`0 ?$`0`, `,@@ 2@"@`0 "c`<`, (`(``,"`$`$`,$`(T$`,㿘& 0 ". 7 $`2`( 7 & $$`& (T`  $ ؒ L $ ,$ 0$ <` $ @ &&a VN nfsd wakeup㿘 0 #>2 " 0> " ? `"y D `& DfZ" 0 2 0> & 0`"㿘>#>0 4_5>$"b>[""Ȑ"" nfsrcnfsrv cache㿀 < 2  Xp ,  >d  X>0`̕2  >$bȑ* @ r>[">J# X @2g   D 2b       8@!  "V   2ѐ  ` ,  "` "@$$ "$   >y!2 a,  *$a,   a4$a4 #\#`#dY    沔a4  $a4 9 &a0  $a0 ,   ,  , e0 2 X>J8#>2a>#`"8  4K @ a $a >[b  " %>  ,  cޖ b     ,  `"  "`   "@`"  "`>["" "   @;   @"M H /* ' >HR 8*`@ `?2`H 0  ` (>H /* '`>O @"@> !2` ?* *   >-  P"@   "P # H 0 > PR *` L'  , $>[b`$ `""` ,  X$  8  ` 2  ,  `  @,  8k $  F4  X2 >0 `>$"Ȑ *   $  X2  *  "`  X`"ȓ2  * " X2  * $  ,  , dÐ 㿘 < i X>0`̕2  >$bȑ* @ \>#>  X @2Q   D 2L       8@   "@      , >b  X ,  `#,  D* @ "  L >!h *   T $   ,  沔ݖ $ `,    ,  , dX0 2 X㿘>["Ȁ">2"` "`  "@`"`$`"@ KՒ 4 2>2"!build > MLEN㿘 >cTJ*  6 H /* '>H`8` 2`H 0 &&  & 6  _ (8& H /* '5>-P    P& >O @" > !2`  * >H`8` ?"`  &PH 0  " & & (& $ &  6 & ` `!D!>L`|   2 >",.`   >",.` `   @   `I      $ @  "@`  3   ?& 4,  >cTI  2H /* '>H`8` 2`H 0 """2  & &     & "@  F"`     $ @  "@`  4   ?& ,  >cTIC  2H /* '>H`8` 2`H 0 """2 x & &      & "@&㿐>  ` #T'pI   4`H /* '>H`8` 2`H 0 $@$``$` 4` |  ( 8 cH /* '!>-#P   ɒ #P$`>O @" > !2`  * >H`8` ?"` `$#PH 0` "$` $`($`$`$`   4` <`" @$`` D$`$` `  ```$ "  2 %@ , >cTH  4 H /* '>H`8` 2`H 0 $$  $ 4   $@$` ` ` )> p ` $` '>t  x% p  $t r %>`p "`p> pa%$>7" $>2!l $ % I$   a"$b   $b $>!h. $ $$ f``  ```$` @  "@   7`  ?$@/ >cTG  4 H /* '>H`8` 2`H 0 $$  $ 4  0  l($@>u!آ$` ` ? ?` @ $` $ $  $  $ $ ` @ $  `>H 8)>-`  ```$` @  @`  ?@2_` >cTG  4 H /* ' 4H 0 $$  $ 4  ϒ (5$@H /* '#P   \ #P$ >O @" > !2`  *  ?$  %#PH 0  " $@$ ($ $ $  4 $@$` ``  ```$` @  "@`  ?$@ 8 @&` v$`   ?"$` @6` ,`@` $` `  ```$` @  "@` 4 `  ?$@ , >cTF  4 H /* '>H`8` 2`H 0 $$  $ 4  * $@$` ` `  $`  $\$ \>H 8)>-`  ```$` @  @`  ?@2_` >cTF  4 H /* ' 4H 0 $$  $ 4   (5$@H /* '#P   n #P$ >O @" > !2`  *  ?$  %#PH 0  " $@$ ($ $ $  4 $@$` ``  ```$` @  "@`  ?$@ 8 .&` v$` \  ?"  @6` ,`@` $` $$ d$@h (%`l%`"㿘   " ?P"` $] @`2`W @@`*0"L H "@` Ӕ$@$@$@`<  B>```"&`@`8@``&@?&`"@@`""`&4`&&6 @&nfsm_uiotombuf: iovcnt != 1㿘  >r m@`? ?">H 83>-       $ @  "@  ?$ n >cTEi  4 H /* '` 5`H 0 $$  $ 4   "5$ H /* 'cP   - cP$ >O @" > !2`  * ` ?%`  &cPH 0  " $ $ ($ $ $  4 $ %     $  @  "@   ?$      $ $ $ $  <` B>  "a& @"@&`"M"`$N       $ @  "@   0   ?$( >cTD  4 H /* '>H`8` 2`H 0 $$  $ 4   $ %   @*@` $ '  ''@ nfs S too big㿘 & &@&@'@_ d\ H( >q >cTDX  4 H /* '>H`8` 2`H 0 $$  $ 4   $ $"$  '@&@"! H    @ ' @$ "$  怤 $ & &@   "   H &" "@㿘       $  @  "@   ?% ? @"@ `  % & % >H 8/>- >cTC  4H /* '` 5`H 0 $$$4  l(5H /* 'P    P$>O @" > !2`  * ` ?%` %PH 0 " $($$$  4 2(  l d$ %  "@`   ?$    ?"@ 8@$ &~&  &@ struct nfsnode bloated (> %dbytes) Try reducing NFS_SMALLFH struct nfsmount bloated (> %dbytes) Try reducing NFS_MUIDHASHSIZ struct nfssvc_sock bloated (> %dbytes) Try reducing NFS_UIDHASHSIZ struct nfsuid bloated (> %dbytes) Try unionizing the nu_nickname and nu_flag fields 㿘>B"!>2 "al>7"">@ "!\>%" @>2"">M"#8>O" >W"!X>G "c>2a""a>S% I"``>2"!P>."">K?"b>!X @ d!>2 $!$!@ ) f> 2>/>@!P>b$ >b>b   ">)c"c" !>O! />.U$ L>/"##"  㿘>"   L"@>.""""  㿈@!D``   Db"  T 쀢 ``@`'`+`D*  '> ``H*` %'>@` * @`>c8< 2 @`4`'`8*`" *  * ''􀦠2@" @'|$@>7#`$@? >7c\p$ h$ h|$h$ |>)c$|$e$&$$(( /6 & D& ,& 0 d`*& ` 6 ` & `& ``   @ > "& ``   > H`8& `<& $`@& (`L& 4`P  & 8,& @` 6 ` & `& ` > `& `  ; 2`* @ *` > H`(& `,& $`0*`" *  * & (& (& @`<& 4& 8`@  & <> P  2 @>L 2   8 2   @( >  <@>L<>L $n `$!"&$&(" &,&0 㿘 |>L  "   D@X#  @`aaaa 2      >Jc`  C"`c( "c  2( @( 2   8 2   @( <  <@< `$!"&`$&`(" &`,&`0 㿈 \ `$@$$ @  @ " $ "} H "K  /o  `@$  @,@ `,@'@ ?"& & 2R   $@ $ $ 0#\h#`@Q 2? `@ < 5 ꤐ $`$ # !$ d$ i 2   @@`  ꬰ  $@d$   A     1"   + ( 0$ , " "    (  #2" 㿘\@`J@      $ @  "@`  4`  ?$ ,  >cT?  2H /* '>H`8` 2`H 0 """2 . $ $   ` >.b $ Z#      $ @  "@`  4   ?$ ,  >cT?  2H /* '>H`8` 2`H 0 """2  $ $    >2P$ #   ## , #0# 4 #8`# $@'@@㿘`J`  ```$` @  "@` 4 `  ?&@ , >cT?J  2H /* '>H`8` 2`H 0 """2  &@ &` ` ` >.b &` M#@`  ```$` @  "@`W 4 X`  ?&@ W, >cT?  2H /* '>H`8` 2`H 0 """2 7 &@ &` ` X`` >2!PX&` @#@&'㿘V`&`& ` & L ->@`* @&` /&` &`&`H &`L& `F&$`G&(&,`&0&4`&8`$&<`(&@`,&D`0&H`4&L`8F&P>@ x*` &@`2>`>c@#x`*`  &`&` &@ 2`D?&`H*2 @ 2 & `&$`&(`$&,`(?"&0@f#&0`,&4`0?"&8@]#&8`4&<`8?"&@@T#&@㿐\>#p`?&  W F `  M`   R h h )0"a1/  d & &R  @66 ` *` `"R @6   $$`       @  nfs getcookie add at 0㿘   @{ , cD , 4`  ` < "1>>j#8G H`4?:! = &` &@" $"&` ?ဦ2@` 4@6$ @! = "`@ "@@" &@"` 4@`  &`.  @H( 2 0` $`0``0"`02H L`R D>(R   P " P  R?# @ >І  * *:* *  㿘@c P 6@ &` &` 6` V  @6 V` `"V @V` ʐ`㿘>L ``"  aD@ܒ  @`!!!!` @@   0 D '' D''@'' ؐ@  `d'`h'  `$€ `ה nfsd init㾘  D R> `T "@ '>[#>⨒ `H T  T$ T T @ !@14` / D''''D' $@ " `!D旐 @"@ @  $@ `@ݐ  `l   `'Ζ  @ܰ`M | @ À   0  @t *  L  @2  <           2  2`@> P@6 `0`$`@ | 3;ה `0  =g 3}@2$ ` `"  "`   "@` "`$`  "  "$  $    PT $  4 $ 4 l$ lp $ p>L`xt x $ h < "$  ` 2   $  ` 沐 $ Ḕ < $ $` $ ` "$` @ *  L  $ @ے *  L "` @Ӓ * " L@͒ *  L@$ Ḑ P``L @"`L@  "` $`@ߔ ? 㿘( R    >'" 0 "T T   !!q "T0 22  >cx;  2H /* '>H`8`0 2`0H 0 """2 D ?c  #@ i"  ` 254ZR` 214Z >cx:֔  2H /* '>H`8`0 2`0H 0 """2      # 1" 4Z4~X | 4X ?4|! 2: @!$``$` $@>[b`$``""`$`$`  $ $`H /*!$>"$ $`0H 0 nfsdmbuf siz=%d Bad nfs svc reply㿐'D'H'  H /* ! ! 4:PD!@ @%%>2``%`""`>`X "`X;>L 2  #>" 2 !>!>  T`% Ru$ T T ?$ T >"  2 >" >[" 0 ` " 202 >b ?"b "0 Y  @D&0 &D%  ?&04@  q"`>L``; 0(@ (@b2`* @ *` b2*@*@D4`, @``,`: @E " H`" @ 8  2 `      % 0   "% ;' 'H 0   W4`u>L``"``` "`d< ""8"`8 % ?D%`8   ` `\`` `d  D`h  DH |    Q>`\ >`@`\>` " `\`>b "` "`\ `L 2`D  "`D!"`T > "``   ?%  "`D "`TR"1 .􀤠 D >"  >`\  [ > Dc0+ @   D >Jca  a  < "0>J Dc*଒  "" ,    !@ > g4>eː!$ .$   2   ?" 4  ?"    ?$ `$    "    "   $   "@̒ 0  `<q  ->#( @3<`NH /* '>HR``8*`@`?2`H 0 <` ,H /* '`>O @"@> !2` ?* *   `< >-P"`<>H `8` "P  ` H 0  <>R P*`9  ,   @ 挐 ? 9 @>H /* !q >#( @  , < 9d '`>L``;3`+ +`@ b 2`* *` b2*@* @ 0(@``(: @EH /* !H   8  2       H 0H /* ! ʔ "?%  @%7`""`>2" "@H 08 4D>`X @? "`X@ 㿘 0  ? & 0&   d" "  `HH /* '>HR` 8*`@ `?2`H 0  ` "( H /* '`>O @"@> !2` ?* *   >-  P"@   "P # H 0  >R P*`8   $  ! ` "`   "@` "`&  "   8l 3`2 H /* ! H  "$$$ $$ "@ 8R  2 & HH 0㿘 D? & D 0 `"  "`>["" "@8- 2㿘> `T " >c H "`T>[" " 0 -` "`&  "@8 2`2 0#>[$bb& > T `"T "TPT>2"  " >! 2" 6O#"!>'$"@!""``"`  b "b" & >'"!>[$""" #> ! 263 $`@!`"``"` "@ "` "`$  >* (    `2 L" L" D" D" 82"">L` ``"*  ( ( d( " `">"a   "anfsidl㿘 ?>! *` "  ``$*`> "  ` "`>." >. ">" ,$@! >`M >.b` "$@>."`U "  ```"`%``"@`0@"`\ h' 8bH o*@ e 0   0  2   0 $ 0 ? 0 \ $ 0 \`4 "`4H 0 l 2`\b`2` >.>! ," >`?"`nfsauth1nfsauth2㿘 @\@$  >>XMn*`<Y E@!  + 5 $&$ Ȑ!$ $ @$  N$ @` `;>5> Ē XaM@*`<+@  `  *@$ P "  6n *@$` ' Д ~$@*@ @$*@$N nfs_getnickauth verf too small㿈`4`>aԐ#В C@*  쀧`>L````2``>L`h` 6@@ ``"`& `@"@'@ '` "&   4z  "`t "& &'>L `l   2 `p`p@ '`l'`p '`p`l'`p '' '' x '@ \z'``  "    ' ８ܖ 2z '>L ' ,m > P@6  `&  | 34 `"  "`  "@`"`& "@&`&>L g&hx&l &p}&t& & "& `@W C*  쀢  &`@N C*  "` `@F C* " `@@ C*  & ``  "  ?   'ﻒ  ''@build > MLENh'D'!D L "  ;''Ѐ` 2 @`Ԑ@`>Jc`  "` DԒ Q`' `|R `  ?   $  @  "@  e`|   ?$\  $ @  "@   9  ?"1 >cT3D  2H /* '>H`8` 2`H 0 """2 y  l(>`J#"'" '` Ԑ"` `|R '"? "?`|`R`Y `|`R` R      $ @  "@` 6  ?$ . >cT2ߔ  2H /* '>H`8` 2`H 0 """2  "'" '  Ԑ " @ `|'|#\#` Ԗڛ踒 "` /`)  @"@ 'ؖ  '  ܖ    ؒ  'Ԁ 耢  `` ` " 3`  `4''  4јܖ _ 7@7`8`4'`"'`   @ + 3` @3 '`   @+ 3` @3 '`  + 3`  3 '`c '`$  '`'`'`  '`'`'`'`D`D@" `<``L{ ZD` Z{`D`<`  @ܒ`܉9Ёp  D>Jc` #``| 'R`  ?   $  @  "@  e`|   ?$4]`|  $ @  "@   9  ?"1 >cT1  2H /* '>H`8` 2`H 0 """2 В  l>^#"'" '` "` `|R '"? "?`|`R`{O  `R`g #\#` B찒 x .  '@"@   ' 췘 ^   ܒ P M  @"@ /0  ' 0쐘 7 `@a >$` ` $`$``@a >$`` $`$``@c <$`` $`$`@ $@root/root on %s nfs_mountroot: getattr for rootnfs_mountroot: can't setup swap vpswap on device 0x%x swap/swapswap on %s nfs_mountroot: getattr for swap>L>`;#p <"А@!(>c>c @l>#_ >2X$`$ X 2`"X">2"!\>2l"8lp  >]#@H 0&>>-"och ">>]s#"">^Ґ#* >`lb>` @Blצ> ^|l " @"$  ~ >]H  *2 @ 2 $nfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d8>"`m >]"h< X@>"<'  ' ' j' ' '䰒 >"\  y& @ >"\nfs_args: retrying connect nfscon㿘H /* !`  @ ?+?  &H 0 `  `,`>!X>2@a@+ @| @& d& d, "* @4& d` " ``0  d& h d& h`"`  ` " `  > & "&   @  4&  @ 4& ` " `$  > & "&   @  4&  @ 4& `@" ``(  <# & $` "  &  4& ` " ``4  $& `@" ``8  $& `@" ``<  <$& `@" ``@  $& `@" ``H`?#@$`J6!`@" !`L`?#@$`N6!!! 86!`@ `P`?#@$`R6!`@" !`T`?#@$`V6!!! 86! P ӌ T 3>#>K!>ѡ  ]cؐc #FՖ 0v  ^  v H ? Q Kv X *@ F'<@@D ;   '2 v{ +@ Yv% " Z@ @$@  Yv  @$@ ϖ   '@0`<@@"s  .  @g"&aD$  $ $  ! &`@>!X>2@a$ d $ h$ $ $  $  $  $  $  $ $ $   $ L4! <4!4!4!   wɒ6`D``  @Ē``w Z`w Z$ ` $ T  T`$ XΒ &`L L+  > '@cp  җ/8 nnfsdism㿐6`!D` L  A T` $Ɛ8   ` $'>K%>㤒 @Eǖ  㤐 " ת*@$e @$٭L& `% .  㿐!D L  `@   "`@ "@&@ 㿘 ` & 2`Ő 2 $ 0 " $`" $ Ք \ 2M $ 2  -㿘`'  # -`2!L& !K!L& >J#u$!L  aL   >Jcu!L    -㿀  ⚖#\#` Ը  .build > MLENpD` "<  `@    `F `@  H>Jc`P \#`P|`'R`  ? ``$`` @  "@  e|``  ?$@4]|  $ @  "@   9  ?"1 >cT,R  2H /* '>H`8` 2`H 0 """2   l>YX#"'" '` "` |R '"? "?|`R`v  `R` ِ0  $ @  "@` 6`   ?" . >cT+  2H /* '>H`8` 2`H 0 """2 ! "'" '`  "` ' a@@  `2 `@2  "2 `@2 "  #\ә#` I .  '@"@  '  "R 0.  ܒ 쀦   @"@   '   2 (0@H~open eacces vtyp=%d 8  | @ ` !D>!hYΒ } !4>L `@$p !D  @6i  ے !" 2b` `@ `$`@` O   x L @ѐ` B<``    xӘ "; @$` @ 2   <`  E )!  < "`Ā@" @   <`   x   @ߐ$`!"$` 㿘  `@ $`|`!D      @E<   4    xs $   ?4   x|!Dc "d2 ` >Jc`D  "`D D A`'| R `  ?   $  @  "@  b|   ?$4Z|  $ @  "@   9  ?"1 >cT*5  2H /* '>H`8` 2`H 0 """2 j  l(>W;#"'" ' " |@R '"@`? "?|VR`R` P0l      $ @  "@` 6   ?$ . >cT)Ԕ  2H /* '>H`8` 2`H 0 """2   "'" '   " @ |'s  #\ё#`  .  '  S㿘`` @  ?| - ?2 ?2 $?2  ,?2  ?#@"  < |  ?2@ ?"J ,@?`(>!*` ըհհհհb  ,? $?? #@  ? ?M ??4<  < D    `  `  `v  4 <@ݓ<@` ?2@ $?"` @  `  `vј 2`  ` `@  ?2<@ ?<@<@gp>Jc!D `H  "`H D<  ޗ'|`R `  ? ``$`` @  "@  c|``  ?$@4[|  $ @  "@   9  ?"1 >cT(  2H /* '>H`8` 2`H 0 """2   l(>U#"'" '` "` |@R '#@`? "?|`R`V `R`Y P0`  ```$` @  "@` 6 `  ?$@ . >cT()  2H /* '>H`8` 2`H 0 """2 ^ "'" '   " @ |'q?`#@P  $ @  "@` 6  ?" . >cT'Ԕ  2H /* '>H`8` 2`H 0 """2   "'" '`' >2!P`" #@`M#`  $ @  "@` 6  ?" . >cT'  2H /* '>H`8` 2`H 0 """2  "'" '`' >."`" #@`?P  $ @  "@` 6  ?" . >cT'7  2H /* '>H`8` 2`H 0 """2 l "'" '`' >2!P`" #@`M#`  $ @  "@` 6  ?" . >cT&  2H /* '>H`8` 2`H 0 """2  "'" '`' >."`" #@` ?P  $ @  "@` 6  ?" . >cT&  2H /* '>H`8` 2`H 0 """2 ϒ "'" '`' >2!P`" #@` M#`  $ @  "@` 6  ?" . >cT&L  2H /* '>H`8` 2`H 0 """2  "'" '`' >."`" #@`?`?"U  $ @  "@`  6  ?" . >cT%  2H /* '>H`8` 2`H 0 """2 . "'" '` ' >2P # #@``  #@`L#`  $ @  "@` 6  ?" . >cT%  2H /* '>H`8` 2`H 0 """2 ܒ "'" '`' >."`" #@`$>L @R  $ @  "@`  6  ?" . >cT%T  2H /* '>H`8` 2`H 0 """2  "'" '`  ' "  #@`$`#@`(#`  $ @  "@` 6  ?" . >cT%  2H /* '>H`8` 2`H 0 """2 9 "'" '` ' "  L#@  $ @  "@` 6  ?" . >cT$  2H /* '>H`8` 2`H 0 """2  "'" '` ' " #@`,>L @R  $ @  "@`  6  ?" . >cT$g  2H /* '>H`8` 2`H 0 """2  "'" '`  ' "  #@`,`#@`0#`  $ @  "@` 6  ?" . >cT$  2H /* '>H`8` 2`H 0 """2 L "'" '` ' "  L#@  $ @  "@` 6  ?" . >cT#˔  2H /* '>H`8` 2`H 0 """2  "'" '` ' " #@  $ @  "@` 6  ?" . >cT#  2H /* '>H`8` 2`H 0 """2  "'" '`' >."`" #@  $ @  "@` 6  ?" . >cT#4  2H /* '>H`8` 2`H 0 """2 i "'" '  ' " ?`#2@>K "`2>>##x*`  $`?2$ >K"$ ` ?2$ >K"$ `$ `$$ `(?"$ @ڒ#$ `,$ `0?"$ @ђ#$ #\#` 찒 "i .W  @"@  ` ' 4 N @>2aP   @"@  '  3   '@"@  ` '   @ ܒ  'ؐؒ  +    !D @ % "  < " @? Z  @ V  |'x < ` :>J;   2)%" s | @>J# `"   @ ($ ̟%>J  L`"  "L` ? H $ ׵' | R `  ?   $  @  "@  c |   ?$4[ |  $ @  "@   9  ?"1 >cT!  2H /* '>H`8` 2`H 0 """2 ޒ  l(>N#"'" '` "`  |R '# ? "? |`R`V `R`w P0V      $ @  "@` 6   ?$ . >cT!G  2H /* '>H`8` 2`H 0 """2 | "'" '   " @  |'k`` ? ?` $ @  "@  c  ?"Z  $ @  "@   9  ?"1 >cT ٔ  2H /* '>H`8` 2`H 0 """2   l(>Mߐ#"'" ' '" # ? "?j  ܩ   #\Ȅ#` } . (  '|@"@    '  `  Z| R O|   @"@    ' И 9   @/ H ``  "   ?  @  'ۮ   }x`z @xR`2  `@ 2 # rx xxM   't@"@    ' t ݰ   t^ ϰ t  'p@"@    ' N   p8  'll-  l%v R`2  `@- 2 ɦ r x x[0 N  'h@"@    '  d   h V h  'd@"@    ' ՘ >  dܿ 0 d'``ܲ # `  @"($@"%  @2 %x \## % ""ɩ  2 @ 2   < ?   @($㿘  @ 2    gː 㿘 @ 2    g p`>J!Dc`T  "`T D  Ԉ'`| R `  ?   $  @  "@  c`|   ?$4[`|  $ @  "@   9  ?"1 >cT|  2H /* '>H`8` 2`H 0 """2   l(>K#"'" '` "` `|R '"? "?`|`R`V `R`J P0      $ @  "@` 6   ?$ . >cT  2H /* '>H`8` 2`H 0 """2 O "'" '   " @ `|'g `#\#` "X .&  '@"@   ' J <   ܒ4 . +  @"@   ' #   H y䖒  Sp ```< B!D  "Ұ 804 H00 0ƀ>#P>H 8>Jc`X "`X , P '`| R `  ?   $  @  "@  ``|   ?$4X`|  $ @  "@   6  ?".     2H /* '` 5`H 0 """2 A  l(>J#"'" '` "` `|R '"? "?`|`R`U `R`ڒ P0+      $ @  "@` 3   ?$ +    2H /* '` 5`H 0 """2  "'" '   " @ `|'fk  $ @  "@`  3  ?" +  ^  2H /* '` 5`H 0 """2  "'" '  '  " `: "` ""` """ `#\#` " .;  '@"@   ' ׈   ܒt ܀   @"@   ' f } 'ؐؒR p  @"@   ' F ]R  ՟䖒 N{$ 2     F>Jp'L'P'T !D @'``=  B "   x G tP p>H 8>Jc`\ "`\` ? X 4 *'|`R `  ? ``$`` @  "@  b|``  ?$@4Z|  $ @  "@   8  ?"0 >P  2H /* ' 5H 0 """2 T  l(>H%#"'" '` "` |R '$ ?"?|`R`X`R` SP`  ```$` @  "@` 5 `  ?$@ - >P  2H /* ' 5H 0 """2  "'" '   " @ |'d{V  $ @  "@` 5  ?" - >Pj  2H /* ' 5H 0 """2  "'" '  " `' :$` $  $P O$  $ @  "@` 5`   ?" - >P  2H /* ' 5H 0 """2 M "'" '`  "`  ` '$ $ $$ C a` L#\#` " .   @"@     ' @ ?>2aP   @"@    ' ' & |   `?  '@"@    '     ܒ ܀ a  @"@    '  `ܠ @6@@$ " "@@ `;  "`` @ b `>` &` 2@ " @# `c @%@`Ԓ@   T  c  '֑ؐؒ ؀|`T"`ר% >JP  &`h !D` "D  >K߻&. -">J# l`" l   ? T 0  <  Ξ '|`R `  ? ``$`` @  "@  c|``  ?$@4[|  $ @  "@   9  ?"1 >cT  2H /* '>H`8` 2`H 0 """2 ǒ  l(>E#"'" '` "` |R '"? "?|`R`V `R`` P0t`  ```$` @  "@` 6 `  ?$@ . >cT0  2H /* '>H`8` 2`H 0 """2 e "'" '   " @ |'a  ɐ" ? ?` $ @  "@  c  ?"4[  $ @  "@   9  ?"1 >cT  2H /* '>H`8` 2`H 0 """2   l>Dǐ#"'" '` "` '?" "?aw  Ӑ    $ @  "@` 6  ?" . >cT^  2H /* '>H`8` 2`H 0 """2  "'" '`  "` >`* @'"?#@P  $ @  "@` 6  ?" . >cT   2H /* '>H`8` 2`H 0 """2 ? "'" '' >2!P`" "M"  $ @  "@` 6  ?" . >cT  2H /* '>H`8` 2`H 0 """2  "'" '' >."`" "  $ @  "@` 6  ?" . >cTp  2H /* '>H`8` 2`H 0 """2  "'" '' >."`" "  $ @  "@` 6  ?" . >cT$  2H /* '>H`8` 2`H 0 """2 Y "'" '' >."`" "  $ @  "@` 6  ?" . >cTؔ  2H /* '>H`8` 2`H 0 """2   "'" '' >."`" "$>L @R  $ @  "@`  6  ?" . >cT  2H /* '>H`8` 2`H 0 """2  "'" '  ' "  "$"("  $ @  "@` 6  ?" . >cT5  2H /* '>H`8` 2`H 0 """2 j "'" ' ' "  L"  $ @  "@` 6  ?" . >cT  2H /* '>H`8` 2`H 0 """2  "'" ' ' " ",>L @R  $ @  "@`  6  ?" . >cT  2H /* '>H`8` 2`H 0 """2 ͒ "'" '  ' "  ","0"  $ @  "@` 6  ?" . >cTH  2H /* '>H`8` 2`H 0 """2 } "'" ' ' "  L"  $ @  "@` 6  ?" . >cT  2H /* '>H`8` 2`H 0 """2 1 "'" ' ' " "?   $ @  "@` 6  ?" . >cT  2H /* '>H`8` 2`H 0 """2  "'" ' ' " F"Gp"  $ @  "@` 6   ?" . >cTa  2H /* '>H`8` 2`H 0 """2  "'" ' ` "  `'>c@>#x*`  $>K"$ $ $ $$ (?"$ @#$ ,$ 0?"$ @#$   #\#` + .    @"@   ' o    G !  @"@   ' Q    @ H ``  "   ?  @  '/ Ͱ eܖ ð  2  @"@   '    "   @"@ S Tg T  '䀦'ؒۖ  ؀ "  @(Ú԰   h  @"@    ' ͵ S >2aP "  @"@   ' ͙ 7  |  `?  '@"@   ' x    Вb  Ѐ "t @ٔ&@Z |` 2`|" \㿐    Oh``` '  !D@  b`PX 2(>J# ``" `  ? L ( <  I' |`R `  ? ``$`` @  "@  c |``  ?$@4[ |  $ @  "@   9  ?"1 >cT=  2H /* '>H`8` 2`H 0 """2 r  l(>>C#"'" '` "`  |R '"? "? |`R`V `R`  P0{`  ```$` @  "@` 6 `  ?$@ . >cT۔  2H /* '>H`8` 2`H 0 """2  "'" '   " @  |'Z  t) ? ?` $ @  "@  c  ?"4[  $ @  "@   9  ?"1 >cTl  2H /* '>H`8` 2`H 0 """2   l>=r#"'" '` "` '?" "?Z"  ;   $ @  "@` 6  ?" . >cT   2H /* '>H`8` 2`H 0 """2 > "'" ' ' ]"  "  $ @  "@` 6`   ?" . >cT  2H /* '>H`8` 2`H 0 """2  "'" '`  "` >N#x ' H>!`">a` "a`""?#@P  $ @  "@` 6  ?" . >cT]  2H /* '>H`8` 2`H 0 """2  "'" '' >2!P`" "M"  $ @  "@` 6  ?" . >cT  2H /* '>H`8` 2`H 0 """2 D "'" '' >."`" "  $ @  "@` 6  ?" . >cTÔ  2H /* '>H`8` 2`H 0 """2  "'" '' >."`" "  $ @  "@` 6  ?" . >cTw  2H /* '>H`8` 2`H 0 """2  "'" '' >."`" "  $ @  "@` 6  ?" . >cT+  2H /* '>H`8` 2`H 0 """2 ` "'" '' >."`" "$>L @R  $ @  "@`  6  ?" . >cT ؔ  2H /* '>H`8` 2`H 0 """2   "'" '  ' "  "$"("  $ @  "@` 6  ?" . >cT   2H /* '>H`8` 2`H 0 """2  "'" ' ' "  L"  $ @  "@` 6  ?" . >cT <  2H /* '>H`8` 2`H 0 """2 q "'" ' ' " ",>L @R  $ @  "@`  6  ?" . >cT   2H /* '>H`8` 2`H 0 """2   "'" '  ' "  ","0"  $ @  "@` 6  ?" . >cT   2H /* '>H`8` 2`H 0 """2 В "'" ' ' "  "  $ @  "@` 6  ?" . >cT O  2H /* '>H`8` 2`H 0 """2  "'" ' ' " p"  $ @  "@` 6   ?" . >cT   2H /* '>H`8` 2`H 0 """2 : "'" ' ` "  `'>c@>#x*`  $>K"$ $ $ $$ (?"$ @{#$ ,$ 0?"$ @{#$   #\#` + .   @"@   '     `G!  @"@   '     @ H ``  "   ?  @  'Ә Ͱ  ]ܖ ð  2  @"@   ' Ư  `"   @"@ S T  T  '䀤`'ؒ  ؀``"  @!g԰  h  @"@    ' Y S >2aP "  @"@   ' = 7   |  `?  '@"@   '     В  ЀK   #` `     გ 2 @f`"   |` 2` |" 8   T` `|%  Ό2W $   W       @$ "     2 @ .   $㿘   @ p`>J!Dc`p  "`p ? H $ '`| R `  ?   $  @  "@  c`|   ?$4[`|  $ @  "@   9  ?"1 >cT   2H /* '>H`8` 2`H 0 """2 ~ْ  l(>6#"'" '` "` `|@R '#@`? "?`|`R`V `R`r P0J      $ @  "@` 6   ?$ . >cT B  2H /* '>H`8` 2`H 0 """2 ~w "'" '   " @ `|'Sܐ ? ?` $ @  "@  c  ?"Z  $ @  "@   9  ?"1 >cTԔ  2H /* '>H`8` 2`H 0 """2 ~   l>5ڐ#"'" '@ '@# #@`?@ "R  Ĥ ~#\#` 찒 "6q`| .h  @"@   ` '  S @>2aP "  @"@  ` ' ՘ 7  `|`  `?  '@"@  ` ' ô  @  ܒŞ  ܀~`|` 2``|" 㿐      @  "!  @ 4 " T  $  | 2  @  @ 2    `` `#\`#`@6 @`   @ NLb  WU " 㿐``` #\` #`@p `>J!Dc`x "`x ?` ?  H@ T'`| R `  ?   $  @  "@  c`|   ?$4[`|  $ @  "@   9  ?"1 >cTH  2H /* '>H`8` 2`H 0 """2 |}  l(>4N#"'" '` "` `|@R '#@`? "?`|`R`W `R` Q0      $ @  "@` 6`   ?$ . >cT  2H /* '>H`8` 2`H 0 """2 | "'" '`   "`  `|'` PM ?` $ @  "@  c  ?"Z  $ @  "@   9  ?"1 >cT{  2H /* '>H`8` 2`H 0 """2 {  l>3#"'" '@ '@# #@`?@ "P2  K 4|R   ?` $ @  "@  c|  ?"4[|  $ @  "@   9  ?"1 >cT  2H /* '>H`8` 2`H 0 """2 {2  l(>3#"'" '` "` |@R '#@`? "?|`R`W `R`˒ Q0  $ @  "@` 6`   ?" . >cT  2H /* '>H`8` 2`H 0 """2 zВ "'" '`   "`  |'` OZ``|4` ? ?` $ @  "@  c  ?"Z  $ @  "@   9  ?"1 >cT,  2H /* '>H`8` 2`H 0 """2 za  l>22#"'" '@ '@# #@`?@ "N   #\#`` \ך찒 "6`| .  @"@   ` ' I  @>2aP "  @"@  ` ' -   `|`  `?  '@"@  ` '   } @` ܒ o ܀  @"@   ` '  S @>2aP "  @"@  ` ' Ƙ 7   |`  `?  '@"@  ` '   @` ؒ  ؀ z`|` 2`|` 2``|" |" p     D@  by     >J# |`" |`  ?  D `' | R `  ?   $  @  "@  b |   ?$4Z |  $ @  "@   9  ?"1 >cT  2H /* '>H`8` 2`H 0 """2 x  l(>0#"'" '` "`  |R '"? "? |`VR``R`S P0@      $ @  "@` 6`   ?$ . >cT#  2H /* '>H`8` 2`H 0 """2 xX "'" '`   "`   |'`L `|R   ?` $ @  "@  b|  ?"4Z|  $ @  "@   9  ?"1 >cT  2H /* '>H`8` 2`H 0 """2 w  l(>/#"'" '` "` |R '"? "?|`VR``R` P0s  $ @  "@` 6`   ?" . >cTV  2H /* '>H`8` 2`H 0 """2 w "'" '`   "`  |'`L   x! ? ?` $ @  "@  c  ?"4[  $ @  "@   9  ?"1 >cT  2H /* '>H`8` 2`H 0 """2 w  l(>.#"'" '` "` '?" "?K     #\#` "`6 .`  '@"@   '  z  ܒ  k   @"@    ' ܘ S >2aP "  @"@   '  7  |  `?  '@"@   '     ؒ  ؀w |` 2` |" |" , " h```  >J!Dc`h "`h`@r  ?`  L ( @`<`   '| R `  ?   $  @  "@  c|   ?$4[|  $ @  "@   9  ?"1 >cT  2H /* '>H`8` 2`H 0 """2 u  l(>-#"'" '` "` |R '# ? "?|`R`V `R`R P04      $ @  "@` 6   ?$ . >cT"  2H /* '>H`8` 2`H 0 """2 uW "'" '   " @ |'I ސ  ?` $ @  "@  c  ?"4[  $ @  "@   9  ?"1 >cT  2H /* '>H`8` 2`H 0 """2 t  l>,#"'" '` "` '?#  "?Im   j ^?`#@P  $ @  "@` 6  ?" . >cTO  2H /* '>H`8` 2`H 0 """2 t "'" ' ' >2!P`" #`M#   $ @  "@` 6  ?" . >cT  2H /* '>H`8` 2`H 0 """2 t6 "'" ' ' >."`" #  $ @  "@` 6  ?" . >cT  2H /* '>H`8` 2`H 0 """2 s "'" ' ' >."`" #  $ @  "@` 6  ?" . >cTi  2H /* '>H`8` 2`H 0 """2 s "'" ' ' >."`" #  $ @  "@` 6  ?" . >cT  2H /* '>H`8` 2`H 0 """2 sR "'" ' ' >."`" #`$>L @R  $ @  "@`  6  ?" . >cTʔ  2H /* '>H`8` 2`H 0 """2 r "'" '  ' "  #`$ #`(#   $ @  "@` 6  ?" . >cTz  2H /* '>H`8` 2`H 0 """2 r "'" '  ' "  L#  $ @  "@` 6  ?" . >cT.  2H /* '>H`8` 2`H 0 """2 rc "'" '  ' " #`,>L @R  $ @  "@`  6  ?" . >cTݔ  2H /* '>H`8` 2`H 0 """2 r "'" '  ' "  #`, #`0#   $ @  "@` 6  ?" . >cT  2H /* '>H`8` 2`H 0 """2 q’ "'" '  ' "  L#  $ @  "@` 6  ?" . >cTA  2H /* '>H`8` 2`H 0 """2 qv "'" '  ' " #rߐ ? ?` $ @  "@  c  ?"Z  $ @  "@   9  ?"1 >cTה  2H /* '>H`8` 2`H 0 """2 q   l>(ݐ#"'" ' '" # ? "?`E  `  j  $ @  "@` 6`   ?" . >cTt  2H /* '>H`8` 2`H 0 """2 p "'" '`  "` `>#@ >K"&& & & `$&  `(' @k4#& & `,& `0?"& @k)#&   #\#` "  .    @"@    '   `G !  @"@    ' m ٰ   @ϰ H ``  "   ?  @  'K  M4ܖ   2  @"@    ' '  `"   @"@ S T T y '䀤` 'ؒ k   @"@     '  S >2aP "  @"@    ' ˘ 7 ` |   `?  '@"@    '     Ԓ  Ԁ`p" |`` 2`|"  " h'  >J!Dc`d "`d` ? H $` <  `'|`R `  ? ``$`` @  "@  c|``  ?$@4[|  $ @  "@   9  ?"1 >cT  2H /* '>H`8` 2`H 0 """2 nʒ  l(>&#"'" '` "` |R '# ? "?|`R`V `R`c P0`  ```$` @  "@` 6 `  ?$@ . >cT3  2H /* '>H`8` 2`H 0 """2 nh "'" '   " @ |'B``o͐g ? ?` $ @  "@  c  ?"Z  $ @  "@   9  ?"1 >cTŔ  2H /* '>H`8` 2`H 0 """2 m  l>%ː#"'" ' '" # ? "?B|  ` `_?#@P  $ @  "@` 6  ?" . >cT^  2H /* '>H`8` 2`H 0 """2 m "'" ' ' >2!P`" #M#   $ @  "@` 6  ?" . >cT  2H /* '>H`8` 2`H 0 """2 mE "'" ' ' >."`" #  $ @  "@` 6  ?" . >cTĔ  2H /* '>H`8` 2`H 0 """2 l "'" ' ' >."`" #  $ @  "@` 6  ?" . >cTx  2H /* '>H`8` 2`H 0 """2 l "'" ' ' >."`" #  $ @  "@` 6  ?" . >cT,  2H /* '>H`8` 2`H 0 """2 la "'" ' ' >."`" #$>L @R  $ @  "@`  6  ?" . >cTٔ  2H /* '>H`8` 2`H 0 """2 l "'" '  ' "  #$ #(#   $ @  "@` 6  ?" . >cT  2H /* '>H`8` 2`H 0 """2 k "'" '  ' "  L#  $ @  "@` 6  ?" . >cT=  2H /* '>H`8` 2`H 0 """2 kr "'" '  ' " #,>L @R  $ @  "@`  6  ?" . >cT  2H /* '>H`8` 2`H 0 """2 k! "'" '  ' "  #, #0#   $ @  "@` 6  ?" . >cT  2H /* '>H`8` 2`H 0 """2 jђ "'" '  ' "  #  $ @  "@` 6  ?" . >cTP  2H /* '>H`8` 2`H 0 """2 j "'" '  ' " i#  $ @  "@` 6`   ?" . >cT  2H /* '>H`8` 2`H 0 """2 j: "'" '`  "` >#@ >K"$$ $ $ $$  (' @dŒ#$ $ ,$ 0?"$ @d#$   #\#` 6| . `  @"@    '    G`!  @"@    '  ۰   @Ѱ H ``  "   ?  @  'ژ  FÖܖ   `2  @"@    '   "   @"@ S T T { '䀥 'ؒ m ؀`h  @"@     ' t S >2aP "  @"@    ' X 7  |   `?  '@"@    ' 7    Ԓ!  Ԁjf|` 2`|"   "%  @ а   @ 2   " " p   `!D @ "  >J# t`" t   ? H $   '`| R `  ?   $  @  "@  c`|   ?$4[`|  $ @  "@   9  ?"1 >cT  2H /* '>H`8` 2`H 0 """2 h3  l(> #"'" '` "` `|R '"? "?`|`R`V `R`̒ P0L      $ @  "@` 6   ?$ . >cT  2H /* '>H`8` 2`H 0 """2 gђ "'" '   " @ `|'<\  i5 ? ?` $ @  "@  c  ?"4[  $ @  "@   9  ?"1 >cT-  2H /* '>H`8` 2`H 0 """2 gb  l(>3#"'" '` "` '?" "?;   ~  #\#` " 6q . h  @"@    ' I S >2aP "  @"@   ' - 7 ` `|  `?  '@"@   '      ܒ  ܀`h; `|`` 2``|"  " nfs_readdir: lost in space8@` @  |  4  F B `@=2  ` @6 2 !D!>L | @$@!ྀ >Jc`  ("` `^  Ā@ >Jc`  "` `9ޔ 2X` >Jc`  "` K"@2H C @@`Ґ",  Δ "@"@` >` >!h??"@:   @ E"??@""@@`@"@$`"@"@""EEK! readdirrpc resid > 0 h ``| `!D  %>#P>H' 8'􀥠値>Jc`  "` D" +'`| R `  ?   $  @  "@  ``|   ?$4X`|  $ @  "@   6  ?".    2H /* ' 5H 0 """2 eW  l(>(#"'" '` "` `|R ' ?"?`|`R`V`R`찒 Qf0      $ @  "@` 3`   ?$ + ￔ  2H /* ' 5H 0 """2 d "'" '`   "`  `|'` 9S  $ @  "@` 3`   ?" + q  2H /* ' 5H 0 """2 d "'" '`  "` '   I   $ @  "@` 3`   ?" +    2H /* ' 5H 0 """2 dW "'" '`  "` '    `#\#` " .?  'ܒ@"@   'ܐ Rؖ e  Ԓ? ZԀ   ܒ@"@   'ܐܔ 1ؖ D&&eq0O  ܒ@"@  'ܐܔ ؖ (䀤  ܒ@"@   'ܐܔ ؖ       ܒ@"@   'ܐܔ ߘؖ :  ` " "" 4@@"@@`8""`` @ B `>`"&``8 <@$,4", ```B >`@&`@ "@@``? "`ܖ @*@@$"@@`""``< @ B `>`"&`  ܒ@"@   ߒܖ 0{'܀  ܒ@"@  'ܐ   ܒ@"@   'ܐܔ Bؖ U؀ ' '"    ܒ@"@   'ܐܔ ؖ ,`?d[䀤  ""@4@"@""`8 B`>`"&`" ``>d7 H0d3 0 > h`   ""EEK! readdirplusrpc resid > 0 'L  'x'!D|'| ``  [J>H''t'x`  \>Jc` #`| 'R`  ?   $  @  "@  e|   ?$4]|  $ @  "@   9  ?"1 >cT  2H /* '>H`8` 0`H 0 """2 b  l>#"'" '` "` |R ' ?"?|`R`6 `R`   $ @  "@` 6   ?" . >cT}  2H /* '>H`8` 0`H 0 """2 a "'" ' " '  ` ` |` ` `Lt #\.#` H .  '@"@   't        @"@   '  '`'` x`  @"@   ' c     @ ˞ @"""`5@@"@@`8""`` @ B `>`"&``8'xx`@@%-5"- ```B >`@&`@ "@@`?"`@& &p @,@@$@"@@`""``<`@ B `>`"&`  @"@   Y 0\'  @"@   ' ͘ Gx`"'' ``  "S  T& T 0)'  @"@   '  K  @"@   '  ``@  @"@ ` ?    'h W`2`@]i 2 '=D   ]' '7' >'' (cx* @ 2 -@ ` & @`J` @@& 2``+  @"@   '  ~  @"@ ` ?   h 0k'   @"@   ' ֘ P [x   @"@   '  6`?` x ""@5@"@""`8 B`>`"&`x`"``$?``ڐ!``Ѱ H`̰  >!p`   "".nfsAxxxx4.4㿐c  `| ' &@&`ݐ>#(2` 3  &`>`  @, .`<   @.`<   @4 .` @.``` @@'  `@@ " ` .`* :  z 1`@  h|>J!Dc`L  "`L ? H $ ?'| R `  ?   $  @  "@  c|   ?$4[|  $ @  "@   9  ?"1 >cT3  2H /* '>H`8` 2`H 0 """2 ^h  l(>9#"'" '` "` |@R '#@`? "?|`R`V `R` P0      $ @  "@` 6   ?$ . >cTє  2H /* '>H`8` 2`H 0 """2 ^ "'" '   " @ |'2_kP ? ?` $ @  "@  c  ?"Z  $ @  "@   9  ?"1 >cTc  2H /* '>H`8` 2`H 0 """2 ]  l>i#"'" '@ '@# #@`?@ "2  3 Ր#\#` 찒 "`Ȁ` . 쀤!  @"@  ` ' }  @``@ H ``  " ` ?    '[  @`"%U R` @ '܀`@4 `Y `R @ ܀`@ 粔 "`ܐ`1 2 2  @Z3 2 :ܰ ^a0V 4  '@"@  ` '  + @  ؒ  ؀ @ ^.! 'ԐԒҖ  ^`@  `0'@p!D@@ l  D>Jc` #`| 'R`  ?   $  @  "@  e|   ?$4]|  $ @  "@   9  ?"1 >cT  2H /* '>H`8` 2`H 0 """2 \  l>#"'" '` "` |@R '$@`?"?|`R`0 `R` ߐ  $ @  "@`  6   ?" . >cT愔  2H /* '>H`8` 2`H 0 """2 [ "'" '  `  '` $ $@$`$`#\#`A찒  .  @"@ '  j @>2aP   @"@  '  O   '@"@` '  8 @  ܒo * '  @"@` ' ^  `Ԑ@X_  / !1\㿘  "  ``L @[[:` $ nfs physio/async㿘  0`  >Ȑ# 0  >#p 0@" l h 0 3? 4* 㿘    @ nfsfsyncnfs_fsync: not dirty0'L'P'T '??  '@ !D'|''*  !!D"` T@]H /* %0K @ F  0 2>yǐ`2 l l@-?'- 0% 0"  T ; 2`* @ *`  `:  @ 2 d@( d d `" :  @   H 0o &P' @#-` P T l :`2*  *  ` d :"@  :`@ `@-`!1 F @4?#?!-`@ 0 % 0{!`H /* % 4%4 0% d% 0 0% ` % 0H 0}`@ԑ-`H /* %0 ^ @  0 , L`2Q`2M > 0  " 0H 0`P A!>!X * ' 0 >j 耠`T` 0 2xƐ`T` 0  0% 0H 00 H 0`L'P `FH /* %4 - 4 >$E% "4H 0P' ـ!>!X * 'H /* % 4 ؐ4H 00 T`G`  ?`0` 㿐     |  #\' tag VT_NFS, fileid %ld fsid 0x%lx 㿘  |<>8(  @ 2>> 0  - - - - -㿘 @  bwrite: buffer is not busy???㿘 0  0>`#p>  0?! @& 0H /* %  \  \" \`0 "`0 \`4 "`4H 0@   5` T \ :`2*  *  `@ d :`  0 @  l#  ,@ & 0  0@*@& 0 & d& ` 0 & 0|# `!1@` \ ` ` 0@ & 0Ӑ2# {֐H /* %  \AH 00`0 "`0yH8   ` < "  `@    2      2  P 㿘 `|ྒa2>L`"਒``*"@ *`@ *`">b>)*` @㿘 `|ྒb2>L`"ఒ``*"@ *`@ *`">b<>)*` @8 `| #"&>$4 T`  >` < > !" ' ' ""  ' '  ƒ>!`>)c* @@㿘 `|ྒa2>L`"਒``*"@ *`@ *`">b>-\*` @㿘 `|ྒb2>L`"ఒ``*"@ *`@ *`">b<>-\*` @8 `| #@! >L $   *`" *  * $  " >L $   *`" *  * $  $4 T`  >` < >& !" ' ' ""  ' '  ?>!`>-c\* @@dev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialfile system full %s: write failed, file system is full 㿘'@`  0  %@> @  ?>#`  ># >#2  Ā D   <  ( ` ̡, @W @Qb d$ 1> @. " $26 2 `@VZ @QH>@ ܔ   `>  `$``$`'@> @-ז  >@> 0F ԰ dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevbad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim㿐\% `0 e@> @ 2 > ?  @  >" `03`> ʐ"`2`> Ő"x .``<``(```̡, @V9 @P d$ .` 2 >" `0`> "В?u  '= @- "`v0@Pb@ `dT,@ > |"$x$0j`$6 `'>`<`*@U`(@P1 `̀@# >c }`$``<`(@UΒ@P  d`̀@`0 >c0 l`Ԑ  $`#``> :#>@p ܠ $3`d,"`T@  <@@ o `T&? @ f "@<  $w$0H"0@R6 %':` @,t v8`>@$> 0 `԰ ffs_reallocblks: unallocated block 1ffs_reallocblks: non-logical clusterffs_reallocblks: non-physical cluster %dffs_reallocblk: start == endffs_reallocblks: unallocated block 2ffs_reallocblks: alloc mismatchffs_reallocblks: unallocated block 3 %d,>! '|   | $  `  P?#>0, @ Td@ ̓: 2  c& 6>, @ P@"  m؀&8 d T*@>@, @ T "   T d@ T@O:.`@T:@O 2( Ȕ@$ 2 @$ 2  *  @*`@ @ ?0t   H@` *` * ?  ?* @*`  2>  0" 0?s ʀ@ H'|@N>@# . H| d T0@ : 2>  P`Td@: " >  x <@  0#\@  $@@@ #\$@`  8 >! t`@t@ >a `& >L     '+`# +  + '@>! t9s 6@   <@2 d T0@: d@,"`Td T0@ : 2>> 3 ! "`>  ` 8Ӥ @ t_  tY mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free 㿘   "`| `Ȁ W< 2@]``,@SW: @R. 2>@# :`   ͔06  | `"  >#  `> #(>#@` &  쀢 &   & &     &    >`@ `>#p x`԰ 㿘 , @MP  @  l p: :*  "ؓ*` 6   &  : @Rڒ 㿘 `\@Mϒ .? 2X`8`   @R%``@R x`8.?   @R`@M@L` `,@M`@L`l`p: : *  @"ؓ*`   6,$bԔ:  C `l`p: : *  @"ؓ*`   6$bԔ: / `X +& ``* *  " `@0 `@Rb `8`@R] `8 @RV`D@RT``|*"@ *`@ @L*`?@L@RG㿘  "`,/ 6 @@6&@  .`,@ `, @M  ܲ``,@"  㿐 plT>@* .@ "ؓ*` " :@58:? 4˰  @Q @Q.@   d , qQ? H@ "U@  >L#Ԁ  >L r  $ @LT> @"U@ ,` :`c ` @ ` ` "@: ٘ 蒃@ 8" !@"U @ ,` :`c ` @ ` ` "@: "T 璃@ T>#*  4" 4#*` `4 "`4T>3 @"U@ ,` :` ` @   "   * ** $?$ $̘ p$̑>@* l"ؒ.@ *`  ?"  ,   <@@q}㿐 pl>@* .@ "ؓ*`   202  @Q @Q.@ ?  d , pq  H@ "U@ " #Ԁ |  >L0t>L $ 02T@ߔ8>  .`4 28`@ `8@N  Q@Ô@K8"@"U  ,`  :`c `  ` ` ?"@ +@*8撆 8 $"@ $ $p@ $̑>@* l"ؒ.@ *`   "  ,Е* 4`^"4@  q-U 6! $@"U  ,`  :`c `  ` ` ?"@ +*@* $"$ $p"@$̑>@* l"ؒ.@ *` ,`  ""  ,`4?"`4$@*` `4 "`4@P$``< @prpos = %d, i = %d, fs = %s ffs_alloccgblk: cyl groups corruptedffs_alloccgblk: can't find blk in cyl㿘  `H༐@JB "8 ( @J@ "U@# ``@Ǖ> 2`X ѐP ͐|@OȐ@Jମ@ "U@-`T T  @ "U@" X- P@O* |@O@Jତ@I@O@J@O@JP@O@I@ ,`U 4P`@ ,`P@,` @ ,`,`U ,``@,`,`U $jX@Jc@Oa%|`@I* L,#\ TP@OO* R?2 L>!)>!(?,`,#\ TP@O2* R@"U # `@ 2*`L?2Xe`  >`: >ߢ !>!P8@r 6% ( ,` >@"U@" `#ؒ@ @? ?% Đ?$ pl:* * "ؓ*` ?"|@N͐@I@IÒ@I@N@I@N@IP@N@I@bU*   - Ԑ  X@N* ?4@ "U@- T T @?"@ , @N``<@@Offs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost block㿐` T.` &Ű ` @NM @NG.@ ࠠ  d , m?  H@ "U@ #Ԁ  h.$   @ ``@ $@$@ h`.?  @@ `4@T.`y"@༐@HX"8  @H`:  l:`* &  *  p    " p *      pA @4@"U # `&@  2`><#@$ ༐@M&`* @H".>'# @%>"8Т@@m0nQ cg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedfs = %s ffs_nodealloccg: block not in map㿐 pl>@* .@ "ؓ*`   2  @M[ @MU.@ ?  d , lƘ  H@`"U@"` cԀ` >Lmΰ  $`@H+ `:`b@`\@   &: "W `0` `" : :``@"U@"@`\@ @I  `@"U@ b`\@ @I 2 >#(`0Ȗ>_#H" `@"U@@`\@ *   *>#h>C#x$`0   <@ @L@ z`@"U@:b@`\@  &   +  *` ?$` p$ȑ>@* l"ؒ.@ *` < @ ?",` $`p@ $>@* l"ؒ.@ *`  " l@Lidev = 0x%x, bsize = %d, size = %ld, fs = %s blkfree: bad sizebad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s blkfree: freeing free blockblkfree: freeing free frag㿐  0>%@> @  > 8 T@ >@@  >#  0 ># @Fa $@ >  > @ 0͐ @K   @K, ?    d ke, l0H@"U@  >LԀ >Ll 0 $ @Fΐ 0 } `>@@"U@`@ ? 2 > 0  >4 X@"U@"`ؒ@ @  $  p`% đ<*  l"ؒ, *`  " |@K @Eޒ@F @E֒@K @Fz@Kz @Ft%P@Ks@E @bU*  -` Ԑ X@K`*  4@"U@-`T 8?.@  @"U@:c`   4? $ :@  8 #  :@ @ ~ @  T >@ 6>$@"U@,`:`c`   :`*#;@ " > 0   > x"`    ?# `@   @*@ +@$$$ ̖ p@% ̑<*  l"ؒ, *`  "  @"U@:c`   4  $ :@  8 #  :@ @ @  `<@"U@`@  "v $ 8" $$ ̐ 8 8"  p%  l< *,  ؗ*@ `  #@#`  $  p`% đ<*  l"ؒ, *`  " |@Jz @Dʒ@Ep @D’@Jl @Ef@Jf @E`%P@J_@D @bU*  -` Ԑ X@JL*  4@"U@-` TT @ "@ - j㿘   <@@%@ B  ifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inode㿐`` | ``,@I >  q`@IP`@I`` @I-  ?` `   `diT, j0xH@ "U@  >L#Ԁ >Lj j  $ `@H@ "U@4b \ : 2 > !`L`Ҁ 2 > !0@"U@4b \   **@* 0*$ 0  $ ``p`$`ȑ=* `l@"ؒ- *`  "` <  2,` ?$ ``p$`=* `l@"ؒ- *` ?" ,`i bsize = %d, size = %ld, fs = %s checkblk: bad sizecheckblk: bad block %dcheckblk: partially free fragment㿐 0  @> @ " $> #  >  @*>  8 @Cl@I @I,@ ࠖ?  d , h H@ "U@ " #Ԁ  i?0E@C0  @"U@# ` `@ϕ>@ - T>@  @"U@,  : ` @  ?";@ 2` 疆@`@ > 2 Piq`?start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in map㿘@C` `, & : ``,`: "`@"U@@``@>`8#` *  ?" ?  * @D ,`@"U@ c``@>`8#` *  ?" ?  * @Db 2 > "`> "А" *  8&`,@"U>!.>!<  `:`c@``@    & :  `8 "@ : "  *  (  +``8Ԁ > "Ԕ`> k# 㿘e$ l h>`.`&  ()> . &  (.@)e$ p@@6`8 ` ('@(  (@ @ &e$@,?`8  ('@( 8@ ?'@@e$4. ` &.` &+ &e$( @? 4@ cT( uid %d on %s: %s 㿘>  ` ffs_balloc; blk too bigffs_balloc: ufs_bmaparray returned indirect block ```| @A9P` <` 0  >  H``"a P@@Ŕ` '` c'a` 40 *: 8 208<0<D L 0@D` `@0q#\ #` <@,  0Td#\@8 0@FĐ : <@d, T:@ " ` $f ` gB `  -` `0@F: 8  ?f  ` ":0<D  L @ ?e ig10#\ ` <@OdT#\C8 @FL`: 8 D2 0(0DL a w g 'd`* "TH@B<" @` <@   #\@d-`T:@ "  $` G"@X> 4?> o `''*  ؀ D   0  Ę 0gE'Hd'<, @By"T @` <@ 0 #\@` fe 2ؠ*  $'`$  Đ@?0e `H*  R ` fJ   09 &@ 0f 'Hd<, @B"T"@` <@ek  0 @Ve `* &eUe G-* `]0 Q &0f 'd`, "TH@A<" @` <@ ` @#\``* &e `eU`e` 0?dh  0 0f[ d', " T` $"@e  0 0 @`2 @` <` @ "$`$㿘@p@"?ffs_update: bad link cnt㿐` <`|  ?%      ?%   2     "  %  %   "   %    0% `B = 0   >L %   *`" *  * %   ?% e, 4   5 5  `@C`@DN`` @DH,@ ` @C @C`x ```0 *  ?`dc, "d0.  <@@ `xU   "`x>" @B   H* U    < @dd] ffs_truncate: partial truncate of symlinkitrunc: newspaceitrunc1itrunc2   , |>L>L!    'P*`" *  * 'T@ ! @:` ``耢 ">/!`@@`  q<@| 2@}$L$P$X$T <@) 4 ` ?  *  "Ѱ? @| @    ~ P =  <@908 2 4@(  E?       L#\ <@!@a`cMLcLP   ${@ < G<@=2P    E?    LW#\ 2Z <P * : 8 208<0<D L @L H$@?Le `bL0cxL0 :@ EB?@<P't$'t @BΒ$'0 < : ?@ 6""@ @," @?P   $X < < < `(      } ?'t$ ?'t@B $?'؀@dH@ɕ- 2H`$ؐ06 ~?? @,`,਀"#` $P`* : 8 208<0<D L < @ڦ`J.` E` 40P`* : 8 208<0<D L ` <P`* : 8 208<0<D L # >p!  T:  <  X> 0 ؀@Za`` X>,`@"`J!` <" $$ ?   @" ffs_indirtrunc: bad buffer size㿐'P'X    t@A P @;  0c: `0" >#p `, "`,`0`< `8$`0 $$`T>"d Pb,Xw "`H 0˵ 0'-  t@"@@>*`  < @ a\ 2aܐt?@A??&@, @"? ? d. 20?@ P@<, @ ?d_. 2P  X 0@ " 0aX 㿐  | `P @: 4`0 *:  8  2`0 8e<`0e<eD `L   ?" `B " a0 e< H @  "  "@㿘>8`(` .@-(>>< `` @:"8  @2 /`/@(&/`8 (8 ܰ Disk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlap㿐>" T> D *`" * @ <@: <?`<@"5`|?@20`| ",`|  ؘ 2$`|` @2`| "`| 4`|: $`|>x#># ;  ?>#@ ɠ |ffs_isblock㿘 8">0 2>@ * >* >@*@   `?>@ *` @ `?f!ffs_clrblock㿘 8">>0>.@>*` *` @ * * .@ >@* * .@8!Ёffs_setblock㿘 8">>0> .@>* * @ * @ .@ >@*  .@ "ffs_isfreeblock㿘 8 ">  >0 >@`?>@*` @*` *   `?>@>  ؐ#@softdep_flushfiles called㿘>ʐ  softdep_setup_inomapdep called㿘> Psoftdep_setup_blkmapdep called㿘> softdep_setup_allocdirect called㿘> softdep_setup_allocindir_page called㿘>!softdep_setup_allocindir_meta called㿘>y!@softdep_setup_freeblocks called㿘>k!softdep_freefile called㿘>_!softdep_setup_directory_add called㿘>P!softdep_change_directoryentry_offset called㿘>>"(softdep_setup_remove called㿘>0"psoftdep_setup_directory_change called㿘>"softdep_increase_linkcnt called㿘>"softdep_load_inodeblock called㿘># softdep_update_inodeblock called㿘>#Xsoftdep_fsync called㿘># ffs_mountroot: can't setup bdevvp'sffsroot_device㿐>>">-pq’ch  >>!!>2q 8 >%#0;>#>`p  3 8@   o" 0">2X"@"`X 2"X">2"a\!D  Y`  ~ @ Doђ@  WARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck  g l@<"x&$D L Ҁ   w@   <@0@ 怤=<@;   `b !(  L р 2 <@>>!j  !Xe Ӏ   0  <@ $< 2 &$ @w `0} @&(&&k&, @ "D  >"Ԁ@& {   "<< !!`   ^<@@    D`D `  r ( YJ Z`@9"   Y= Z`@9$  Y2`@9$ @N D`@<@"  L Ҁ ,  Ӑ  , ѐ@  qĐffs_reload: dirty1ffs_reload: dirty2㿈<  D` r  wϚ  % ">"8 `h ? " ( @6q<`  ?[찒  HF%\!T@@ 0@eg8D]3ϰ "  |"#T"#T h h#@ 0@ " 0]%(@+&@D@   4?@6 6'  8 0 4@<=$?  d@[*@  `< *` H bo\ 8 Ӏ  Ԗ %$p0s<*@&<%$ $ ,  #T%$ "@ ,``\ `>Nc`$r @`o   w  "`|>^"P @;: @;Ԓ   @;Β,@   @: @;' x? ` 0+@  d [6,  x@:w  H*` U\j%p<`2` 㿈D  ?tx gs >2 8^ `G  v   J`<   ?Ζ > `h  " ('  @5;<`  Zɘ2D HF\!T@ O0@@eg(D ,В ?Lр ,Ӑ`,`<@>>!X L!۰ L?!P Ұ  g @7Ò!P h` %` hL Hh#@ 0@ " 0['` ,Ґ ,,4@5@ $`,* @ 6  (804@:Ԑ%d@ZF*@  H `< *` "b[}8'$ $&aD$T, 6 &aD$ "@,`&aD&`d "`  2&`h`  &`h(&`@`< &`<%@%`%`t%` d%`$8`%`("`@ 6"`D@U"``Ԕ! "Ԑ@7&"@ 0  =aH0 @3e; 0B? 8 <04 <0/ Ӏ     ,ѐ@p  3 D쀢`" [   ` `   &aD㿘  * &   @*%L?&  &%P%, %  0 :* * :>%0   t  @2; %0 B >%0 H;  ;  L>%8;  ; >%@ 㿘`<6` `  @= 7aD N`Ҁ   `Ӕ @.`Ѱ  &.`є?  D "  t N`Ғ     ?,n bŝ Ś ŗ $aD`<*@$`<㿘<@D o?` % ` " @  ` o+ `@ @ ffs_statfs㿘!D Fe\!T@"6@>#`4&``0&``(&` `@9V`8`̠ &``(@9O`<@3 d$&``,@9H`?&` D`Ȁ@ &`  `L Z 6@ ` } Z`<  @5y` fs = %s update: rofs mod㿘!D Lа " LҀ"  > >   5` 2  $ @ ' |` ` 0 " `"@`m    2 dmِ 2 ` <@2 `h 2 D@LЀ @ߒ 2inode㿐D`@ &  > xkr "`& x  - .! @5D!< >   " |$` $ $$"`$@6"`$@z " mn Ɛ0s@7ϒ @8i   @8c,@   @7  @7 x`?  ` 0+@  d Wʓ, " xlY I&@7  H*`    <@"T0$X> c0>@! "`l$&l$ 쀢 2%,$   $  < 2%, $%, $$ &㿘!D`  `,@7`   F@ | 2@"` "`㿘  4?@2& +8@04@7Ɛ%  d@Y4*@ H @ `XH8W 28@@&8 :Td @1"    hY  ,>L`h$ H ѐL?H"P, 4H8 H`"@"H`:0X0W} 2㿘`  >   -0   -0>  ( ,>! >!&%s: modeffs_read%s: short symlink%s: type %d㿀  ` |> X>`h@ @@ 2 耢 2 > x>`h ( > >`h`0@Ű 2`` 4@(`0   `'`@ b `  @0P `` 'P*@: 8 208<0<D L ` <0 `"*= 2P@(PP* :  >D ?> (  #\[?7  , 40P * : 8 208<0<D L '?#\#`V  ?Uޘ % @$6HH  W ` X' "W %ffs_write%s: nonsync dir write%s: typep'    |> X>`h@ "#  >$ $> "  <  @" @   @"02 > x>v`h>s`h ) e0 B  2@e4@ ` ` B  2  ' ܰ 6' ?ذ @ @/`P e<`0 #  $  #\ u< B 8    < B=  @td@t @`  `P`* :  8 `L2`0 8`L`0  : e8 ; e@  @@ B @ "@@&  H  H@2"`0U\  > ,     \ U U쀦  "   %  2q؀@        35 +`Ɩؐ' $@ b <؀@>L     '+`# +  + 'ffs_fsync: not dirtyffs_fsync: dirty㿐    `?H /* % `0 3 0 +  0 >@! P & S 0 $ 0H 0 \ U;0T 0P р" ɦ -`4@ A$@`4 2`4H 0 0H /* %`0   ?`@ >!lDH 0>L```'*"@ *`@ *`'   0`?㿘  @  !D  x -  | .' $ | mfs_mountroot: can't setup bdevvp'smfsmfs_root㿐>>">-pgch  > >!%>2g8 >  0S>  > `eߔ K $ .X 8>)H" |"  " x>W$>$ $ `0$ P$   e"В ͒ .0">2X"@"`X 2"X">2"a\!D  Y`  8`Z De@F  㿘\F!T@2  0@@4 eg> >  "a>W4"a@3$>"cذ>>?h#@"`"hmfs_mount: dup dev t t@< D N`Ҁ    Д ]N`Ҁ T<@2P.`S  >)Hf0| K> | !h" @?c f#!h " $> ː# . |# |$ $ $0 $ $  "|!Dx `ix"Ԑ@@/ڒ"@ i Z YZx Z@/˒"@  ?h $ mfsidl㿘!D |`?<`# $@$`K` >``>!՘ ""` <@@2  s "`  ((Ā" ? *@, &`?2` 㿘\6@`<  @/`mfs_open not VBLK㿘  @ >!0"h  mfs_strategy: bad dev㿐 >p  Di R 2|>!" `2 0 0 T * @ H <  H < U0 @2@ 0 & $ֽ" 㿘 0 T * @ H <& 4 H <& 4 4 "& @ 0(& 0U    "`  `2  mfs_close: ref count %d > 1 mfs_close: dirty buffers mfs_close㿘 |`$`m` 2 $    m< T`>" h` >" T >"` "?>"{ $`E mfs_inactive: not inactive (mfs_buflist %p)㿘  | `" >"^!  \  㿘  | .$ | tag VT_MFS, pid %d, base %p, size %ld 㿘  | >"ꢐ"  mfs_badop called㿘>"0"x 㿘 `  | "@      @  ufs_bmaparray: invalid argumentsufs_bmaparry: indirect block not in cacheh`|` D>"` >"#`'@L@+@?"Ѐ "̐@ `/'̑.`@ $* &`" `` 4 @6 .`?@  (  ` `` '@@  Q0 '@* @ j `Rf a ]  Qʐ $ LRx  0"2`2$>"v#8,@ $ T 0@ $ 0>#p ,`T",  H̓*$ `"" `"  @: @6  H.`(@ ?  @  '@ `@@ & H ̶ ? '̀ "$Qn$,@`&?& 㿘 !D& @ ` A   `";  @0@`&@%@ ""@& "&& `   `@/̒@*@/(&$$  @0]`"@2& 㿘>!t>L ͉4>0"`>'"">L4 >0(" @22 㿘>#p>L 4 >0`* @ " @ @2 2  `d >L0 2  㿘>cp <    >L 4@ >0`* @`>L`2 @`@2 @ <  ٖ `2`>L 4>0@ *   & " " &    2   "" ffs_inactive: pushing active㿐 >#`|   T`>$"xg} :T 4# ` < 2 @g ? @v    ?; $   4  $   >L     '+`# +  + G'   eufs_reclaim: pushing active㿘># "  |V  >$#g! ||T  d3$  $`"`@ $ $``  mangled entryi_ffs_size too smallh'  ' '''' @?`< '| `  'ǰ } @    < ?  R \  @c@/ T bߒ  "܀` |`b̒ ܀`    . @j c8܀`    @|S` R| ' ̀``2  "  ?'!D L`?'`d  : `  2 `d`(`d $`h$ ऊ$`h:    I >-0 $`p`  `h@ " >-cx`  "``h `'䖂B*2 2 2`*  *`  ` "N `h :` ۤ `􀌡2 H?  H   >!Ȁ @ `>%`h@˔ ""@`h  S$`h`"' *  2   ?"@`$耢@` `h22? `h耦2 `h " "`h 2`h@*  2`h @ $  f $`l Nl$`p~` @$`h '` `hr` `d$`h NP̀`` `2O`   2G "C` >| 5``$`\B*2 2 2`*  *` $`h ` $`h! $`\%$`\@$`\a,c >`$``ܒ`$``(%~ ?@T̀`QԐ@Q 2 >-cx` "`   ?@`   ` >%`h@     `<`$` ̀```h >$`d̀`B >{ `h!$`\"$`\``l 2aC԰  @  `"`"` `| aU  `( @`.؀`) &{9 l``l 2e   ^ @`(%U ~ O #~ `l  z9`09܀`) &z.  !`0)``l 2`Ð @  ܀` }̒  @@Ԑ@P %s: bad dir ino %d at offset %d: %s bad dir㿘>( p `    F >(㟐 First bad Second bad 㿘` `""  >( ?  $@>(      >(ې  @  @ J  `@ @ J  2 ufs_makedirentry: missing name㿘`(2 >(Q!&`.``   @ < 2 ..ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2㿀 |   ?\`u ha" >("p L~>L```'*"@ *`@ *`' < 2~  h : 8 h  h\ : <h :`}쨒   <@ K\    ? \ @'"@耢 @4    ? "@ @  <@\ \@&   @'  : 6>(<"66>(7"4   <@h ϕ8J}  ($` $:  8`2 ` | ` :`}/``x2㿐 |h :`|U C " * h\"@  :`|B 0\ "r @ 2 `"  ``?&``&`  <@ `vJ `?6`}W &㿐`h`: | &"@  @ 4*```?&``&`  <@ PJJ ``}"6`` $``   2H (E     #\ #`#d#h#lv2 23 ܀ 2/   "+ (   `4" M  .2 `2M  "  M .2 "    @ D4Ő   checkpath: .. not a directory ``` '܀@?  `; @56 4'#\ #`#d#h#l ܔ  uӖ  $ 2! ?  2  @߀@ ]  ܰ  @ ѐ   2>*##܀ ]undefinedgroupuser㿘  $ `!D  @` $  " ( ( 2   @O (   㿘`@ڐ`U`$ ?# $" 6̤   (,&(&(  6   4 2  " $`$"  @N   `  $" 6n   (&(`6     %s: write failed, %s disk limit reached %s: warning, %s %s disk quota exceeded %s: write failed, %s %s disk quota exceeded for too long㿘.  $ (  `" $  2X E @2S E>+" >` Ӓ`C  $ C`"B  ( >L  !D.` ,@$ 8 @20 >+">+ >`ஒ`# >L  8@$   2 E @2 E>+# >+@> !`. `  4  E 㿘`@`U`$ ?# $" 6˳   4,&4&4  6   4 2  " $`$"  @?   `  $" 6}   4&4`6     %s: write failed, %s inode limit reached inode quota exceededinode quota exceeded for too long㿘.  $ 4 , `" 0  2X E @2S E>," >` `C  0 C`"B  4 >L  !D.` 4@$ < @20 >+">, >`̒`# >L  <@$   2 E @2 E>+# >,> !`. ߯`  4  E chkdquot: missing dquotmissing dquot㿘   !D  " < 2 $  >- ^ >-ގ ``H aD  @.''''r'ܰ | xt@  ` sCl [z_@c `< *`<`< &`< &$`@ 3`&N"&,&4@ 2` 8 4&, < 4&4@ `%@ $V " Z 2`m| [($2`2`2@ `< ?*`<@㿘aD. N `< *`<`   @  $ Zs . |$@"$Z $2` 2``2 @@3 " r . $ ?$  `< ?*`<   `<*@&`<㿐 !D@\    @_ p!D  @@Ԁ 6 ɬ     (' 4'   8' <'܀ " (@  $ @ >L.` ,@'耢 " 4@  0 @ >L.` 4@'& & $& (& ,& 0 $& 4 (& 8􀢀 & < ?# @6  4 0@? #ߒ @6  0 2  $ 2  , 2   2   6 ?# @6   @2` p!D T @Ԁ K6    2  $`" 0 (   >L.` ,@& 8 0` 4  쀢 >L.` 4@& <& ( $& 4 ?# @6  4 0@? #ߒ @6   @n2` 㿘>#p !D`    ` 5 `1`2 `@ &`$@`Y   ` `|,   $`"  ` " @^  $`|Yv`$2 2` 㿘>!t>7 >7"`>8"!!" dquotfree dquot isn'tp. >#p < >7' <>7c * @ %@>8! 2  * @`2    ` "` "  "@@Ґ' 2 >8! %>.>!t>.b* @>aܐ "a%>.>a܀  >8 @  @! @ &$! !>/͐"8' D ?@" >/ΐ"@` "` "  "@`"  "` "@`q@ $@" $@$ @u 4 $ $ 4 'Ж 'Ԣ ' ''.`  ?'''. r `  @   u   F 4 `"  "` "@@80' 0 2  $ 2   , 2   2  4   "' 8 2  <>L.` ,@$ 8 < 2 '>L.` 4@$ <'  2 㿘`` ?6`` @`?6`*   >8&`a`&` `"`"`dqsync: dquotdqsync: filep>`#p>0#` 2`\ `* @` >0# `q/` ` 6``   t۔7 `  6`''Ԑ` ' ''`*`  ?'''``* rO ` " ` z`?# @6` tdqflush: stray dquot㿘>7#>7`* @ &>7* @` >1| """@"2>7 ?: 㿐    &@㿘  >`#&2  `  " `  I``F   T^ > #/%!" 0/&$ 0'# %~  ^`TA㿘>ap  "ap 㿐!D\-`@ 2 ! ` &|` ``@"&Vܐ & F0 '4'@㿘  >cx* @  @ a 㿘  >@cx`* @   @ Q  |` "``D?2"`V" @X$  |`  2   `"` P=|`x`5"`>L"``>L`0"`@:`0`>L"`"`>L"``>L`0"`@:`0`>L"``"` 㿘  `!|@`>2"Г*` $$$$$$ <  f 2`   @"      ,` [k2 `| x  6# >L#  >L 0# @; 0 >L#  # >L#  >L 0# @; 0 >L#  #  #` #` 3` 3` #` #`  #`D ;` #`$ #`( #`, #`0 #`4 #`8 #`@ #`<`@(2`@L#`   :0(  ( ;`H`@#@ 0 ;`P㿘     |T ?2  ?2ܰ  ?2ذ  ?԰  D? L? ["Ѐ   @$`  @?c @? $` @ @$`` $` @ @ ` @  2 ?"  < w  @ o ?2@ ?"  $@ "c     < U   s J $?| ,?"3  < 2= `@ " $ X / n͖ ( $?" ,` $` ,?` $` $ ,s   ?#@   <  @㿘 | @ [ "+ "  @ b"  O 3 2 d"  < @o@ 4  $  b 2 @^ chown: lost quota㿘|`"``@@  `􀦀  2 ` `` @`$$`$@`($`(  ` ?  $ݠ ' $  $`$`\ 2/$`@`$̐$`$@`(Ő$`(l  2  U  1 ]   $ ' $  $`$`) ?@`$$`$@`($`(:  &  0$  >4֯!2`@` $` @ @` 74`   ` ;4`    㿘  `@ `| @2  | `     S0S{Syufs_link: no name㾈   $>5Q!@ 2 or @oj   l} oݒ0]|`#@oӒM ` @oɒC `` $```4` $` <@>L>L```'*"@ *`@ *`'< 2q[   Ƙ " ``?$``4` $`K  oڔRufs_whiteout: missing nameufs_whiteout: old format filesystemufs_whiteout: unknown op㾐  ` ``>60<*>609 @ $@ -0>`(2>6՝  @ 4'>6Ֆ 0 `/``T / _  @ >6| 0  `+ $`q X`$`ג ` ;$`ufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVrename: same filerename: lost dir entry㾀       ' '䀊$$2`>6'!`@   @n@RR$ "RnR}N䀢  | ` ߰ `| ` ِ@( `@ ϰ nQQRYRW ? %>6Ԑ! %NRm+ k |#@|  n  @ ` @  n <  :   k      k  n l @J .@        nk N$` Qې `| | $`4 $` <@>L7>L   '* "**' < 2o   n2\  k9  n'`2%`# HQ+   D @2>6"M 6 `| |2]`@>6" 0`.`#@ `` $```4` $`` <@"`Ð`< 2o.   ``?$``4` $`d  ݀`ې ` `?$``4` o$`̀`@>6@>6ӓ" @2`>6Ӌ"0""  `" `@"  <    B`    B @ < 2 `2 |`2 ``?$``$`?$`$  <@`2`?4`4    n]  PP5P2 ? %>6!L䀢  | |>6"HP{ N `>6"H` >S!  W" h@H  $`O"% O! OO` ?$ i  $4`O$0P-ufs_mkdir: no name`` `$`>9ҡ  |#@ ̠ a  m0 2  |`$`$` 2    " ` `mO04`̐ $` "`@$`4`` L5>L```'Г*"@ *`@ *`' <Д 2m  2u  @ >!>!@'`'`'` '`'`'`"''   #\lԚ  J̔ "`<`` @Y`$`Ȑ`HŔ   <@<"@ ̖ H 2 <b@&H < 2mA  " m  <@mȰ  t̔ 2`"@$4`$$``4``N$` N㿘  ||@ D " @O0NNK  D   @ B` % 2`7 B @2   @,   %>ʐ``?$``$`  ?$ `$  <@ `?4` 4    l >N^N\㿀     (@ ) @*`@@  |  <` < $  #\ #`  #d#h  e#lN&ufs_readdir: lost in space㿘   !@z $"    hb# 2Y  "U >: >:#   ""@,    @ D , 8 ,   " < "@ "  @ D #@ `@4 2 8 $  | @  2  @8& &㿘 | @@ 2  耢 2     gڔ 㿘  |  <ٔd㿘   |` <Δd㿘  |[ <ufs_strategy: spec㿘` \@? |>;:"0 T P@2 T   TjI "  T$ 4 0h" 0< l?2 T H@S <$ @ T? D $ D>#* @@ ; tag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %qd 㿘  |  >; G#8  >;V A#`   >; :# @ s. <>;/# 㿘 `|`">b>)*` @㿘 `|`">b<>)*` @㿘 R `A | x  ":>  ">L " >L 0"`B :0 "# ?>L " ">  ">L " >L 0"`B :0 " ?>L " ?">!`>)c* @@㿘 `|`">b>-\*` @㿘 `|`">b<>-\*` @㿘 R `A | x  ":>  ">L " >L 0"`B :0 "# ?>L " ">  ">L " >L 0"`B :0 " ?>L " ?">!`>-c\* @@`)><(||,@Thh `   `    ` $  ` "  `    㿐     |  #\A 8㿘> |#8`< @ 2`  `*$ @>=!*` 44$ `J  |& |>)c$ |$ * K$M$`$ ` 2`0 $`0>7"<`0" *` * " *  * " * <`0& ufs_makeinode: no name㾀$`|>=H"'<&  hܖ䰒 "  |$`  $` 2    " 4` `i.K.o>`c8 $` 2 @"@ $`4` <@"``$"` 2  ƒ "` ;4`@>L` $`>L   '* "**' < 2i4  2tꞘ 2@' J͐ & JŐ$``4``$`Jext2fs_alloc: missing credentialfile system full %s: write failed, file system is full 㿘' >>͂  `. "  @& : 2   (? $&@H>?&@"  &  : @ $  $  '>>@>>!=$ mode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocout of inodes %s: create/symlink failed, no inodes free 㿘 " | ` O< 2@U`(@?`(@. 2>@@!8 3   h0/ | `"  "  >>"@ Dd>>ې"p@  >@>L  ""  $  >>`@>>"ʹd 㿘& @ ? &,  & "  $     㿘`x  ` `t @  & `. <.` (@b?@    㿘  "f/ 6 @@6&@  .f@ f @В  ܲ`f@"  ext2fs_alloccgblk: cg=%d bno=%d fs=%s 㿐 &,.`  ?  &&+ 4 " 5_r  $`H&@2 &@Q &: N* &:@`/   $@@&2  $  2 " 6  N "* &N   N "* &N @ܔ - :`*N & :   >?"h+$>>"p * @.  &,?$ .`@` ?2` ,&4 $@.  cg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedfs = %s ext2fs_nodealloccg: block not in map㿐 f,.` ` | ` f?f+ 3q 4m  H`(@ &: L* &:@`6:  `("@`2`@    @@2 >@ ̥d>@< ؐ" L*  @ *  >@!̔d>@+!:*&  + .`  , <` f,?$` @ ?2,ff,@ ` 2`3`(@ bad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s blkfree: freeing free block㿐   $@&@ @ >@#X =>@ @p0: &,*@&?&+ 2˜ " $40* H@&@ `:`*L@ &@ :  @ >@# $>@ʧ# * *@,@  &, $ @`  2` ,&3sifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inode㿐   | @ 8?>A!id`(@Gf,-  @ `f?f+ 2U 308 H`(@4 L : 4 >A!8˨dLf 4 >A;!X   **@, `- f, $`@ ` 2` <  2,ff,@ `?2`,f2 start = %d, len = %d, fs = %s ext2fs_alloccg: map corruptedext2fs_mapsearch: block not in map㿘``$@=&2   `$@`2`"@@    @}@2 >A"Bd>Aِ#" N@*   *   >@!1d>AȐ#0uid %d on %s: %s 㿘>B `H$ext2fs_balloc: ufs_getlbns returned indirect blockH `'.  ` ? .``  ?1     % t % x3m '`* "TH@<" @T: $`   % '8 `4>BP  *   2'   % xĖ 3* H'<* @]"T1" @ >0 * "   %   Đ@?1  `H*  ;@ ` 2>  Z g m% x@ 2ݘ 'H<, @"T1j" @ U `* %@1`1 5,* `#0 6% t % x2 '`, "TH@ <" @``* %@1*&1r"1`?0 1010  2q ', " T '㿘 `  | "@      @  ext2fs_bmaparray: invalid argumentsext2fs_bmaparry: indirect block not in cacheh`|` D>C` >C0!`'@L@ @?"Ѐ "̐ `/'̑.`@ $* &`" `` 4 @6 .`?@  (  ` `` '@@  1+0 '@ * @ j `1 a ]  1 $ L1  0"2`2$>CǺ" ,@ $ T 0@ $ 0cZ>#p ,`3Z",  H̓*$ `"" `"  @: @6  H.`(@ ?  @  '@ `@@ & H ̶ ? '̀ "$0$,@`&?& 㿘qext2fs_inactive: pushing active㿐 >#  `|T` >D!G > : 2# ` < 2    ?bk >L```'*"@ *`@ *`'  $  b2$   >L     '+`# +  + bm' a    F 㿐  < 2] |   $>L $ >L 0$`B <0 >L $ ?$ 6 ?$ ?(@,*@  @$   @ *@ .? "/0$@ ?   H*`m   /| /,ext2fs_truncate: partial truncate of symlinkitrunc1itrunc2itrunc3` `s >L  |  'P*`" *  * 'T @    @@      >E] @ ?$ @2 P 8   26&@(3&E?&&@ˤ `    `L  $@M@MÐ`.L/2LP   au$ /$@&`    `LT 2$&@MN@ML H$@ L0`.rL&.L& :@ EB?@e&'&2 $'& 2@I$'਒& <: 'D? 8@ 6 " "@ ," ??P   a$ਐXc <_ < $ `(   ` `I/ ?'& 82@$ ?'&'@2@@  $?'@&H@i, 2'@H@`%yD ?߲ ,`" ?$`c&: ? X>E 0  ` "`4!(` X>E, @" %!0 2  0 >E , >E!8@$"@$ $ext2fs_indirtrunc: bad buffer size㿐'P'X    & @ o2`P@ & : .'`0" >#p `, "`,`0`< `8$`0 $$`T>Fǐ#0`n0t P-Xo `H & &u, &2`"@@ ٓ*`-3 2&2 ?@ ?&@, "? ? &. 2@@?@ P@,  ?&d. 2@`ǒ  X 0@ " 0-X ext2fs: e2dir->e2d_namlen㿘@ s!&@ .`.`  (`>G4"0`@ `  ? 6`h   |   &@? @@  a $"  ?? ? ?'Ж '''̦@ /'  [e ?$@   Ҡ `   .`   "@ "@@    @ E" %  <!  "     " "  |     2  8& &$mangled entryi_size too smallh   '` `@ |` '&'#@ `?̒ @|Z `'ؚ`e'Ԑ/ \ Z @@=/ @ ]Q ?ܔ "؀` @`Y ?ɔ؀`   @  ]+ @ @5؀`  @ ]`YR Ф|#@ ''쀦 2  @"`  ?'!D L? ' d`  @ܢ $ h @  $ h :`   ]P  ' h  '?@ @ H  "+  h :`]-  ?@?  H   >!Ȁ @֔ >H h? @% h@@D$ h"( *  2`  ?"$耢   h2`'2  h耥 2`  h "' " h `2  h`@  "n h @$ h '`@  h䀣` ' d$ h +y2@` @"<` "8` < ! `Y0   ?@ @ $ h$ \$ h @$ \@ڒ@  $ `ؒ`$ ``(%` [?@А@.Ӕ $ l +%$ p   ?@ >H h+(   ?@$ `$  @ h  $ dC @>`Xʒ ? h@$ \"@ $ \  l 2>а #@   "`"  `| >  `(#@.Ԁ`) @&`X m  l 2f   _#@``(%`V  [YP @$ [P l  `W0:؀`* @'`Wx !>E0)  l 2> #@  ؀` @ [#@`@А@- rec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentry㿘 |`  ` &>J#H`>J#h` ?@ >J # >J#@@>J#Ȁ` >J@` `#>K ( direnter: missing nameext2fs_direnter: newblkext2fs_direnter: frag sizeext2fs_direnter: compact1ext2fs_direnter: compact2 %u %uext2fs_direnter: compact2` h&>Ka! `|'7\` 4 ?h? >KH! :?7''''Ȑ '''' W˔ `aD@`H >K,!8 m?@@$`b$h :`Z V   ?\ @"@Ā @4    " @ ܼ\@&  :7>K!X6 7>K!xF>Kݐ!4 ܝ[  $``@  :`   Z 㿐 | \ h :`Z& "@ h"@  :`Z  r@ 2[O `$ 㿐 h  :`  Y  `[6" `$ `  9    #\ #`#d#h#lTM 20 ܀ 2,  "( "`4 L .2 `" L .2 "   @ D  @8Đ  checkpath: .. not a directory checkpath``` '܀@?  `; @56 4'#\ #`#d#h#l ܔ  S  $ 2! ?  2  @߀@ <  ܰ  @ ѐ   2>L>">LՐ" ;%s: modeext2fs_read%s: short symlink%s: type %d㿀  ` |>M (>M`8@` @@ 2` ` 2` >M H>M`8 (` >M `>M`8   @; `B?  2`` (`0x v  `b'`` @ b X@W  @`   '` $*<2@(`*@@ ? '?#\#`&]  ?&- % @$6HH7  '\` ' "'R < @` &`ext2fs_write%s: nonsync dir write%s: type㿈  `|>M (>McH`@ "   >M!#p !>M#p <ࠀ    "װ 2 >M#X>McH>McH 0   8 @ @)B? 2`@@ `@ ` ` B   6 k  6  X@  #* $ @ƚ ?<  B   @@D$@D@"@@& Ha%  &R &쀦  "  $ 2       34(XK' $@ b <>L     '+`# +  + XU'㿐  |  @yf "   f$ۖ? &  f H @  " "@Disk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlap㿐>" T> D *`" * @ <@: <?`<@"5`|?@20`| ",`|  V 2$`|` @2`| "`| 4`|: $`|>O<Ր 8>O H ;  ՘?>Ol x@ ɠ |㿐!D>`@ 2 % ` &|`  ` ``@"&9V& F0 '4'@ext2fs_mountroot: can't setup bdevvp'sext2fsroot_device㿐>>">-p8ch  >O>!!>28 8 >O">O">Ob6b 3 8@   6H"h 0">2X"@"`X 2"X">2"a\!D  Y`  Ӓ$@֒ D6&@Y 0 %s: file system not clean; please fsck(8)  Δ l@<"l&$D N 2"<  @ @$   :   6:@  ΐ .<@0@ N .<@+   `Q !R  Up0 Ul: .6: 6: .@  2&$@= @&(&&2&, } @ " D8t  >"Ԁ@& 8j   "<< !!`Qi R/ 800N U<@@2@  8~ 8y03!D ճ"@$"@ ׳ Z Yգ Z@"@ N  : .>L &0>P 7@J  ext2fs_reload: dirty1Wrong magic number: %x (expected %x for ext2 fs)or wrong revision number: %x (expected %x for ext2 fs)wrong block size: %d (expected <=2 for ext2 fs) ext2fs_reload: dirty2㿈<  D` Pʐ  >'  T} ">Qu 0 `h ?R8 " (:  $@  $?"V찒  H; 8#S@ >Q L  >Q H>Q  L 0 `( D>Q #} 7M0` $ "  ?@  $ $$* $` ?: $<?2` :@$ $ (2`@$$ %$($* ?!찒 h`H@s, ֳ #, &"Q >Nc$8 @`6c   =p "|>QÐ ( ?@,*@ @$? @!*@ o $@?   H* c "% 62  or wrong revision number: %x (expected %x for ext2 fs) wrong block size: %d (expected <2 for ext2 fs) 㿈`D ?:̐ 9[ >2 8@ `O  <  SN `<   ?P" ِ `h Q'  $!)2`D H; 8#S@ >Q L >Q H>R! L | O`D `!P>Rs!X O ܔ @8!P&0 Ք % H$":'  ,: 2 4:4: , "  ?@Đ $ $$* $` ?: $<?2` :@$ $ (2`@$$ $(@@   %$,$* ? 찒 *`H@$, d !ܦ '&aD` &`d &`h <&`@%% % 2 % % $ % (`D " , `D쀢`" !   Of   ג Ԓ &aD㿘6` `@6 1aD` L& 2`@͒  2 ` : 2` 4 :@ ` D" L&  `  ?O.5`&,   $aD㿘!D6J ``N_` @P5 `Rext2fs_statfs㿘!D ; 8#S@"6@>S# &&(& `@x & &`&&` "@ &`  &` " &`&` D @ &`  `L Zԣ6@ `ԟ Z`<  @` fs = %s update: rofs mod㿘!D L " L"  >T >T (  5` 2  $ @ ' |` ` 0 " `"@`4(   O 2 Q4 2 `"L <@2 `MO 2 QfL @ 2inode㿐!Dϩ &  >-T2 !}& H @l!`< >T 1 " |$` $` $`$`$`tϧ$`x "4 ϐ0[(@,*@V @$?  @*@ "$4 @;&@=`  H* Ӻ` 1$`>%`d> E "3 &3$` `䀢 >@>L  ""$`` < ` $` &㿘!D`  2 Ff@5`(   FF | 2@"` "`㿘  $    HW$`㿘 `  )`$*    c @, ?`H'`n &`  2㿘  >cx* @  @ 㿘  >@cx`* @   @ޔ  |` "``D?2"`35" @5D$  | "     ext2fs_access: not locked㿘  `|Lo  !>U#86P"  "     , 8R2 |` "`>L"``>L`0"`@:`0`>L"``"``"`"`2`2`"`" `"D` :`"$"(`","0`"4"8`0"@`2"@`"<@(2@L" `*  :H@"`0 :P㿘     |T ?2  ?2  ?2  ?  D? L? W"@ 2MW @MO  `JA M0A| #@M1  0M) `4  $ >L '+ " * *'O1  b " `  ?4 `$ `+  M0ːext2fs_rename: no nameext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: EXDEVrename: same filerename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirX  ''Ԁ$``$2`>Xb  @   @АLЀ0ǐ0_Ѐ "0YL03Ԁ   | 0  | ܐЀ@( `@ Ұ L̒070500` ? %`>X  %@,Ki`IE |#@`|  L  0    L <  :  I  Ѐ   Iޒ Ԓ Lʰ r` `J .`      Ԓ L T$ 0Т  | | @ 4 $>L ؘ   'ؙ+`# +  + M'ܰ Ԓ LY` I  Lx 2%# E`/|А A A@2>XX В+ٔ 3Т  | |`29` @>XA  #@ `4 ؔ    M$  ` ؔ    4  Mw$ `k @>X@>X `@2 >X!""`  `" ` @"`` ɰ `<    q  B`  8 E `   ?4 `$ .א`?4`?4`*  ">X!   L `В`$`.` ? %`>X +Ԁ  | `|>X!8/ @S >X!8><     4 `$ Ԅ #\#`   #d#hFT#l %  ?  " ' >XͩX  Ԅ #\#`   #d#hF1#l 2 ```?4``$`` ?$` `.E`"#.@`.9`.7  ?$`GZ  4`."$0.ext2fs_mkdir: no nameext2fs_mkdir: blksizeX `$>Z#@ |`#@ Ԥ a ` K 2``  |4`4 $4 " @4>L    'ؙ+`# +  + L 'ܐ ` `@ 4` L$` H>"@"@ ' ' ' ' '''`' |`  f 7Ԙ#\ #`` #d#h  Ew#l 2`  |!D` f H@$$>Z|#X $ "``?4``$` " 4Ԓ`-x$`"@`ɒ -o㿘   |`| -ǐ-a:  / B  ΐ 2 & B #  0z `  4 $ -<4    KUw `-)-'㿀     (@ ' @`@@   | ̻  $  $  #\ #`  #d#h  D#l,㿘 | @@ 2   2     G3 㿐     |   #\# 8㿘> |8`< 2 $ @>`0#p>\ *` qqqqqqqqq$ `+ "`C I |& |>)c$ |,$ .$``$ ` 2`0 $`0>7"<`0" *` * " *  * " * <`0& ext2fs_makeinode: no name㿈$`|>\I!'<@& @ Iݖ찒  W|4   4 4 > c8 $  @2 @"@  d4       ;4 >L     '+`# +  + Jc' 2 2@] ,  &U + 4 `$ +㿐  ` 3N`?>L   '*`" *  * '    J$`?ext2fs_reclaim: pushing active㿘>#   T  >] X/ |c " |,&  |  H$ |  N>B  >2 00 dev_pager_alloc calleddev_pager_setup: bad object㿘 >>]y!(ؓ4 `*` *   n>!xi>!e>-#L b @ >2`,* 2 >[!?P`h>B!@08 ;  $ >  % 2&  $4 >"x&  & & & &&@  &@# @#j @0    % $>B& &  " $ @#W  >]!@ 㿘`"  "`>B"! "@  `"`$ "@@Ӑ 2K %H $dev_pager_getpage: cannot handle multiple pagesdev_pager_getpage: no map functiondev_pager_getpage: map function returns error㿘>>]# b@* `* `   , >!x>^>!2 >^ ( @G?>^ P@;"  $   " " @)!@'?`"# @` 6`"?#ߐ @6`"7>[!@ 8& dev_pager_putpage called㿘 >^ R!؁ 㿘#>2`0  %!>[! h  h@ (  `0&& ""` (>2 0` 0 "` " "@#6 "& $ 6 dev_pager_putfake: bad page㿘 "!2&>^ ">2 0 &  "@" >> 0>@  >0 @" >% HH >@   >H " ""@`   >[#> >,"#8 @&"#>b>[>,"b>[>[2 &* b0 @4 >>6 ("" ( #" *( *"  swap_pager_alloc: bad object㿘 >@"@.  @! e>_ 耠  $`?R  X  %J %>->6#Lcc@ ` * @($@ @$@6` $` @<?$`*  %*   $`  % $* `@{*`$`4` 4`&>@b`& `""`@@! @!{ & 4`&& & >"& &  & & swpgdealloc㿘 ` `"  "`>@"" "` ?4`H /* %T`  !>_ `"ؖ4` T` 2H 0@7 ` ` '>2" ` `` A %> %; $swap_pager_getpage: page is already faulting㿘 6 >`*@`"   02`" @  7#*@`" 2`"㿘 @ސ   @?@b 㿘  *` @`  @ *`  @>2`,2    :   swap_pager_cluster: bad offset㿘  >"*` 4@&@ >`C!@ 8 &&swpgiobufswpg_io: lost spcswpg_io: bad free spcswpgio㿘@ `* `,`@ B 6T @U*  1>2 ,5:@`"@  @K >@" 24 H /* % @9H 0  >2"  $ 6@,  "  H /* %>.!$   ' 3>` bp 0 $ 0 $ >.! $`$" $H 0' &`0>7!&`,#>-&`H5 ch@ (j&`Tch&`\`@ 2>[`D &`D>[! h@ `0@,&`<&`` h@&`dH /* % ch 6 `4  "`4H 0?,>2 ,< 5 , @E, @& $  =>@"`">`O" `"`"" " >`=""" """">b"`0&`X`@&`0H /* % ">%`H`"`""`H 0E  O H /* %`0"  !>` "% `0" ?6 `0?ο`0" @&`0>.! $2 &`$$ $`\  .ܐ 0 @ 0 * " 0 >8`"`$`€5`"H 0@+h%s: clean of page %lx failed swap_pager_clean㿘/>%H?#H /* %H` ` " @@``"`%`@"@`2`H 0 `Q ``0 ?#߀>2 ,`,@+Q@`  >b X>b $֒`x "  4 " " $>8`€4 " "   4 " @4 "(`׀?4*    @?*@4`@*`$`$@>@" $` "@" swap_pager_iodone: bp not found㿘H /* %>% H   2 2>b" ?`" 0(`"" `?2``  ?2`?ο 0" @& 0>.! $& $$ $ \ - 0 @" >- 0 * " 0>-#pH 0swap_pager_remove: sw_cnt < 0㿘 @:^     *` @ @N @>2`,2@6@2  *?@ ,`@2' "$ ` "`@2@?* @@k*@ @`&@>2" `&```@ ߀ " & >cm 㿘   A *` @A  7@ՒƯ>[a@ΐ?+@>2 ,@$4@?*@ , 2* ? ـ" ?2`    2  vm_object_paging_beginmFltbsy2fVfault1vm_fault: active, inactive or !busy after main loop%s: active or inactive before copy object handlingvm_faultmCpybsy2fCopyvm_fault: active or inactive before retrying lookupvm_fault: active or inactive before pmap_enter`'D>[a` "`#\#`#dD@찒 䀢   " 7"@ >c#2 % #?#?#>[!@" " (`" @ 4`"n5`? ?4 *     4 ="  4" 4"0@#`?2`*   ` 2` D@>cH#(`n%H0 "`"@`"``"`>N"#l`@"@`"?# @4`"L?%`%L`" "`"@`"``"`>K""`@"@`"?# @4`"?%`">cp 4`">7!Ѐ@")`"`쀢  䀢 2B (@"7 2< ( ?4 *     4 "  4" 4"@"~`?2`*   ` 2` D@o@e>c@% #8耢 䀢 D@Z 8 %8 (@'h   @!@`%@?`"a`$ >8`@4`">>7cp!Ѐ@"`"`ct "ct C`"  4`" 4`"F@" ?4 *     4 6"  4" 4")@"`?2`*   ` 2` D@@. `"  4`" 4`"@!ِ " 4 0 +@  ?4 *  2   4 @" `>cp %`>7!Ѐ?`"! @%4`"cp  "cp " ?4 *  2   4   7"@>c#X4 `"  ">cې#HY P@"Ē?"a @"(4">7cL`$€ ?`"# @` 4`"?#ߐ @4`" ?4 *     @?*@4 x>[a`$ "`$ ?4 *     @?*@4 b@{  7"@>c#4 `" ?'`4`"`" >c#>cxc $ 0 `" ?''`4`$" @ ]@ [ " V 6 "l `?`"?# @` 4`"?#ߐ @4`"@!?$ ?4 *     @?*@4 $"?# @` 4"?#ߐ @4"@ Ɛ?2*    @?*@2ې D@>ck#0u  @ > 2U(`"?# @` 4`"?#ߐ @4`"@!?$ ?4 *     @?*@4 $"?# @` 4"?#ߐ @4"@ n?2*    @?*@2 D@]@S>c@"#耢 6D@N ,(@%z@ 0@   "?# @` 6 "?#ߐ @6 "U@ ,@) ? "# @` 6 "?#ߐ @6 "A@  2$@!]? "! @6 ">7cL$€ ? "c @! 6 "? "# @` 6 "?#ߐ @6 "?$?`"# @4`"`" >c?##\#`#dD?@ذ L?`"# @` 4`"?#ߐ @4`"@ ͐ ?4 *     @?*@4 ݐ$"?# @` 4"?#ߐ @4"̐@?2*    @?*@2 D@@0@ 쀢@N`"?# @` 4`"?#ߐ @4`"@ x ?4 *     @?*@4 $"?# @` 4"?#ߐ @4"w@N?2*    @?*@2c D@>@4ԐԒ `" ' '耊 ?`"# @4`"`" "`$>dv D> a@ 䀢 @f `"@`"@ `"?# @` 4`"?#ߐ @4`" ?4 *     @?*@4 $"?# @` 4"?#ߐ @4"@Ր?2*    @?*@2 D@@ 㿘@@t >[! ?  " h @0  unwire: page not in pmap㿘@#'>2>[!>)c€ 2>hא#@r[ @P>2a" *` * @ @h@@ >)@sі fVm_copyvm_fault_copy_wired: page missing㿘  @"@& &7,'>i@ے @ h@@ >i x@z> Ж$@ @-?"# @` 6"?#ߐ @6"?>[!  ΢@㿘  >-#L>$: @ @ "@ H >bԀ` >B  > D* @* `?㿘  >#p>-#L :`  @   `?㿘>#p>-#L :`  @ 㿘>#p>-#L :`  @{ 㿘 @ `&`   Ȁ "ͣ@ >$"@e cP&`b &`$ $!0@ c  H @1  :`0  88  @:`  8(>[ >2,*@   : P㿘>$  "@1@ H /* .N -  @E ( & (H 0& p>[a`( "`(schedulerfLowmem㿘 >K#  J- 2( 2ptJҐ *`" $ 2J-` >2>7!>j  ښ  ,>[a2 @ Κ Ho o>j@ H o@ 㿘 >K#/"-> (  2$  2  L -   p( &  4  t耢@ @@%(    2 (>[>-#L>2`,* 2   " @㿘>$  "@k@  @q1H /* . ( ?& (N -  @DH 0& p>[a`, "`,vm_mem_init: WARN: MD code did not set page size 㿐>2 , 2>j+#@@E@@@?@@^@ 㿐>- , cL'@   @ޘ.@  vm_map_lock: failed to get lockfKmwire㿐   >-L)>@ #pk.@ ">k    @&  #pj 9 3>2 b@@ b@ #pjؔ'>k"@ @"@3?`"# @6`">[!*" @@@ 㿘>-#L@:` @ @ kmem_suballoc: bad status return of %d. kmem_suballockmem_suballoc: cannot create submapkmem_suballoc: unable to change range to submap㿘 >-L , &@ . @0  "@>kV">k"&@_@@ 2@>kސ"@͖ >kՐ#kern_malloc_alloc: map != {kmem,mb}_mapkmem_malloc: entry not found or misaligned㿐>-#t > !\ >l    >-L'> ,@+pj' ">k    @&  ?p>-#t ,#>b@&" b@ߘ  pi  @@g ,>[!@ ?" `h& @[@2`h@̔@ >p i˔ E "# @2"`h @"  >l @>l4 " >l/ 8 "4'>%> >[!@ $ И @@`h*ℐ >p i @ ΐmKmwait㿐 >-#L#>@.@ cpiv ">k    @&  0 ,"  cpi\  e  cpiR >le#0Ր  @+ >p iB 㿘  #>cpi7 ">k  >-cL& ; @ @ @! x cpi 㿘> !>@ ` #>cpi ">$>k ""   > " @ cph 㿘!>B!>-@c` !>G"#Đ"(`"(>7"#H>-#` 8@E5>"!x$ ` 8$ 㿘1>! ) '>က 2$ >%%>[ \h*`" * ?@ >$b&!@湒>!"a|h@$> "a&!  p @V ̐@Z @\ؐ& & āvm_map_lock: failed to get lock㿘 Đ? & Đ >p hz " ,>m#  0@i& @] r] vm_map_create: out of maps㿘>-#t  >GcĀ 2 (>mؐ#"cĐ  p @&thrd_sleep㿘 $& $& (& \& ` & h& d& ,& 0& |& x& p& >n  8 g & l& tvm_map_entry_create: allocated %d new entries. vm_map_entry_create: couldn't alloc pageable map entryvm_map_entry_create: out of map entries for kernel㿘>!x TH /* ')>! B %>=>2"@ 6>[!`h@C 8>n Ò@[? "# @` 4 "?#ߐ @4 "> !> !Ж  $@  `h! $? %!%>$ 8@A H 0| >ጀ > a"ጐ?("a 8 o !>n H /* '>7H    >ax"H?"ax >n!H 0 |  >!>""! ᐅH(>7cH>"x"cH xH  h" h㿘   h? & h @`!>#pg2 l ,  0@&& @\C #pg$ q 㿐`,*} `0 u @t o  `$@`` e`6`$3 /`d +  '  # 0  (  ,  4     ' @&    ``'  $``/$ ΐ"" """"" "$`d  "0 "(","4`\ $`\" ""`" ``" @`x$`` @:$`x p$"@  "  ( ( @  " "p2  ""p㿐 ,@ *  0@@   x $2    0Ĕ   0 $@ : @ " & p` :& p  & 㿘  %>pf7 " >m#` $   pf!   >p f 㿘 @"`"`"` " `"`"`"`"` " `$"$`("(`,",`0"0`4"4" ``&@&`&` \ & \@"@ ""`"` ` 0@ 㿘ʐ@"`"`"` " `"`"`"`"` " `$"$`("(`,",`0"0`4"4&` "`& " \ & \"`""`"` ` D0@ 㿐 >p e " >m# , @ &   08@8ϔ  `@ U '` ` `  `  `  ` 2  "` "`"`  >p e2 㿐 >p e) " >m# , @ &   08@8x `@ >p e   ' $@"`:` 2 `, `@ 2` $@}>B!`y `  `(&`, &`(&`(`( "a`` N  `>pd  "`>m@#` "```` `` $`"@ ( @:$ `  `` "   " `(  @ ` $@'  `>pd{ `` `   @` $@2` >p d`  㿐4M  H >p dO " >mА# , @ &   08@8   @ # $  $"    T$ 0 2  >p d  㿐   #>cpd" >m# , @ &   08@8R   cpc  J @Δ $"  :  4   @:    "   {   2   @&  $ :   4? $ 4  ? 2   ?&  $Z :W 4 2   2  $ "   (    @3"  $ $    @ f"@$ $  @_  4  @$ 4     $    4?$ 4 2  >p cB b  2 > !@ >p      >p @& c( @ 4? 2    "  4 ?$ 4  $2 > !@2  >p c " >m# & ?&  >p b ߖ   >p b  㿐  #>cpb֔  ,@* 08@8- 2 0cp>p b  >p b z  >p b r `:$ $`  ` (`4` "  @  >p b V `4 Ӑ ``*``:B +>`&@` @ ` " ` cp blΔ` "*`cp ` `$ bX@ `@ $  @ `` IJ@ >p b;  㿘`` Ґ&`4㿘`4  \?& \`@"@@`"`` ` `"@ " & `` ` `@ 8`㿐h    @& p x  ; $7& x8     4  >2"@>"@2  d $@@  2  $@ Δ@ @WD $2  㿘  #>cpa " >m)# , @ &   08@8 cpa 㿐 @  $@" `@*  `( 2 ` @ ` vm_map_copy_entry: copying over permanent data! 㿐 p l " 4  24>t4#4  `d "@@V  4 " @ @@ 4 C$ 2 d  h `?  >B (!   " @ @  #@ @ 7  &$  &$&$& & @ @ @f" 0㿈'P'T\P' @I @ >p `͔ "  >mN# ` !>#p` " >m@# ` #p `&` " >m3# &  !>#p` "`>m%#   #p `& "`>m# &``d ! d  `    Ҹ   R T͔ T`HT:`d y` r` ` "   g  `" `  \  2 ` ` 2 ` Q  ``"   `  @&`` "( ``'@ >p_ >mw#&  ǘ >p_ޔ #\` @& #\ @  ?& 2 ` ?&` ` x `du dql  d   TP@@U.@TP@` !>#p_ @  #p_ vm_map_fork: encountered a submapvm_map_fork: copy in share_map region failed 㿐 >p _o " ,>m# 0  |&  ̒  $ (@Ť` "`0>vِ# r4` 2`` 5 ``  D$ d@"`" `" ` " `" `" `" `" ` " `$" $`(" (`," ,`0" 0" 4 \ $`$ \" $`"  "` "@ $``$`$`@$`$ `$ ` $ `$ `$ `$ `$ ` $ `$$ $`($ (`,$ ,`0 $ 0$ 4\$ $\$$ $ "` "` ` @d" G`@$`$ `$ ` $ `$ `$ `$ `$ ` $ `$$ $`($ (`,$ ,`0$ 0$ 4$ $ \$ $\$$ $  "  "` `  ` #\Ö"  >v#8`B` $@2@`    `>p^$`㿐'T``>p ^ `p`$ & @  @* ה `>pE &     >&pm  ( `>p ^S   4@ ' ( `?! '>p    &@ ^5 2 p^) ` p^$ T  $  '>p^     @Ĕ" $ $ p^     2   '>p]  n` p] i`  @ݐ"@$ $  p]   % '@ T#@h `?\"d "㿘`   `>p]Ð  >p ] 㿐 >p ] ">m5# & ` $\  2Y> d T  P  L   H   D 0 0@? ( (@: , ,@5 4 4@0   @+ $ $@&  @! " @@   x "& x \& p?& \`@"@`"` " @v`ڐ >p ]A 㿘> @F%s map %p: pmap=%p, ref=%d, nentries=%d, version=%d TaskSharemap entry %p: start=%p, end=%p, donate_copynonecopyshareprot=%x/%x/%s, wired, share=%p, offset=%p object=%p, offset=%p, copy (%s)neededdone 㿐 d >y h>y >y  h \#\ YZ#``>> ( }( $ (  r"(>"ؤ  >y!H>y ` Y> d "  0 (*  ,>yƀ! 4 >yƀ!     >y ƀ!@ `(` " ` @"7 `( W$`(,`(>y ƀ!0  >y $ ">y>y!X!`ƀ>yƀ!h@" ` 2` @"  `( @ $`(`(?$`( >`(?"`(㿘>L @[  >7>%@ >7>"aГ2  t: @~ 㿘>K#  J- &  2  Ѐ 8t 82J- >",@"("@@*` 4 & `=#`'(   >%   -0 -0("  @ 0Ę z㿘@֔ 0>2!@ ?# 22>K#k>z"X>"("2aJ- 7* ll( "t Ѐ 8t  6 : t  6 :t  6 t:8 ( "  6 6 J- "(  ( $  2 2`" ` 2` @  2 "  6 2(>2!@=>-#L>2 ,   2 @&  &  "    2 @&  &  $  $ 2 @&  & $ "   ( 2 @&  & (2>[!& , - -(`` `@>-#L`' % :`@  "@  '@>@@ 3p     *'3P?+ @ 2T X U  (`@  `D@/ "`@7  C @   ` 07 2 `@ 2`  2` 0'']   @` 0`     #\#`@ &㿐@`?F` C  @>-#L $ *  7    !>#pZb Ĕ #pZX `  "@  p `" `` 0 `  0    㿘@>-#L` $   >@   e    ( 㿘@>-#L`` @ #@    @ Ș   0   㿘@>-#L` # `  ~@   0    - -㿘@>-#L `$@@ * >2  ,>["6@ >#@ @(  #j     㿘@>-#L `$@@ * :  i     vm_map_lock: failed to get lockh\ `/ >-#L@ 2* `2@@  * &@@  @@?  @  D  @    @@g@ #\@ (g@ր @ `#\@@  #\@ E@  @+  >p X " >|x#H  & @w  @c. @    > @  >p XȔ @q @L ^ '#\ @6 `@ِjY ` 4`@ #\?`# @4`' @#\#`#d@r@@: (  @ A@ @ 5@  `  @@ @@ "   ݰ 0      㿘>O" P P" >2"!@!@" >B"!>["">Z"!X >@""" `` >2>c""@>!> """> ,@q@ @㿘 L `e @"@"`"` "`"` "` 2`2`"`$"`("`,"`0"`4"`@"`>2@"`  ` >Bᰄ >[>2,d2  d  " 㿘 :'D>O P#>.D`? "` .`@ * D &@>DD  D` "`8 "`< "D 8& b`@b$b@{,@`(D 0@ D 'Dvmterm㿘   `6 # !>~  "  @S6    0 @  $"$ $  2    @@ ` >[!@  \ $ \` ( " @ & `"  "` >2"!D  "@>Bᰒ a7"ᰁvcleanvm_object_paging_begin%s: pager_put error vm_object_page_clean㿘     ( 2 @ ( ?   @ Ƙ  @  ( 2 ð   !>#    @  @SU6    >[!?#@"  " * :  "!2   >/c0@ $ ? "# @4 "  " 4>7 "  `"  "`>K"" "@ "?# @4 "` ?$` `"  "`>N"#l "@ "?# @4 "`?$`>7cL $€  " 2K  4 "  7"@2> H6  (@ ֔  > `>j`x "  4 " ?6 *     @ ?*@6 x 2 ""  "@ "@= "   M4 "?#ߐ @4 "xF  \@㿘   "  @ 2 "vm_object_cache_trim: I'm sooo confused.㿘>.>p@'>O)>  P@ ( h@  ap@P㿘  !>7 @8  :  #L $€  " 6 "  2 㿘  !>7 @8  : #L $€   2 vm_object_copy: copy/shadow inconsistency㿘 2 (&e' "     `& @`@8 `:``" 2`"``2`&' E'@@ $``  `( ` "`&0'  $``0>`4 > !ؐ @'@#&4& $` `8 `:``" 2`"``2`&&@''@vm_object_shadow: attempt to shadow null objectvm_object_shadow: no object for shadowing㿘 >ʐ#4 2>#@ ?$ @&4&@&" (" ,㿘!>@"@ * `!>O P>.` (2@    8` <"`<" < 8"∐?"  & `2` 㿘  @   !, >@ ]H "  `6 " "  "@$ 㿘@ѧ * >@b   (2`"`""@ ^ !02vm_object_cache_clear: I'm sooo confused.㿘>O P %> (,H@ ' `P 㿘`(  @ u  @  @ X$`(vpagewvm_object_overlay: busy or fake page in backing_objectfVmcollapsevm_object_overlay: pager returned %dvm_object_overlay: backing_object->pager remainsvm_object_overlay: we collapsed a copy-object!vm_object_overlay: backing_object still referenced㿐 0 4   ( `4    @ :   " % #>   c04 Ps     "  E'>[!?#  """@>#8@ @@z 2  ( ( ""@ T " ( (  hI@ @   h=@ `" 2`"@ ' (  ( " & ( ,& ,$ (>@#p  >[!?#?# (@   u$@% f ( "@  ]@\ '`" 2`"  7"@2>  H4 8 $8  (@   ?4 *   `  @`?*@4 u````"  2`" 2`"u @U >#ْ@@$@'?"! @ @ 2" 2"u  h h (` ( " 0@ 9 2 (@ ($ ( ( " 0>#@Ɛ 4 4  0` & 4`$ " >#  >> b  "b ?# @4 㿘 0 J 4`""(` " :`@j " ( """ ` ( "K @ @ "F ``2`( "/0@ƒ @ '>[!@ $@ @A " ( """ h ( "" @  2 h  h(@@ @ ߀@0@I 44 & 4$"$$>b  "b㿘@ vm_object_collapse: collapsing unreferenced object㿘`2&@># 9 7 0 3  . 0 "  $ &   $ ># V`    0 &@n`" 0㿘  #>7 @  :  $cL€ @U 2 㿘`2" "   4  ( 2  0 2  $   @Ȕ @8&  㿘> @>Object 0x%p: size=0x%lx, res=%d, ref=%d, pager=%p+0x%lx, shadow=(%p)+0x%lx shadowers=(%s0x%p, ) cache: next=0x%p, prev=0x%p memory:= ...,(off=0x%lx,page=0x%lx)㿘 [ > ap N( ( , 0> 4ƀ!>ƀ!> @  !%>#>ƀ D a>ƀ! 8> <ƀ!`1>`(  !"`(  >Mb 2 >>ƀ"(>Mb0 ƀ"8 > $ƀ"@    >ƀ"(>`(?"`( 0 !`  D" H H H H D `"" 0`"``@" D`@ D H"`@`@" H" 0vm_set_page_size: page size not a power of two㿘>[!`h 2`h"`h`h>- "cL> h>2 " , `, "`,* `,vm_page_bootstrap: can't get first pagevm_page_bootstrap: bad i = 0x%x㿐> "!>%" > "#@#@" >K"""" >N"#h#h" !>->-9#La *@@$#`>B"a@˒#`!># >)@3 @  $# c *  "c !># >)?"@v* >@# "b"  2">.@3"!| >[!@γ@ (!>%$ \* @@\*`#>2 \$`*@ @X*` \  7o" `"`$ `(@3 >! @3>2"a >2*@  *` "2 "" 2 @" $@3 >@3>2a>%`\" >2>!H !>-#L> :` #! "&&@>W"!Tvm_bootstrap_steal_memory㿐!>!%>'>-L .! @3-!L : $! @ $!L$! * '> >[!@39 2> >#!Ж @ h vm_page_insert: already inserted㿘 " @"& >!& >2>@ ,>)c6@ * @H /* '& `& `" "`H 0 & `& `" &` " @6 "`  &` vm_page_remove: page is faulting㿘 "@`@>E";>2  ,>@2 >)c ⨑* @H /* '  ` "` "  "H 0  `"  "` "`  "@ ` ?"` ? "# @6 " >2,>@"2>)(H(@ 2 2 H 2H 㿘 >vm_page_alloc㿘H /* '>[!>#@> #@>2" >">#p>H"@ 2H 0 < 2> @`"  "`> "#D "@>[a`x?"`xH 0 "6 " 6 & 6 >[!xt@ >-p@ @>-q+#p㿘  "  `"  "`>K"" "@ "?# @6 ">[a`?"` " " "`"  "`>N"#l "@ "?# @6 ">[a`?"` "aH /* '@6 "&> c@`& `""`>[a`x "`xH 0  2<  ""   >K   >[ ? "2 " ">["   >N l  >[ ? "2 ">[| | 2  2 (>K""  >[  "2 "| |㿘 "  `"  "`>K"" "@ "?# @6 ">[a`?"`*&>Nch`& `""` " 6 ">[a` "`>B`@ $>/c0@ $ ? "# @6 " "`?# @`6 "vm_page_activate: already active㿘 " " `"  "`>N"#l "@ "?# @6 ">[a`?"`  " "&>.!>Kb`& `""` " 6 ">[a` "`㿘?c "><!  $6 " 㿘?`"# @>O 6`"`$€ $vm_page_alloc_memory: alignment must be power of 2vm_page_alloc_memory: boundary must be power of 2㿐'L>#P?">[>ِ#!쀦*>-cL @ʮ* @J    H /* '> #@ s'>[!+>2Lk@0q &@0l>2a" h@ʁ>%`\ X$, * `"@$@0Q `@?h@ @ `(æ- >2> #@>[!> , *  ` "` "@`x?#`x 2""2 "`"`"'`( !T #!T H 0㿈'' #\#`G >$" "v`!> >[!>2b > !`$ !П@ h@`%s:%d -- Already 0! ../../../../vm/vm_page.c㿘H /* '- > #@>[!#> `"`& "@2"" " "$ x $xaT  ?>#H>c`.'Q$aT2H 0pageout daemon has stalled 㿘>#p>H"@ >  x>!X: >-nn#p>[!>WaT Hl㿘>[! P $ PH /* ' xH 0  p>N+@Q>N#h @J>[H /* 'xH 0 p6>-Tc@ $T`$@@ "`"L "$L  >7cL`$€ X  $X "`@4n " `>N#h`>[!  "@  "   %>K耤`v? vm_object_paging_beginpageout㿘>7cL $€  " 6 "` 7"@2>#6``( ? ` @  2 @  `<> ,` ,,`,,,,!>[!m? < D $ <`$ D? "# @ 6 "? "c $ >8`@6 ">B>-#p!>>X(kϗ: >BT>[a`L "`L>B`@ $`? "# @ @` 6 "?#ߐ 6 "mZ`?6`*    `@?*@6`mKpaged㿘>#p>H""H o@>[! t >[ x@F !> h% t#@?$#!>#@9$#% t t 8% t>[! p 2  t t @&* $ p p t `$ p#>c 2>- x@ $c>-#p>WaT> pF    @  p $ `$  x p@   @@>[lݐ!>-no default pager㿘>$> >Wa" >["b>>,c * >  ",, * *>#0 >ڐ#0㿘?># .  >#0`2` vm_pager_deallocate: null pager㿘 2 > X @vm_pager_remove: null pager㿘 >  vm_pager_next: null pager㿘 2 > ` €vm_pager_count: null pager㿘 2 >w!H $@㿘 2  M@ `0   vm_pager_put_pages: null pager㿘 >F" 㿘'HH ɖ㿘'HH vm_pager_has_page: null pager㿘 2 >"`€㿘>>,c *  ` , `, * *vm_pager_cluster: null pager㿘 >~#p vm_pager_nullcluster called㿘>~ؐ#Ёvm_map_lock: failed to get lockpager_map㿐>[!@D  %>!>["pI5  ">~   ">pI( O ` "`" ⭖ >5 "c " pI  >("i  " pI  ">~   !>["ۘ  ">pH %> >[!bЖ  $@  h㿘>[a@ؐ!>[" @>T  "#>cpHÐ  "">~D  " >5#  k" " cpH vm_pager_atop㿘>[">)c€ >~"@+>2a>2" * .   2  㿘 ` "   6 ?# @6  swapinitswapvpWARNING: no swap space found WARNING: primary swap device not configured swfree errno %d swapinit swfree 0㿘> " > "!P>"">8!耢>7!  > aP` " #aP ?>  > '> Ԁ  >}# #> aP>b?@l@$aP!> !P@> ` $!P "> >}#> !P 2>~#>.@7 ``>~֐# >.">.>~ϐ >}f "!$> @ ? 6 !P#! |$$ @ $l$h$ $l$h!P#!$$$swstrategy㿘  !P ) >  Ԁ>"@ @@@@Ś& T ,>"@  2 @  & 4 0h" 0? & D  @ >|"H H /* % 0@  \`" `4@? "`4 4 "@i`4 `4 "`4 \ ͐H 0 s" \㿘>"T> #R㿘>"T>  #RP W{ E @'''@'V'ܰ :`@ "`D2 >" ` ` ( $ 0 >""   2 "@" @0:`   ?`ސ swfreeswapswfree miniroot sizeswfree miniroot savePreserved %d blocks of miniroot leaving %d pages of swap 㿘.`>"@ >2 8    "    /$ >  *"@ *`@``@> >2 8    !P$ "!P>  @Ԑ 4$ $ 2 >2 8    ?|$ 6E>2/>+>2->$@]> `@X> aP >{А!4  >b0>`( : * >O 8$  b0>`( : * $  Ĥ$>2 82 >  $  D `&a @:` $>2>{!#>"%`0!> (@:@ *@ {& `0 (@:@ *@ ">>{u""$ |֕:  㿈@'`' 'Zsbrk: grow failed, return = %d sbrk: shrink failed, return = %d 㿐@>-#L @*@ 䀢@'J  @&@   4? 2  $9  #>`(*>-cL  * &@ '@ܖ ">>! 0`(  ؓ:@  6 @ >"{ 0 > 0`(  ؓ:@ " $ ذ 㿘 耦@:( > (>+ @ >  0@"2 " :   :` 0@ B @d 4  2܀@  ܰ $܁ p  dx ((  $m +>  2c 2_ " ( ( "( "S( "O=#H 8 耠 >  (*@>-#L%@ *@7    ( * H?#'#\#`#d#hQ#l     좄@ D #\#`#d#h>#l   @ D&$2㿘  " >- ,#L*@">-#L   +@ `㿘   >-#L@:` @ ޔ  vm_map_lock: failed to get lock㿘 \u >-L@*@&@L C*@ >[!``  "`W  b ` "` ?` 4`#`>[ @4`>2 ,d6 " "d>p @D@ ">y#( $  @Nx@  >>p D  80 ז >7 PP 8> #p D C  $LJ   %LD    MВ %M͒ $* >-cL Đ* ђ  3$@$`$`&>7cP`& `""`&  & & >#8& & $D㿘   "" D "`"  "`>7"#T "@M %M $㿘 @ݘ 㿘   @И  7>8@`" 2`"@@ $`㿐>#p `B ' @   ߔ    L@    ͔ 2 > 6 vnode_pager_cluster: bad offset㿘  @ @>x P>-#L@  * 8&&㿘  @  D   @   @ :$ Ȓ$ ,㿘>7#P>`#p'`@    @  l`2`㿘`@>`#p`D     $  NF `0 vnode_pager_io: cannot handle multiple pagesp>#p>x+"`@``, Z R `B \ @    B >[!@  "''Ԑ''ܒ ?'''耧 '  a       `蔦>[  !쀢  @ @"@ t`  㿘@` +>#`*`   0@$ 2@ * $㿘@   >c`* "@㿘  沔   8  8>cp҆ /  ї    㿘 "&   2   @  ( J=    4` >R c` * @`  㿘  J   $`4 @x H /*&  ( H 0 2`>`cp" ` @4`` >R c`* @ @ 2` K 㿘 >R c`* @ @H /*&    H 0`" 㿘  * 2`  >#`:` `! +`0  H /*&ɴH p@PF_KEY㿘`    *>_ "p㿘  >#`.  2`  . `,*` *  *  Ib  :  '>>#` "  㬒D 4 4``4   >#  "$ Jے $ $  4 I;  > #$ 4>#  "$ JÒ $ $  㿘 >>$#" @s"㿘  Ә &   㿘  I  " @^ $  >>#p$ 0"$ 㿘>#` #`" @ 2" >c?"c >c?"c Je  `(" ` ` * ` * `" p `* y`  " ` "`  @" `  "  `  "  2`p" `y*`2* `"`* `"`* `"` " `@"` " `" " "㿘`"L`"`0"`0 &     ?& ` > (    ?& ` > @ >L & : @ BB-> @ | |) p& x. DB"`  ?& ` > h  N&   ?J&  &  "  =& ` > 0 !  >& ` > H >L & : H BA> H | | p& x. LB"`  ?& ` > ` $ &   ; & & $`> 8`> P`> X @ +3"K@"A$G@"# "(; "@P `;  "/@hX `(;  # "0; "HP `; "@`X ` ; # 8; P; X; @ #@㿘``` `   \.㿘@  ? 2 2@`&@K`*`@  ?@&㿘`@ L* ?6"0` "0G?6"4&""0 L* ?6"2` "2G26"6&" "2`㿘b0  ? 2 2@b42``&b b0b0b2  ? 2 2@b62``&b b2b2  ?@&` `02 `"02 `" 㿐  ,   *  ,  Fߔ    Ǡ 44`   "  2 ** @    2`"7>``0v00 @  , ,2`4$ p>#`` " @`"@ @`2`0U#` *` "@"``"@??2 @` 0 @`2`-@  , ,2`4$9 %>#``  2@`Ɣ @`2`0>#` ` @`2`@G 㿐  0 0 4 2   H L 2  ` d "    2  ( , 2   @ D 2  h l "       ?@ }   |  ?@!}  !|  ?@"0    ?@"2    ?@ EΔ  'h &@$"&` &`  0 4   ` d  H L  &`   ( ,   h l  @ D  &`  &` |&`!| !|&`"0  D&`("2  ;&`, p'  ''ܐ@ \>#@ ``@`2``Q>#耢 A E?  'E @  ؙ4 *ؒ *>cp2`0"䀢 ,'>#   "   2 @gF 'ؐ@u  ' ?` >"*` ghDkm<mon4oonuootX@@"@ ?`>#T*` gxggggggxgg 3 /А 2/А /͐ -TEXAԔ``> 'Ȑ  D  ' @ 'Ԑؒ'' `    2 3>? 2  m"@ KD| '@ؒ"@H@Ԓ  ?`$>!*` i(i8ixixixixiHiXih 3,`x  2,`x  3,`x   2,`x  ,`x V -H~ː`Ȑ`|Őa|͔ ɔ Ŕ . * ٔ Ք ''@  '? 0        Ā   Ȁ  0     `    2 3= ߐ  ڐ "@ KC˔ '@'"@8@#  ?`$>#ȓ*` kkl<l<l<l<l ll, 3,`x  2,`x  3,`x   2,`x  ,`x  -8͔``|a|   } y ( $ ''?X  ' '> l'>h' `    2 3= O  >Ò `K `    2 3< 1 ؀ ,'*  H  `>c $` C#c䀢 '  H` `*  @e$`> ؒ 2 *ؒ *ؔ  >#  (''4` '0`7'   `    2 3< Ӑ  ` @" @ @ h@ @  ؀ `ܪ  ` $`  @=$`      //i //h'l?'h=> { y 4 bt?"bt (Ԛ  '=R=M>"t$`""t$$ >?''   IJ =3>bt?+"bt (ġ '    '  ē'==>bt?"bt>"t$`""t$$ " $@= $ @ $ `    2 3;' u  `    2 3;  ] "Z    `"`""``"$ ` ""`$ D"$Ԁ ;'># " `" ` @2     `2  `@ @ >c$`  "c c$`?"c '  : 8 76 *```"`& "*    *` "`+ ``*`> ` *`  >   ؐ ʘ '؀ "BK BH   㿘#>a@  $a>"$ >"$ >!($ 㿘> ! 㿐 @ \`(Q & * 2K     >#p  0@2:   `1  0> 0*`  `* @&$ `` * *` ` >!*` zzXzXzXz`z`z`zz{<{<{{|T}z`z`zPzz`z`z` 2  8 "  8  8   Z X W 2ذ  ` 2԰  2Ѱ `   4` ` 2° @Q `@ 1 ( `,`?: * ? 2 ! (  8   sJ? @  ? (   *  `&@  (  ?@ H  @ H :I&@ @ 8l  ` 8h ` ߠ  ژ 2[   *  Β @   8L  Ò`@   @6&@ 8;  `@  &@ 2/ @8* &@``* &`2  > `l* @ 2      0   0    iommu%s at %s㿘`> m! 㿘>   `@R `? unsupported cache-coherence?page-sizebad iommu range: %d: version 0x%x/0x%x, page-size %d, range %dMB nameP >5`"#x@>m|"P0ؐ0 4@1 &`(>@b`&`<'> "&`<#>>bx`<>0`,@f"@`(&`,@ 2 @*@`(&`0 `,>%  `*@&`8`,@Ǒ* @?4 2 '>L  @ @У@'>,@* `8?`0@ * ?@ !? ,`8$@@<: `( 0"`چ$@`8@>`4 `L  @&`0?`0&`4? * >"k Ho o`(" `(+  ?  >b"`(2` |" `(" H 0 `(`,>`0"@3 2 `l͕24  >@la 2'4 ''@ΐ >@bВ@ߔ '>_G @ >2,2@>0@*`>5x``4>2,"08( ( 0 >5`x>2,48"0 ( ( 0 ,@obiovmelvmesvme㿘>    `@ `?%s at %s addr %p vec 0x%x㿘  >#& ">> l7#> 4l3#>   >l(#Ё 㿘`> l# interruptcountereeprom unsupported rangesobio: PROM ranges too large: %dcould not find %s amongst obio devices namezsP>  ` 4>>k >"@]@>  ` >>kϐ 0k̐ a4  >@kc@ 2'a4 ''`> ؒ@ @. % 4 =  % 0> jA@j@`>``N&@g 2>!kj'@ " @) '>^  N :)>>@ea(>``@   @ >@a0 2# %#@)Q '>]ޖ @X ̐㿘` >>  > >cX@  >>k$ 0k! 1>  \  >$ < & \@$>"`\@P㿘` >>  > >cX@v  >>j 0j 1>  \  >$ "\@#vme: PROM ranges too large: %d: version 0x%x P>  ` 0>jŐ 0R`4 `@{ &`(< `@@u &`,>`@ $>K@) &`4 <  &`0>!xi<@e>K"#(>@!j `a4  >@5cX 2'a4 ''>#P''!> \] >#H''] vmebus: no ranges㿘 4 2`4>h#0? ?  -  &`0   ="@ 4   0 @  `P>  >` t> ><@2 > >` <@a> ` @ ''' $>!. '䀢  >,?@@  '`  `'`  ?' '` '8  >@cP  8>@cH  2'8>@zc@ 2'8 '''@  "'耢`@Ð'>\ܰ 㿘h 㿘` 㿘X vme: spurious interruptvme: spurious interrupt 㿘 >a> . @*  8@J@ >>K# , h"> >if"  \*@ "`" @   2vmeintr_establish: interrupt vector not allocatedvmeintr_establish: uninitialized vecvme_addirq㿘>  \?>gŐ#2. >g# 2"  2 & > .`  >"   2  :u  2>g @̒ >"&& @ 㿘>  +> ,@ &? #> 0  >`(?#2 * ҃@ " @ 2  @ 2    @㿘> >`,!?@@'U auxreg㿘> "܀ K> T %Ho o>  >N #`*#?8* H 0 0/ #`*#?8*0 #`*#?8*0Ho o>  >N #`*#?8* H 0 >% >aX@(>"(  2 auxiliary-ioauxioauxregmatch㿘>  "   >0>0 >#p>#@`?fԐ# 㿘0?8 @ >   > > ?8"b >N ?8`" `>N *c>h > T b no aux register㿘> "܀>f Ho o>N c**c*H 0  coclockeepromclocktimer㿘>   > ? >"@}    : @  delay constant %d%s [TOO SMALL?] oclock: calibration failing; clamped at %d 㿘> ""l0  @h >2"$>@!`   *`*@ * @ @ >H">"c >! `$ *`$ *`     Ґ# `$  *` `>>!ؔ!gp0  4> & # >gd!㿘>   V` > ? >"@   ^ : @  㿘>g@#0  @%>"b>""㿘>  > ? >"@ "  3 : @  >@!@`?mk48t02modelno prop: %s (eeprom) mk48t08㿘>  @>   >@` 2>>e  f>@`Ѐ 0  @!> ! #>2`   `   @(> !>2  >  >@> ? a`>""> "b  * *` *   >H"b>/""counter-timercounter㿘>  > ? >@/!P    : @  >"x"` >"@`?delay calibration delay constant %d 㿐 %> ?` +  *  @ @0? @ >?"#<>*? "`"   ?0 @  ? ? > "">" # '$@y d@`6> >d#@ :` d@6>  $ # >f#X㿘Ho o  >a    "a a?"a`?H 0  >2> >`,>/  ! >/>>@`** * * * * oclock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz statclock; using 100 Hz 㿘>"l  !>!X`d>e!Ȓ d$!X>-"#D@"@>"a\ !>2 $ *  $ * $ j*`%>Ц"@X@  >!eu d$X@ݒ d>"a\#>)c䀢 cX$cc@z >"(e] d$cc>-@"D2: >"h d@ $ !> bh:  "bh!>   >!\>c<* "@>* * "@   >!\? * "`* "` >"h>7 : "`"xz  r 㿐Ho o>"l  >2 $  '^Z 0> ``>#<'`? 'H 0>2" @  >   V 0/  oldclk statintr㿐>"l ">>cb!  >>* >" ' >"" >#< "`0#  ? 'S>"h?>>7`x @ >* * "@ ?* "`  ;Zx0N8`((`:`(( `:(( :(( ; (( ;`(( `D`E  43  F,   2!m!n >⸄?(P?  4 * ( ("* * ( (*` (㿘Ta>L  E@@4  @  @*, & & &  `? >" , R6   &&   & * R%`& 4& T@a@I.& @.@B <& @ <&@:  @ߡ, &  @/ @ԡ, &   @$ @ɡ, &   @ @, &   @ @, &   @ @, & WARNING: preposterous time in file system WARNING: bad date in battery clockWARNING: clock %s %d dayslostgained -- CHECK AND RESET THE DATE! 㿘>/"`?Y!  >cR" ư!@ >"l @>L7   @-  `-(>L"`!>L  >c%"$ $>@& > , `"@ ># >#@>#H T@qac>b#Px>"l  >L` ->2 $ )`@2>L !>/" А  ' ,',',',',',',',' ' `,'㿈@@㿈'@B@">2$H  *` @( `>2$ (H >2$H  *`*@ `>2$ (H 㿘#Ta@ې@a@Ԓ..`@z.@͒ <.`@s <.` @o .`'!lP2>>!l!mP.`> "c(>#$@      & > "#(.` .` ? ;  7'  2mn2  8   6 >$  @  * (* (* ("@㿘>"l 0>Ho o>L &  & H 0  >! ! >4>>T@&T@А"?@ &  &?/!@& >"a a"`㿘>  B  > %"@8@v 31>" %%  2 2 #    , `dE   @  4_ @_㿘>" 5 + >" #5  @N* :  ,@>!X>@ 2 >J@ @N* :  ܢ` >"   㿘>b  #>  $b">!@JĖ  $b" 2$b> "b㿘>"b> b"LU power㿘>   >@!H`? 㿘0  @ >*"`> *c>`̐!>H>*(ledleds㿘  >@W"  `@O   > `? 㿘>``&`(0 8@P &`,>>`T`"#@>`"p㿘 K 0 @[ >`T`& 0& 0>   Ho o># 0? c , 2H 0   `THo o># 0 Ш@H 0 `T  >% >aX@X(>"ܒ2cpu㿘`@ `?midno%s @ %s MHz, %s FPU: %s%s, %s; %s  &`(>`@@  &`DX:   @2`@ &`@`@  >{_ (>{[!X@>`@` Ha(`@@D>8 0  h`0`4a @Ԗдh`!>`,@L P`> h_В>">`p>L_>@Jb b>_ x>_ ` "`@@]`@ >{!Xa0㾐'p{p:   &! >8 "`0%s: %sphysical %s%dK instruction (%d b/l), %s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)%dK byte write-%s, %d bytes/line, %cw flushthroughback%s%dK external (%d b/l) 㿘>">" _T ` "` >">"_F `$ >"`,_=: >"`</>"`D_2: '>  > `"c` _%:` > >`#(c`l :` >#X>#`` s `  h_  >"`T>#h`\_: >^#Unknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %d㿘 0 4 8> <]{!  ""`l0;+ 06" "`"` "`"` "`>&4"!4"!8"!<"!@)"!D "`l" "` "`  "`l" "` "`  "`"`  `("`!"!"`l" "` "`  "`"`  `("`㿘!>@!`vY  ""   # ! 06 $% 01&  d&  & T!& \6y!@'& &  & "& \ & T?!0&  & !,& !& \ & T_^ @& & !& $& \ @& T!& X}"@&  & dmmu-npmgmmu-nctxclock-frequency㿘@>c@B & \& `>c@; & T>c@5 & vac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-type㿘`? $`>`@@@& >`P@  >``@ $`>`p@ $` `   * &  * "$`>\~ $` $`l>`@ * @$` ! &!cache chip bug - trap page uncached㿘!  > 4@0$ >@">]acache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache 㿘` >@b& >b @Q  2&  & & >b(@ْ ~>@Ӓb8 y t@6 & 4>bH@0 & ,`   ` `* ` * `"& 0>"`[& 0>bx@ & 8 4@ @& $>b8@ & L>b@ & D`   ` `* ` * `"& H>"[z& H>b@ߔ & P L@@ H 0@ & <  D ,&  $ <& 2 >b@” & >b@ & `   ` `* ` * `"& > [8& >b@  @@&>c@$ 2@ & d>c @ & \`   ` `* ` * `"& `>#8[& `>cP@f & h d@u@s& T >\S#h Ƃ(Ģ㿘@ [viking: PCR_TC is off]㿘 Ԃ> & L!@`&!>\&   L`&! &!4> &!H L   & [viking: turn on PCR_TC]㿘 @> L  #@2 >[ @, @warning: hypersparc support still under construction 㿘 & >[!  @H8 4" ," T" "!"!("!$"!0"!,"!4"!8"!<"!@"!D"!H&ĀĠUnknownTI_4_4TI_4_3TI_MS2TMS390S10TMS390Z50 v1TMS390Z50 v0 or TMS390Z55RT620/625CY7C611CY7C601/605 (v.f)CY7C601/605 (v.c)CY7C601/605 (v.b)CY7C601/604MB86907MB86904W8601/8701 or MB86903CY7C601L64811MB86900/1A or L64801psr-implementationpsr-versionimplementationversionOut of CPUs㿘 @ >H` >c8@U?`4 ` >cP@I?><  >  ? @  >c`@5?`4 ` >cp@)?)>< % #>c8@?> 0>cP@?> 4>c`@?>cp@?>"`)>>#Р @2 ?쀢?2 ??2 ??2 ? ?2 & 0& 4& 8& <` , 2 T?& , T 2  & T 2!& ! 2 &!` €`"!( 2!(  @ & @U@ & !( 2!$ &!(!$ 2!0 &!$!0 2!, &!0!, 2!4 &!,!4 2!8 $&!4!8 2!< (&!8!< 2!@ ,&!<!@ 2!D 0&!@!D 2!H 4&!D!H  8&!HXB5010 or B5110/20 or B5210RT602 or WTL3171TMS390C602AL64814L64812 or ACT8847L64804on-chipWTL3170/2L64802 or ACT8847MB86911 or WTL1164/5MB86910 or WTL1164/5version 0x%x㿘> 䀢` ? 2??2?    >Z`memregmemory-error㿘>  2    ` >!P@x`?memregattach 㿘>   >)# 2"`>XV!``2 >)0  @o >)"#>Y!ȁmem err: ser=%b sva=0x%x WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3mem err: ser=? sva=? parity error register not mapped yet! memory error%ssync mem arr: ser=%b sva=0x%x aaer=%b ava=0x%x WBINVALTIMEOUTDVMAERR㿘>  '  1>)0EA 0B#  >"H>hY6 >"#>@Y/ >>Y*">Y'#>W#8 >#H>#p>#x >Yh>#>Y>)#`" >>"@>Y>W#8 @O mem err: sfsr=%b sfaddr=0x%x CSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWasync (HS) mem err: afsr=%b afaddr=0x%x physaddr=0x%x%x SYSERR UNCORR TIMEOUT BUSERRAFOunknown mem err: if sync, fsr=%b fva=0x%x; if async, fsr=%b fa=0x%x pa=0x%x%xhard memory error㿘  >`">!> X>`> !X!> X>!> `3 X >W#"HyperSPARC async cache memory failure at phys 0x%x%x. Ignoring. store buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. ERROR: got NMI with sfsr=0x%b, sfva=0x%x, afsr=0x%b, afaddr=0x%x. Retrying... unknown fatal memory error, type=%d, sfsr=%b, sfva=0x%x, afsr=%b, afaddr=0x%x memerr4m㿘>"ذ6 X!>" >>"? c>?"b>"">k"b +" > 4  ># W>" +>"> A> +"b>"" Ѓ@$У@0G ` >Wߐ#X7>␀ 2;&␐ &5&">>#> W˖>#Ȓ>WĖ>" >"> >"">""#> W> (>W>V; @zs㿘.3>` t ` " t  㿘.3>` tԐ .` t͐ slave㿘` @ "$ >   >>>   >>c @[?V`  `? ,  r`& 4: @ zsattach: expected 1 interrupt, got %d pri %d, softpri %d broken zs interrupt schemeintr㿘>`!У- @자$@ 2 !0 "!0>U#؀>#W 0>   W>a >"a"!Đ>@b >@~b !Ā">U >`@K`,&`(- `D`&`D&&l& >7&h@I"&@&@  l"`l> "`>#"`Ȁ`& >b@>" " #@"  .7 @>ɐ >"܀@>""&`*` ( &d`h& @ &@&@  l"`l> "`>#"`Ȁ`&$"`"`#"` >b>@v @> >"܀@>""&`*` 'Ք &dzsconsole㿘`>T#h>`>!е*>`""@ː &>`"̐`">> "cT>""؀>"t&>"!ȁ㿘> ! Ho o>   H 0, >#>` sb  `>` ` J`<  `<, *   s? H 0inputoutput%s%c: console %s i/o㿘>!Ȁ >"؀ >!`>"܀ >!h`2 n 2 n* `*  & l>#& @& & # & > & Ā`>!p`  a >!U  .:.8㿘  * @ 㿘@   (& p㿘2 & p㿘 >b :6 b*@ * @*`@*``D L`: "`ܰ H /* & p #  2 #"$  $ #$ %$ `@$ $ @  p $ p ?$ p$   H 0 ` p   H 0 ,`=`j t `=pH 0}  p"$ p `=2 @  `>` ``r/ `2 pL`6 "  p $ p  @2 `= p  `= < >!`   `=    " `= p  @ϒ  p }$ p2,`= p =$ pH 00# `= 2   @ p " H 0  > h`*@ € @ 㿘>.   . * *   D >`h*   €H /* &`@ `p " "  @m  >>X>X  "`pH /*, )    . ) . H 0`p ?&`p. =H 0? 㿘>.  ` . *  *   T> h`* 㿘>.  ` . *  *   T> h`*  >*  * (b@(T㿘>7  @p ```2 8.` `\  @    `d* "@ @    `d* "@ @(    `d* "@$`\. `p `Ā `h@}    `̑* "@ `h@ǒ    `̑* "@ `h@    `̑* "@$`Ā "`h``8? "`8`h`2` "I >  8>@ /%2>4` "`H 0&>  H >N #`*#?8* >   >N # `*#?8* @5 # `*#?8*0 #`*#?8*>>   o  ot  㿘> ` "L`7pa L`7  >aܐ *aJa܀  *a ,  M . L   @` , , . N  0.@!> `p3  8.@  ". p+ .   0.@!>   8p  8.@   p  㿘 DN <  <.`. <1>  " 8p  8.@'  (.@1>   8o  8.@   o   H& D @!>.``  & Hoߐ  8.@   oא  㿘!> @  oː  .@   8oÐ  8.@  `o `"   @@`   `  . ʒ `",`N 8 >` @     o @  @  ,` 㿘>#P @6 zs%d%c: %s overrun 㿘@>L@ >`X> &@  PԖaringfifozs%d%c: bad ZRING_TYPE (0x%x) 㿘>7  9>`X\" % > h *` @P>Ĕ%?,$X d* @ ` 0   >u ><`` T>`@<`@`@.u?@Đo? €j? 4 ";pH /* ,  @ `n `$ ' ,'$l @ےH 0L,4p!2pH$D @.``  w$Hn 0sp `$p $pHPHi"  @? 5<`@  4`  € 2 ,5@m,5`ȕ= aP?c D$X2@`㿘>.  . * b* @ D@ > h`*   @ 6 & ]@"iN 6 y@ x@ސ  z@= {@    k@ѐ  j@  \@"M ڰ   l@  m@ϰ H /* , )    . );. H 0 H /* , )     . ) ". H 0  #@ 2`  2`&) "    H /* , N :   3. 6   # . 3 . #  3. 6  #. 3. #   $   3  # . 3 . # '    . ' .  @  3  # . 3 . # '    . ' .  @*@$ H 0  @H  @D  @Œ  )2``*   2@ 2 & 㿘 l>*` `*` *  ⬑* @  D@H /* & pF V  H 4  H & p;H Hc)  H $ p & p PH 0, %   , %=,  *`>   m  $ H$ DH 0, %    , % , H 0l>( ((b(DH(p" Dp"pH 㿘`(> l *` `*` *  ⬑* @  D@`$ 2  ,@~ z @“,  4`p @& & & H /* ,,`0< ,`1 ,`%c! "       `   @ @  `@@ ` 2 >  ",`'lg ,`'?,`)d D L@" @2 ,`( ,`-,`. P,`/ ,`2 `4`,`3` p  `D,`4$`L $`D`$`jJ `@;H 0 㿘` ? ?}H /* , )  4 `. )  p   D. 4& L & D    -. H 0㿘 0.!>  k     k     k    k ` `  `  `  ` `  `  `  `  `ܒ `ؒ `Ԓ `В 㿘  H /* ,  l@     k@"  ) 4 m@" )  4*  ) } . ) 4   p   D. 4& L& D )  .  H 0fdc360KB/x720KB/x720KB360KB/PC360KB/AT1.2MB1.44MBfdSUNW,fdtwo㿘>    > $ >  >  >  2>>! @~@ "    h ?   drive %d㿘`>M!Ё 㿘@C  @  " d@4 @1 o@.@+ [version cmd] CFGLOCK: unexpected responseintr pri %d, softpri %d: chip 8207%c 㿈 0 8@: &`@$ \ `$ | $ `$ T T$ X> p"`>@vc>Đ $ ($ , @ ( @ @ @ $ p`$ t$ x    7 * x " 2`72 @ ` $ `$ x $ p $ t@͒   X@  X   X>"耢 " X>M/"x X$ lp `  @ @ >M">bA> >" M'8 6>  >>! @ 2*'  " "' 0 4@  2'  <@2 ' @@2'''>#!>'!?n   ' @ fdprobe: %d stati: %x 㿘$ `f   x *@* 䝒 i & @+ @(  #i# p Ѐ 2 ai"@  >@  >  >"耢  >!Lu  >#>a `Lk&a>Le"    `? `   x*@ G : %s %d cyl, %d head, %d sec : density unknown 㿘   0  >L6#?>L1#ؐ?&`&`&`,`" D@  @@ `&`0> &``(B2&>ɐ#,@ >!t0&`@,fdstrategy: b_blkno %d b_bcount %ld blkno %d cylin %ld fdstrategy: controller inactive 㿘> D` :  6+ * @ %  T !  "耢 & @ T <> K ؑH /* % ̒A >!t! 2 $@0  \ >K!@H 00 0(& 0㿘 $T &!& X& X" `"X@ 㿘  $ Ȑ  & &  ` "`$ X  "`$ " &!&  X&  X" $ X &`@& `$& >>aX!t* $ \fdc reset 㿘 `   x*@  p *h{ p* `   x*@>"耢 >K 㿘 `   T     D " ` "`+ * `` x*0  D "` 2 ``     㿘H /*% ?&  $H 0㿘 $H /* % ?& T \ @3 H 0fdcresult: overrun fdcresult: timeout 㿘a" `p Ѐ  $`  >IPb@?`t@  *`g֐ ?2`p >I?bX?$`?㿘 pa  b  ?g  p  $? t *㿘 >`:  6I * @  p: ``  *` *  * >b  `2 ,  "$  "$ # ? $  <` $ @;  * " 4  8 8 $ 8 $ 4 8 4  $ <>2  ``"`"` ("`4 `8`8("`8("`4`8`4 "`<㿘>!4> #_㿘>!4>  #Sfdcstart: not idle 㿘 \ >IŐ!0@@%s: %s: state %d (st0 %s cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam fdcstatus: weird size: %d 㿈> $! \  Ie >  >%# >!# >IT"0" > IM(0 > > #\ "h#` >#d (#h>I9"0I6timeout㿘 TH /* % >Ē ( "& \ \ & \@H 0㿘H o*@e@H 0㿘 | 2 & |H /*%@mH 0 fdc: spurious interrupt: state %d, istate=%d fdcintr: spurious interrupt can't be clearedfdcintr: block %d != blkno %d fdcintr: %s drive %d track %d head %d sec %d nblks %d readwriteseek failedread failedwrite failedblkno %d nblks %d nstat %d tc %d fdc: %d -> threshold soft errorrecalibrate failedstray interruptfdcintr: impossible㿐 |  > \H{!` \? & |>G ! T`2`& \ $````"`& X``"@$a 0@2 H \`>Đ#*` <X<& d$`>¤!t <$` T%$``   & \-` *  D " `  ?$ ``$`  ``& \>!X>!Ȕ: ` ?$` ` " ` 0@2` @E$` @@Au  2' ` n i   & |b    `\  ` @@`(Q ` ? P& \$` & \& `X`(B><`X>>aX 0l*=  $````@` $!: @8> ,  !: 8$` <, $`@@@`%`@ @`@ >Gs!@+T H` 0 & ` p& `/*@>"耢   >!>">Ē"  ``GQ#\ & \ & |$& ђ M _ `,@ ɒ ` X  Ð R   L   F >    怢   & \ ŀ 5  `,@  ` ,  ` %   `   `   `   `z    `t  s& \=`(>>aX 0*h >Đ 0ǒ  ``& \>!X 2!>@7 S `(=  > 2 >` @ ( @ː >"耢 ( >"($`>N ?8`* *㌐ *0>  !>N ##?8`,#,`c # ,#,`0>Đ 0v < @`(=r"  >  > E > l @2@ d>"耢 "  0@">>"8"H `` > FU"X   l `4 h  @>"耢 & l>Đ"F; ~& h h  & h & \ d >` >Ā "!?; ; >F"& d h??& h l`  @>"耢 & l>Đ"F I& h```` `$`@  $`" $` ``@[`% @w Tϐc5 d&  & | & \>>aX 02 :` >Đ 0 & \ & |& M    `G  G& \>>aX 0*l = >Đ 0  ``& \>!X !>@  W(   > >?  >"耢  >Ĕ@ T$`` " `  > hard error㿈 T & h   d   6 " `       2& \0& \.& \ #  > >ǀ #0!?; ; >Ð"h > > #\ (#` >#d "E)#h $`4`0"`0 d & d? fdioctl: impossible㿘>6   bA@ "@@"   p@L"@H 0| ">@Ue e@ 0r !@"5V   m@  q@ 0b )"=@, e g@X  `+!R O M   @&* "B > @&`a4; 8 @4 2/ n* @4% @&`&`&` & `&`&`&`&` & `$&$`(&(`,&,`0 &0 & $ fdformat: blkno %x count %ld fdform㿘 >4  `  | Д @2d 7  &( 2$@ | $`0$`,$`D@_@\``@W $`T`* $`<>"耢 $`H`<>D/#?H /* %`0" 3>!> !Xc0+  -ח* #`0"H 0 # `0(2`4 &floppy diskfictitious%s: %s 㿘6 >` @!@@""$ ( $ 8 $ 0 $ ,> a @-$ 4 4  >ɒa(@& !,4 H 4$ 8$ < 4 J $ X@$ $ ,  4  !W$$ 9X4 >a4@$ >ɐ!8C㿘>    $ ۊ `  ۅ 0  `    x?*` x *@Insert filesystem floppy and press return.㿘 1>>Ci#@  C`" `p:```   *` ( (> />=%/>[ᐬ%/> 4$ 4   93   @2 $ _$ 6@  , ,2 @$ $ +>``-?8 -0-?8 - ?$ $` --00 $ 0& @-a! Ѐ2 @ , ?$ $ @-a Ѐ 2 @`  ,` @$ $ $ +>``+?P `-`0+-?P%/>@̀sbusslave-only%s at %s %s slot %d offset 0x%x㿘`> B! 3>`@٬!<: `>B"!<>!@B" 㿘>   `@3 `? unsupported clock-frequency: clock = %s MHz burst-sizesrangessbus: PROM ranges too large: %dnameP >Bb"0\>ʒb_^@@_$(!>@Ƞ"BS>ʒc@S ?$84 " '>@a 2'4 '>ʴc@' @ $4   $0>ʐ# @Ò@@4 >@c@@E  @ '>ʔ(4 @# relative sbus addressing not supported㿘 4 22`0`4=# 2 &a<?* L&a@> "&a@>@y  `0>&a<*  @&`4`@8&`0   ` "`0`4`"`4`@` 0( `4&a<`@"&a@ 4 @0  0 2  4 4  @# 4 0  # 0`@``@ sbus_establish: can't find sbus parent for %s㿘`$>ˢ"   > >˒"@a@  "& $ ,& $ ,reset %s:㿘> Ա. >@#8Ac  , #> `"  @bAU   2 %s: dma card found in non-dma sbus slot %d: not supported 㿘 >ʒa@?a<: > `A0# 㿀&`'?#`, '`, 耢`'쀢@2 '2'*`: @/䀊- `,  $䀢@" > @''>̔>3 ` "(`("`,&``",`  &`   'OUI 0x%06x model 0x%04x rev %d at %s phy %d㿘`" > ! *:  2@  >@! 㿘` @ "@  @  (""4 # & 0# &  0 ! A ! # &㿘& $   & ( 8  " (  㿘    8  ( 㿘& $    & ( 8  ( %s%s10baseT, 10baseT-FDX100baseTX100baseTX-FDX100baseT4auto㿘>̀h .`# ? >͐ >@>͠ %@.`# !?x >͐ >? >͠ #@.`&?g >͐ >?0>͠ @.`& ?S >͐ >?ڔ@>͠  @.`(?B >͐ >?ɔP>͠ ` .` ?2 >͐ >?`㿘  $> D  0  <: 0 $  0 < 0 < $, 0    \# !$ < 㿘 @ !!!  $  0 <  0%  < $, 0 "  4\Đ#``c$ < 4   @   < $0 0$nsphy (: 2 #  : %s, rev. %d DP83840 10/100 media interfacefxp%s: no media present 㿘>͐#> c?+  &`4&`0>ΐ!P&`8&`<  > @’c   2`@ &`@`4`&* >} @h`<`$,`0 ` &`D>> >`D @2`4>> >͐>> 㿘`"0 42    42  "` < $, 0 $ $ < 0 0   4  < $, 0  < " $0  0 ? `" <``; <" 6@ < $, 0  2t 0` $ 00  @ !!   "! < $0  0[Đ"@ < $0  0 ;0; < $ 00  $ < 00  0) 42 25 22 ` 4 "-  < $, 0  < $, 0  2  H  & H& H@{@ L`(@2`42 `4@ $`(& L 㿘 < $`$ $`( < $, 0  < $, 0  " <`$ $`$ < $, 0 "`($`$S `( $`(G 2 <`(D  $, 0  . < $, 0  < $, 0  "!`() `(    @`( `( @$`( `(   $, 0  @`(  % $`(㿘 < $, 0  < $, 0 >`  $ 0  <: 0 qsphy (: Q2 #  : %s, rev. %d QS6612 10/100 media interface%s: no media present 㿘>ϐ#(> c8=U  $&`4 &`0>В`&`8`4&`<*`<`" `4`&+ < @`<`$,`0 ` &`D>=.#X>`D @2`4>=%#`>>=#x㿘`"K0VU 42  O]  42 "` < $, 0 $ $ < 0 0 H  4 4 "@  < $, 0  24 (0  < $8 00  $ < 00  0 42 2 2 ` 4 " @ L`(@2`42 `4@ $`(& L 㿘 < $`$ $`( < $, 0  < $, 0  " <`$ $`$ < $, 0 "`($`$U `( $`(I 2 <`(F  $, 0  < $, 0  ?`/*`>А# CD D D CD D D D D D D DD D D CD D D C`( `( `( `( @ $`(`( `(  $`(㿘 < $`0  0 getxscannot allocate scsi xs 㿘H /* %   1>р`9   p4 %  ` ?, >M#< ` "` "H 0`H 0 h  H` `@>;Ґ x  H 0 & 㿘  ?& >Mc<c< &c<" "c<&   ` *?# @2' 0  `@could not get size p@b  %/" #\#`h#d  @S   . * *`  @>;s"x 㿀@8 / ##\#`#d   @+ 2x@$  @/ /a"#\#`#d   @ 㿀@   / ,/ ##\#`#d  ,@ 㿀@~  //##\#`#d   @ 㿀@~ߒ  ///`!0 ##\#`#d   @ʚ 㿘   @ . 0@  &Q09@ 2 0@ "    ' 0 0& ,  `" $ 4 0$ 4 <($ 0$ @ ($ @  `@  0scsi_execute_xs: NOSLEEP and POLLscsi_scsi_cmdscsi_execute_xs: invalid return codescsi_execute_xs: impossible㿘& , . X $ ?& & (  @ "<   >07&>04   $>9"8H /* %  !>Ґ "`$   H 0 0 ?@_ ?" & ,8ܐ"pscsi_scsi_cmd: buffer without nosleep㿘`d2>8Đ# 2$`  `YU}$`$`$` $`$$`\$`0$` ` *``  *` *   w?<0 scbusyunknown error category from scsi driver 㿘 ,`;*`>Ӑ!h MMNLNLN M4 @K?0 , 2  $ ,  ?   W"@   >K#>Ӓ #y  ?? $ $ , ? ? $ @ >9!  DEFERRED ERROR, key = 0x%x error code %d at block no. %d (decimal) 㿘 ` `4@?  p qz@ >Ӑ"`9t `  ` i>Ӑ#L*` OOOPPPPPtPPPPPPP($@"K$(P ``?# @4` @b  " 2  2 $,R? " ` 2V"@F? C %!= :  ``?# @4``-?` )` 0   ?  @ 0@"> "8 `   >Ӑ"  *`* @ 8@ >8" %s(%s:%d:%d): probe㿘> `!X`>Ԓ!h    8єReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadySoft ErrorNo Additional Senseq`qHq qppppphp8poooooxo`o0onnn`n0nmmmmp mX m@ m( m l l l llxl`lHl(lkkkkkp k` kH k jjjjpjXj8j jiiiixiHi(hhhhph8hggghg@g gfffffXf8feeeeexe` e@!e!e"d$d%d&dp&dX&d@&d'R@(c(c)c*cp*cX*c@+c,b,b,b-bx/bP0b00b0a0a1a1a2a`2a@3a(6a7`9`:`;`;`p;`H;`;`;_;_;_;_; _; _`; _@; _; ^;^=^>^?^X?^@?^ ?^@]A]B]C]pD]XE]8F] G]H\I\J\K\L\hN\HP\0P\P[Q[R[S[S[S[pT[HU[0W[XZYZZZZZpZZPZZ0[Z [Z[Y[Y\Y\Y\Y`YpaYXaY@aY0bYcXdXIllegal Mode For This TrackEnd Of User Area Encountered On This TrackScan Head Positioning ErrorOut Of FocusUnable To Acquire VideoVideo Acquisition ErrorLamp FailureSpindles Not SynchronizedSpindles SynchronizedRPL Status ChangeLog List Codes ExhaustedLog Counter At MaximumThreshold Condition MetLog ExceptionOperator Selected Write PermitOperator Selected Write ProtectOperator Medium Removal RequestedOperator Request or State Change Input (Unspecified)Updated Block ReadGeneration Does Not ExistUnable To Recover Table-Of-ContentsSystem Resource FailureSCSI To Host System Interface FailureMedium Removal PreventedUnload Tape FailureMedia Load or Eject FailedCartridge FaultErase FailurePosition Error Related To TimingWrite Append Position ErrorWrite Append ErrorOverlapped Commands AttemptedLogical Unit Failed Self-ConfigurationData Phase ErrorCommand Phase ErrorInvalid Message ErrorINITIATOR DETECTED ERROR Message ReceivedSCSI Parity ErrorUnsuccessful Soft ResetSelect Or Reselect FailureInternal Target FailureMessage ErrorPower-On or Self-Test FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)RAM FAILURE (Should Use 40 NN)INQUIRY Data Has ChangedChanged Operating DefinitionMicrocode Has ChangedTarget Operating Conditions Have ChangedLogical Unit Has Not Self-Configured YetInvalid Bits In IDENTFY MessageMedium Source Element EmptyMedium Destination Element FullPosition Past Beginning Of MediumPosition Past End Of MediumRead Past Begining Of MediumRead Past End Of MediumReposition ErrorFailed To Sense Bottom-Of-FormFailed To Sense Top-Of-FormPaper JamSlew FailureTape or Electronic Vertical Forms Unit Not ReadyTape Position Error At End-of-MediumTape Position Error At Beginning-of-MediumPositioning ErrorMedium Not PresentSaving Parameters Not SupportedRounded ParameterRibbon, Ink, or Toner FailureTape Length ErrorDefect List Update FailureNo Defect Spare Location AvailableFormat Command FailedMedium Format CorruptedCleaning Cartridge InstalledCannot Read Medium - Incompatible FormatCannot Read Medium - Unknown FormatIncompatible Medium InstalledCommands Cleared By Another InitiatorOverwrite Error On Update In PlaceInvalid Combination of Windows SpecifiedToo Many Windows SpecifiedCommand Sequence ErrorCopy Cannot Execute Since Host Cannot DisconnectLog Parameters ChangedMode Parameters ChangedParameters ChangedPower On, Reset, or Bus Device Reset OccurredImport Or Export Element AccessedNot Ready To Ready Transition (Medium May Have Changed)Threshold Parameters Not SupportedParameter Value InvalidParameter Not SupportedInvalid Field In Parameter ListLogical Unit Not SupportedIllegal Field in CDBIllegal Function (Should 20 00, 24 00, or 26 00)Invalid Element AddressLogical Block Address Out of RangeInvalid Command Operation CodeRecovered ID with ECCMiscompare During Verify OperationGrown Defect List Not FoundPrimary Defect List Not FoundDefect List Not FoundSynchronous Data Transfer ErrorParameter List Length ErrorDefect List Error in Grown ListDefect List Error in Primary ListDefect List Not AvailableDefect List ErrorRecovered Data - Recommend RewriteRecovered Data - Recommend ReassignmentRecovered Data With LECRecovered Data With CIRCRecovered Data - Data Auto-ReallocatedRecovered Data With Error Correction & Retries AppliedRecovered Data With Error Correction AppliedRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Using Previous Sector IDRecovered Data With Retries and/or CIRC AppliedRecovered Data With Negative Head OffsetRecovered Data With Positive Head OffsetRecovered Data With RetriesRecovered Data With No Error Correction AppliedData Synchronization Mark ErrorPositioning Error Detected By Read of MediumMechanical Positioning ErrorRandom Positioning ErrorBlock Sequence ErrorEnd-Of-Data Not FoundFilemark or Setmark Not FoundRecord Not FoundRecorded Entity Not FoundAddress Mark Not Found for Data FieldAddress Mark Not Found for ID FieldUncorrected Read Error - Recommend Rewrite the DataUncorrected Read Error - Recommend ReassignmentMiscorrected ErrorNo Gap FoundIncomplete Block FoundData Resynchronization ErrorCIRC Unrecovered ErrorL-EC Uncorrectable ErrorUnrecovered Read Error - Auto Reallocate FailedMultiple Read ErrorsError Too Long To CorrectRead Retried ExhaustedUnrecovered Read ErrorID CRC Or ECC ErrorWrite Error - Auto Reallocate FailedWrite Error Recovered with Auto ReallocationWrite ErrorError Log OverflowSpindle Servo FailureFocus Servo FailureTracking Servo FailureTrack Following ErrorLogical Unit Communication Parity ErrorLogical Unit Communication TimeoutLogical Unit Communication FailureMultiple Peripheral Devices SelectedNo Reference Position FoundLogical Unit Does Not Respond To SelectionLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Initialization Command RequiredLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Cause Not ReportableExcessive Write ErrorsNo Write CurrentPeripheral Device Write FaultNo Seek CompleteNo Index/Sector SignalNo Current Audio Status To ReturnAudio Play Operation Stopped Due to ErrorAudio Play Operation Successfully CompletedAudio Play Operation PausedAudio Play Operation In ProgressI/O Process TerminatedEnd-Of-Data DetectedBeginning-Of-Partition/Medium DetectedSetmark DetectedEnd-Of-Partition/Medium DetectedFilemark DetectedNo Additional Sense InformationDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xCheck Condition on opcode %x SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %u COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d: %2d: 0x%02x㿘 > ! @0f 4 !>@Ġ!0^N   >0X!N   >ܐ"0P  ,  @>ܐ" 0H ,  ">>ܐ"00?>0<"    * *` *  >0-"XN  h    * *` *  >ܐ"p0 @z  >ܐ"0N `>ܐ"0 `@j  >ܐ"0`=     N    (N +>ܐ"/`>ܐ#/  #/ޒ ? >'>%>܀``0  /Β0`/ɠ? `>/Ð"%s, Error in %s, Offset %d, bit %dCDBParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d㿘 ```` ` ` `>!@* 1>!@s06`>Ԓ"` `  ` >! @ 2` ` ``  >Ԓbđ+   `@  >>/a1>>ܒa @r1>=`!>!>a@*@ >/ra>Ԟb ` @  `   @ 2` ```  >Ԓbđ+   `@ >>>ܒaD @r B1>S ` O ` K`H>ސ *` yyyyy `  @>!>!>">ݔ"  ` ` `* / 1>>!>"0>">ݔ"  ` `* /1>!1>!> `bH1>!> `b` `*. 㿘! ( @r!H /* %>@HH &H" "H& H 0 㿘H /* % ` "` "H 0  H(>@H   @  HUser command with no buf User command with no ioctl host adapter code inconsistency unknown error category from host adapter code 㿘 0`Y >.5#`0@ 2!N >.*#05 , [ X, Z ,`$*`>ߐ  |||||| $ (" $ $, [ , Y 4 XIj ( ' > #     >ސ#- , [tuser_strat: No ioctl physio split the request.. cannot proceed cmdlen too big scistr㿈 W@2 <>-А!(V `  a >-Đ!@J `2 D  ( `ؐ >-!p: 2(  ` H #\#`#df 2& 4H /* % 0"  !>ߐ !D  0"H 00& 4 0h" 0scsi_do_ioctl: impossible㿈 !t'! |  !"b !An0!hH `& >ߐ!  &&& &&>& &&   * &8&P&D&L&4=<Hn `s04? # @6  6   6   @6 "   6 @#\#`"#d      @"   "    0  0 " "  "   scsibusscsibus at %s㿘`>,"P  : %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun links㿘`.&`( 2`( .`(> `".`2,p ` `2 ّ* &`,>*"`2  #> ɔ `,."@ `, *b@p`2&I `?@E 㿘`   2   " " 㿘?>a   a.  " @  a @㿘  >a 6C a. @ 2 (;     ?`&1  @6-    !  @4 @"`4`@ 0: "``@뀦@  @ `0  4 % \ @_* @ 00* @ 800* @ 0*\2** * ߒ`*V1.9SuperVista S-12 AT3 1.60 ULTIMA V2.9Astra 1200S UMAX 1R08IS60 RICOH 02.2Model 3200 01.7Model 2600 02.4Model 1300 WangDAT 5150ES SCSI5099ES SCSIWANGTEK Python 28454-XXX2.2GVIPER 1500 21247VIPER 150 21247ARCHIVE TDC 3600 TANDBERGSDT-5200 3.SDT-5000 2.09SDT-2000 EXB-8200 EXABYTE TK50 TZ30 CP150 CALIPER 0001SD120S-200 NEC FC-1TEACG0661467ZIP 250ZIP 100IOMEGAjaz 1GBiomega6027MK538FB ST34501FC ST19171FCST296N ST296 ST157N ST125N SEAGATE RO3000S RODIME PD210S SUN0207PD1225S P105S 910-10-94xLPS525S ELS85S QUANTUM 0307D3847 SnapLink MST LXT-200S LXT-213S SUN0207LXT-213S XT-8760SXT-4170S MXT-1240S XT-4380S XT-3280 MAXTOR DFRSS2FKZ-CH3171-S20664IBM0663HIBM 0662SIBMRAID CP16CP15DK515CHITACHIA00MD21/S2 ESDIEMULEX RZ55 (C) DEC1588-15MBSUN0669MICROP 3.30MOS321 DELTIS 0800M2513AFUJITSU3.08OMD-5010 EPSON CyberDrv1.55R2626 JVC 1.04CD-ROM DM-3x1SShinaKen1755XM-4101TASUNSLCDTOSHIBA 1.10CD-ROM DM-XX24 KTEXEL 1.0BCD-ROM CD-56S 1.06CD-ROM TEAC CD-ROM CDU-8012 CD-ROM CDU-8003ACD-ROM CDU-561 CD-ROM CDU-55S CD-ROM CDU-541 SONY 1.01CD-ROM DR-124X PIONEER CD-ROM DRIVE:8411.0CD-ROM DRIVE:210CD-ROM DRIVE:84 CD-ROM DRIVE:83 CD-ROM DRIVE:55 NEC 1.3CDR-H93MV MEDIAVISRENO CD-ROMX2A MEDAVIS 1.0bCD-ROM CR-5XX MATSHITA2.06CDD521/10 IMS C4324/C4325 HP VDRD-25X DENON RRD42 (C) DEC DEC CD-ROM CDS-535 CD-ROM CDS-525 Chinon CD-ROM CDS-431 CHINON %s offlinescsibusprint: impossible qualifiervendor-uniquedirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationscsibusprint: impossible device typeunknown targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sremovablefixed`>(Q"h  ` `  @2  `  >"8" > >> "8>"p>&ɐ""8>"`OВ `H> t*`  0$<HT`xxxxxxxxxxxxxxxxxxxxxl>"">">">">">">"> #> #>#>&y# >#HА& ! p   ` #\#`#d>#P>#>##h#l ' DECTZ30TK50 not configured 㿈 ,.`@.@ ɐ     (@$@`$``$`` $` `$``$``!$`,`,`>$` ,` >"h@kM ,9     *  >"h  * >"h  >   А >b @j  > b( > >b @j  >b0@j >"h>aĔ ` @g쀢` ` ` ,`   > ` h ,` >h  ` `,@  0*@6 0 ,`   h` 4` h @6  `  `0,`0 ` > "h    '>"h'>#  > ,.`@ 㘙.#@ 0  >&ݐ"8 㿘  '82 @ ` 2.2*@jR @j 2  @jG   @j 2@j<@ @j 2 @@$'Ͳ@cd㿐>c   㿘>"&`"` ` "` *`>"&``&`0`(@  2>` &`>&f"Ёcdlck㿘 1> $ !#h "       $ 㿘 `& & 㿘 > :` ܑ*@ 2 0zȐ v < ` + j ꪒ! e ! _ `!4` 2K <`   4`@z 9   @   !&  `6) . @ !     8  8*@$ 8 4*@$ 4 8 4@ " < `?# @4` <   ꌔ!`?# @4`l㿘  >"ܓ:`*`*`& @ "5    8  8**@$ 8 4**@$ 4 8 4 $ <  S!@ ?# @2 `!   [  ? b 2 $ 㿘 G  : >" <,@` (@k2  -& 4`   %& 4&,$  ` `@@ $  $   2y 㿘  0` `<`@ (k" 㿘 G: >bܑ* @ "  ( <* "@ 4& <  @㿘>#`> #њ㿘>#`>  #Ścdioctl: impossible : >bܑ* @ `#:C#ސ## #  `#0x#Đ  # #Ő # p Ԁ`  q / #e eW# ! `e rI ` # # #  `  mL ` !"uV # #f `  h! `0#"  e gy e f u 00#y o` >ܔ!v   `&` "@*   @g&c   ^     @$   " 0Oؒ@ܔ  I @/氒 @@%8@Ô  0ƒ @/ư '@##\@   @/  @ѐ *@> *   8<  x@K  >G ް ##$ذ  J @3`  ?8`@eB  6>`@e; `(&<!,6H6J&X&&&<@h2` &. 6 !W&&l6 6  *  a >c`@p@ey  %/` h  #\#`#dj ! * *` *  ~&8($`* *` *    c"$`㿀@eA @e>  // /    #\#`(#d, 㿀@e%  / /   /.@  #\#`#d x@e   /6`/6`/6`//6/6/6//     #\#`#d x@d  H/////     #\#`#dԔ x\@d̒  G///////'Ж    #\#`#d湔 x@d  K// 'Ж   #\#`#d椔 㿈 'К #\#`"#d   敘 x@d  B`/ / @///7`//  #\#`( #ds x@dl  C`/ //7 //  #\#`(#dT 㿘ђ   ? ch02009000SPECTRA㿐>c@   %s: waiting %d seconds for changer to settle... %s: offline %s: %d slot%s, %d drive%s, %d picker%s, %d portal%s s㿈>#p>cT&`(" "  2*@`\>#x (``\*"@ *`" *  =q* @  ># `.`0`D>#`># >#`L >># #`@#\`@ 2>># ##``H#d`H 2>># ##h`0&`,㿘>c,  6# c,. @ 2 ( `   2` (^  @-    (? c 2 > ,* (? 2  㿘 >* ,c@ # #@  _  #@"Q#@"?,#@"+,H( #@"(@A( #@ #@4( #@-(@1 -@} )@ %0" !"?@$0   ,0" "@"D"H" L "@ ^x@4K `4G *`@`?@4? * @` ?@ 5  P: 2`2. ` 2 `@ @bԠ  /,`4`/, 4 /4` ,4 ///2 ``/ / (a   #\#`#d䲔 x@4j `4f ` 4b *@`?@4Z *@` ?@4R + `@`?@ H  T:  T: 22< `2` `2 `@ @bp  /,4/,`4`/, 4 /44` ,4 ////2`` / /`  / (a   #\#`#dC x@ * / @`?@& 2` @b*  +/, 4 / ,4 //2 ``/ / (a   #\#`#d  %s: warning, READ ELEMENT STATUS avail != count 㿘.``@ $R   `0 @J$ <``@` ` *  @e*   v `0`@@0 "````@*  >   ] ` , `@7` ܒ x@a  /6`//6//7 /7 // (a #\#`(#dご %s: could not sense element address page %s: could not sense capabilities page h@ab ؐ@a^  / / /   p / (h#\#`H#d >E"0ސߒ * $ 0* $ @* $ 4* $ D* $ 8* $ H+  $ <* @a$ L@a / //   / ( #\#`#d >"`1 0 P@`  T@`   *`P *`T (`  2`㿐& \>cd  9` & \sd㿐>c  & %s: drive offline %ldMB, %d cyl, %d head, %d sec, %d bytes/sec, %ld sec total 㿐&` ` .aD>#"` ` "` *`>#&``&`0`(8@i  2>` &`>!>!` `    ᘔ!` @V@ ` @Q@ ` @L`  >@  >! 0!>!0@] @c  #\sdlck㿘 1> $ !#- "       $ 㿘 `& & 㿘 > :` 㔑*@ 2 0~Ȑ z < ` / n Ē! i `  ! _ `!4` 2K <`   4`@ 9   @   !&  `6) . @ !     8  8*@$ 8 4*@$ 4 8 4@ }" < `?# @4` <   ࢔!`?# @4`h㿘  >#:`*`*`& < "5    8  8**@$ 8 4**@$ 4 8 4 $ <  i!@ ?# @2 `!   q  ? b 2   㿘 G  : ># <,@` (@aH  -& 4`   %& 4&,$  ` `@@ $  0   2x 㿘  0` `<`@ (}" 㿘 G: >c* @ "  ( <* "@ 4& <  @㿘>#> "㿘>#>  "ךsdioctl: impossible㽘 ` : >#*@ `   m@"w e e@8 p@ ``e r@# !@ `` !@"mV   q@_  h@ `y` e g@r e f@ n 0@ w  5W!r   &*"*   @g&e p `     @H$ 2  e g@2 `4` *  a  > @tc  g" 0=<     ?$ 2   އ@ * " %  ` !2` 2 @ `` ` !"@    # SCSI opticalSCSI disk%s %s㿘@]D!@]A"`&(`&0`&,`@`&4 &8 d&8 6aD >b>b@\ `@\`@\   >cu`@\ `(&<.6H 6J&X&&&<@`L2` &. 6 !W&&Ӑ6 6  *  a >c@x@\ @\ݒ  // /6`/6`/6`//   #\#`#dĔ 㿀@\ ,@\  // / p  , #\#`#dި P"& ; 3 @\  / ?/ / p , #\#`h#dޅ  ˑ* *`  && @. .@_ @_6&  %s: mode sense (%d) returned nonsense%s: could not mode sense (4/5); using fictitious geometry h D  ? c 2  Ȓt 2+ ,ؑ*  4`ӓ*`* @@ $` "A` <`2"$`ܮ$` @_Z`@^L,`C 2#,ݓ*`@4`ӑ* *`  $``,`@_8 @_6  $` ` ( "%$` 2  >>">">"c @,@ ,`4 4`"$`$`  㿘   ? : * >c* @ "`* @ ` ?`   ?㿈'> 2l  $ ` `> :*#"@㔑*@ (@] N @^.` @Y.  ` `@ @ < : >4"@[R  */6`/6`/6`//6//@[C h ` & &  &  & &  @^}& & (& ,& 0& & $ @  $  @ _(*`` *????5150ES SCSI FA1501 AT4000s HP 263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21531VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 3800 TDC 3600 TANDBERG st㿐>`  ޘ %s: %srogue, drive empty density code 0x%x, %d-bytevariable blocks, write-%s protectedenabled㿘> &`D$ $  , @H>"0`P` >"8>"@>!s   >@Ò >>d"H&a`\_"X`X`$>>X"p`(T"x`( >">">"H &a&``&a ?# @4 㿐>`  L_` & P& `& ,@" 8㿘 d  P l  @Y  * ` " ?$  *  ,@  * `  %s: already open 㿘 >` :H `*@ 2 D0@`  : >!ے 5   e $` 4`%  <`2 ( @Ҕ  ((`@Z$ <`   (  $ ( @ `?# @4`㿘>6 ` <@ ( !   @   " D   ? D ? D       ?    @? Dc  2  %s: cannot set selected mode 㿘 > >`* @>  ( ( Db  @$ ( ,@ * d `  @$ , Qϒ  , @ F@] A@ < ,`*  l \, 4 ( ?$ (  ,`@L 0!*  h $ 0 ( $ (@ > є!@ ( ?($ (  4#X 㿐 (( D @t @ @ @ ٯ!@` @ @ ( 7& (? # @4  H" 4 L2 4 (" 0E%> (llllll ( X" ("" 0"" 0`" ( ,  X2 ( X (" ( X" 0 (" 0" ( 4 4  (& ( ( (" ( %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d 㿘 G>` <: * >@`(  `0@VV >#X`8 `H >`L   >#`L(` & 4H /*%& $`(& (("@ $@"(H 00 0(& 0 <~" @%s: not queued 㿀 D `  ``?# @4`W0  $` ("`(&! (" (h`  `?`c 4` 0" 44`"" ( 0@2 <  @ " ($ 4 0 <h" 0~7" @S `$ 4 0$ @ w$ 0 (   <$ 4 0$ @h$ 0 ( ~& (: `@Wg  0@   / (% > & (/( (   / <@T 02  <2 /2 //  H <c #\#`#d: " `> f  ` 2l`㿘>>2 `< #D  㿘>>2 `< #D  罖 㿐 !@ :>`* @ 0: 4  !@!@ ѐ 0  !@7 ʀ @j @Vْ 8 4@ 0$` 4$` h$` t$` $`  $`$ l$`( x$`, $`0 $`4 ( (` 4` ((" @` 4` @4` B4`4 @4 BT@``>!*` 84h4먐@%  @K  &@ @  @:   @}  0 @E  @?~ @ v  Ζ (*@9$ ( ( 4$ (@Ob`2 H ( ?`@  L  @ S  L@$ (M  ( $ ( ($ 0 $ (`EB  , 4  <  Do6@ܒ >#X; , 4`$ 0 ( %$ ( ( ?!$ (   T@   ,0,*  0" h `  *  4* l ` *` 㿀1 @UӒ  / (  / 0`@Se: 2`/2`//6/6// D  #\#`#dק x`D  % @U  /!0#\#`h#d  ׉  *`@$`H * *`  $`L0 8  D@Un  //!0#\#`h#d ^  "%* *`  & T*`* @@ & X. \  ( ?& ( 8,͒   40 , 8 D ` 9 @U'  //@U  / `/ 4/ (' `/ ( "  8 02 /2 // 8 ,!0#\#`@#d  㿀@T  `/ /6" /#  D   #\#`#dה 㿀"# ( 8`0B ("0>`4 =9`     " (I (""' ? =  `4 ?߀`6 ( ?& ( (  ?& ( ("` =& ( ` (   ?& ("  ?& (`@T  //6`/6`//   D6" #\#`#dr  㿀`( `  (!"! ?& ( ( =ϐ =& (@TU  /6`/6`// D   #\#`#dB 㿘 ( %$"  %  & &` 2  N x`  ٖ 2" ,  `2  @@T  //   D6" #\#`#d x   (  @S& ( //` D!06"#\#`#d   ͚ %s: block wrong size, %d blocks residual %s: %d-byte record too big %s: bad residual %d out of %d 㿘  4 0 4   7 7  * *` *    $  p2? ( "L $ 0@Vِ& (  @ ` ( $ ( ($`@  ` ( $ ( ($`@   ` ( $ ( ($`@ "  ,  2 ,>!  , "  (  2 ( 0>$ 0 ( $@*=  ( 2V  5`2N$`@O & (  @2J  `E ?`< "6 $  2: >!0 $ ^"2   `   `>!P P$ & ($`@   2? , "  (  2 ( 0>$ 0&2 ?"$ ( $`& ($`@ ?㿘$   6 v #$$`0`02`(`(    ?$`(   ڔ  0 `04`0   Fujitsu M3096GM3096Gm FUJITSU UMAX UG-630UG630 UMAX UC-630UC630 UMAX IBM 24562456-001 IBM Ricoh IS-410IS410 Ricoh IS-50IS50 RICOH Ultima A6000CA6000C PLUS Ultima AT3 AT3 1.60 ULTIMA ssC5110A C1130A C2500A C1790A C1750A HP 㿐>c  ~MUSTEK㿘>c>"&`," " * @RA  >@$cp @R4 2@$@ $&`0&`4 d6`86`:&`<&`@ .`E.`F.`G .`D&`&`|`|&` %s: %s %s: generic scanner 㿐>`Д  @-` &  $ 2&  `>. V@   0 >   !>/"`@Q ,& Ԑ . V%s: already open 㿘 >`:  6' * @`2`,    >!h Œ`  !!O  ?# @4    4 㿘>6 b < @ 쀢`" (@   ($ H ?$ (  ,? c 2 㿘 G>b: * @ ,  @ 䀢€㿘>6 b <@ ( > ܀`" (@  ( $ (>#> "ܚ㿘 G>b: * @ <H 8& < < "& @H /*%& $X(& (( "@ $@"(H 00w%s: not queued x , ` D?#`  4`09 | 6 $` ("`(&  (" 耢€" `@PВ  (/ < 2/2// Ha <#\#`(#dһ " `> 8   ` 2`㿘 >2 <c@ :#@' 4  #@ #@ )  ` 0@ ( 0( (0# ؀€@0 쀢` -@  ( ? $ (  -  , ߻0 ,@PW  $/ 0///@PN 0 `  (`/2 ///`2/` 2/` /2`/2`/2`/`/2/2/2/@/2/2/2/`/2`/2`/2`/ / /`  "` / `  ` 8` ` "` ` / ` @ ` "` `/` i4` g `/`%/ ` " `/ /  !  ' " * * * @' `$" `/Ƒ2 /  ##\#`#d  0Ѫ 0㿈  3 2  ,`*2c#\#`#dђ㿈 , *0` h i g 2*2 2 *2  @ *1 2*2##\#`#d   6i h ,@Oa  4// /a"#\#`(#d ؘ O > 8 | *`* @`<@ @* &`< %s: MFS-06000CXMustek 6000CX Flatbed 3-pass color scanner, 3 - 600 dpi MFS-12000CXMustek 12000CX Flatbed 3-pass color scanner, 6 - 1200 dpi 㿘. V>#@ > >cH` @O9  > . V> 0#X>c` @O+  2> . V> "#>#& ؐ# &  &  &  &  &  &  @!" 㿘 ( " ` @W "`  @Pڐ$&` ` @PԐ$&`@ @Pΐ$&@` @PȐ$@ a&`` @ #؀@Z X`!@@8] `!,  @P* 2 $` !,6`  @P* 2 $`* 2 "U16` *`2 27 ` @LĐ?$.`? H! `@L?$.`?  `@Pv $.`? P8 `   i4  g   V 0* &%ߔ (@ 㿘 P@Q T`<2 @PO$&`<P ,@}ؐ@N3  /ؐ /ܦȐ@N+ / <@PՒ   @@PА   0@Pː   4@PŐ /ɥ4//˓4 //ͣ4`/Π/ϡ4 /##\#`#d    2}@M  // /@M  / 8!,8?@P /@L- d / E @K}?/ F @Kx?// G@P ?/ p//##\#`#d    2A@M  / / 8!, / D " h" i g   # @ H PĐ X/##\#`#d   ϊ  2  <@y   㿀 H  ,@Mt  //##\#`#d   e   %s: not queued 㿀 ,@MT  / P@P T`<2 @O 3`/3`// `H `< #\#`(#d7  >" d 0 L H"& L`<"@& H mtkrdymustek: lines actual(%d) != computed(%ld) mustek: win-size actual(%d) != computed(%ld) x ,@M  / /##\#`(#d    27耢   >#>X >֔#\ L* *` ꀢ * @ >#  @P H@ ># 0耠`  㿘 D "  i   6 T4 0 g 6 T 0@O 8@OS$ T & P` ?` ?& P 4@O :@OC$ P T@O& L@Oؓ2`& H %s: C1750AHP ScanJet IIcC1790AHP ScanJet IIpC2500AHP ScanJet IIcxC1130AHP ScanJet 4pC5110AHP ScanJet 5p set_window failed compute_sizes failed 㿘. V>" >b` @L  > . V>z">b(` @Lu  > . V>l"0>b@` @Lg  > . V>^"H>bX` @LY  > . V>P"`>bp` @LK  > . V>B"x>c& ؒc`& `& ` & `& `& `& ` @$& > "@  >">"%s: set_window failed %s: compute_sizes failed 㿘@ )` @ #؀@8= ` "9 `@!@82 `?* 2 !,8+ ` c !8% `     V 0* &#8 (@̒ >  @ >  R *f0S%s: trigger_scanner failed 㿀@ > @ > >aa`'@K.7@9 > !`%s: not queued 㿀 ,@KR  /`< 2/2//`Ha`<#\#`(#d=  >"j 0 H`<" & H 㿀@K+  /6/6// ,a #\#` #d 㿀@K  /6/6// ,a #\#`#d *f%ldP*f%ldQ*f%ldX*f%ldY*a%dR*a%dS*a0T*a0I*a3T*a4T*a1I*a5T*u2T*a%dG*a%dL*a%dKx> 0`H02> 4`P)2> <`X"2> @``2> 8`h> :`p D`'`` >5`K> 6 T> x, x ,  ,  ,  ,  @JN, > `,Y`6 T> , ,  ,  ,  ,  @J7, > `,B` 6 T> , ,  ,  ,  ,  @J, > `,*` 6 T> , ,  ,  ,  ,  @J, > `,` `,  `,  `,  `,  `@I, > `,` `,  `,  `,  `,  `@I, > T}`> E`v> F`ox$ ۖ%s: interrogate write failed %s: interrogate read failed %s: bad data returned *s1025E*s1024E*s1026Eh`0`4  ?$`0`  `D  $`4  0  > h h> x x ?/@I >R#ؐȒ  H>OȀ  J@ d  `J@  dJ@ 2 L    @ J*`@ А?А * `D $`P*$`P>`` `?@I@/K > #ؐȒ \ >#(`05OȀ  J@ d  `J@  dJ@ 2  >#`    @J*`@ А?А (, `P`T@L$`L@L2`$`H uk  %s: unknown device 㿘>#x>`&`(" " L*>#H`%s: already open 㿘>c  6 c. @`2`(  2> 2 #%` > * (? 2  㿘> `*  (נrdramdisk: multiple attach calls? ramdisk: malloc for attach failed! rd%d㿘>` > 0.!0+ $  4 "`> "`>` @"    : ">@H ,`$$  >a8 @`@ 㿘> 4&``&`0`( > 6 >(" " 2   >8@6 >*`*`"2  " ࠐ *   ` `8>ࠑ(("@ ࠁ 㿘>#> #֚㿘>#>  #ʚ㿘 G:`> *`  2  2/ < & $#  $ 0 0, < T& @ *   0@ 0"@ 8 0    H Hr @" & @ <& @  0& 4(& 0n  : > +    m@"O` "@Pe e@ 0p "@"S+  i e g@e e f@ b `` \@c /'!S O`L  @$ C e g@? 6  *  ? @>cД@O/ +* ( + " # `&`&` &"  `    0  @_@k RAM diskfictitious㽘'>@G5!@G1""$ ( $ 0`2 $ ,$ 4 $ 8 d$ 8 > c @F  4  > c0@F .4 H4 J$ X ,$  ($ <@JZ2` $ ,  4  !W$$ 4 6  *  ? @>cД@"  㿘`>$"a$ " & &  &  㿘@`@=# :&   `&  @ & & & & rd_idle㿘)> '>  8쫖 ?  $ $ <$ $ T$ @*   0@"  "@ @8 0    Hf Hg  @"$ @  0$ 4($ 0m-dmaledma[%s at %s] offset 0x%x㿘`"!@>  "`!@> "p espdma㿘`@F-   > @F&" "   > , `&`4: 0@ cable-selectiontpeauiburst-sizes: rev 0esc11+2unknown (0x%x) nameespP 0, 2  0 8@ &  > &`<@EؒbX #>> @#cP> @E͒c` > @Eǒch 2 `<`<*@"`<@ "b" >  >  8 " > cp@??&`L&`L`L &`L> #`<< @ @&`D `> @"> !`D$@> (@"> `Dڐ#> ֐#> > ѐ#> ͐# > ɐ#> > Đ#> #` >@ @@2> > !&`d> "8"<&`d>"&`p> "T&`h> "l&`l> "&`t>  &`x>  J&`H 28`( 8 > @E5b > 8@E/bP > 8@E)bX 2'8 ''@`H "> @icȒ@  r '>  @y 0> @DbP  `> @#Ѐ &`4"&%s: line %d: CSR = 0x%lx ../../../../arch/sparc/dev/dma.cR_PEND㿘 <@$@d ! ?  y  <$2?  > # <> c!P>   <@ < "@ < Ȓ`"[ <@ ?"@ <@ "@ D @ `  <@ " D@(@2*& @ <*@" L   < " < <@0@ "& @ < " L  <@ 7@("@& @㿘 㿘`@D]  2 t@ 㿘u  <  < %s: start %d@%p,%d dma_setup: dmasize = %d dma: cannot allocate DVMA address㿘 <@$@d ! ?  Ȑ  <$2?  > # <> cg!>   < |` "& \& `!>#  > " P@  \?*@@"@@ 8 & X'# >  X=">  2 \ X   \ X@ޤ& T & P> Ð" <"  D \ <"` D@2 < \ X>`0  > ,@A{@G% <"  <" ~a <`"  <  " @%s: intr: addr %p, csr %b INTERRDR1DR2IEN WRITEENCNTTCDMAON%s: error: csr=%b dmaintr: DMA wasn't activeDRAININGdmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: empty esp FIFO of %d dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d 㿘 < 4>#  > ! > !8> !h <  # <> @8 #@?0  @ 2 <> !@$@d ! ?  ɐ  <$2?  > # <> ch">   D @`2 < <@ @@ "@ <@ @`  ! ?    < 2?  > # <> c9"> А! < }" X )& @># " \#> €a\@€   \*€ \ @€     \@€   ># > ! j 2, X\@€ \@€  *  e`@ \@€  * @@`2  X X@@2 X e @"  X,>#   \> €\ @€  e`@ \@€    > \>a4€>  2  ` P " ` T@ݻ X `@""@ \@ "@㿘 <@ > @8 ="@ <> !h` " n  d@ lebuffer[%s at %s] offset 0x%x㿘`"!@> U#`!@>Q#p 㿘`@A  2 @ burst-sizes: %dK memory nameP 0, 2  0 8@ &  &`@8&`D 8 " >c@??&`<&`<`<`D &`<`> c :` &`8``(w8  ''@  >@`@   '>~ @ qec%s at %s offset 0x%x㿘`"!@> ǐ!!@>Ð! 㿘`@Aa  2 x@ #channels: no channels : invalid number of channels: %d burst-sizes: %dK memory %d channel%ss nameP0  @A &`4D&`@4 &`D@v&`8 8 " >b0@s?&`H>g"@0X >`"P0Q>bx@_??&`<&`<`<`@ &`<`>"c`H:` >">"B &`8``(8 "' '>0"@@= >@b@N  @b '>ﲖ @, ranges%s: PROM ranges too large: %d 㿘 8>`@ g  & P> Ȓ 03@Ch & L 8 P@ L &`4 @6 L  P`0 @2`4   @" `0 P  @"``@  Lޞ`0 `4"a<`""a@  L `0  P 2  L 4 # 4 P # 0` ` %s: reset failed. 㿘  4 $@@  Ӑ ? 2 @>"x 0@= H$` ` & T H @@=ۓ*`$``& X H @@=ԓ*`$`$` < @ 2  @< $@be㿘`@? `?: expected 1 interrupt, got %d board-versionchannel#burst-sizes pri %d: rev %x address %s 㿘4``@>*#0>c@(?&a 0  @ٖ 4&a<  @Ӗ#`&aH  @͖ &a&a  4@&a>c@ ??&a$&a$>`@??&a( <&a(a( <`4 &a(>&`4@t&`8` @_` >t>C@ ?( # E ! # ?  #&` ! # 4  #&` & * ! & $  &&` ! &   &&`  (   (&`     &``6``T &`@>#$>!$>!|$? "44!>a } o`h F 8 >@?c `@"&㿘 4 $@ @6L# "/$L  & & $  ?& "#$L ( ";@,``a<  8 " "@" D  $D 4$6 4$L㿘!"" !"   ?" !b !" ?!"# !#   ? Q !# ?㿘H /*&Ӑ@H 0%s: device timeout 㿘 >ah  `" 㿘!! `! !``@|`@3``@` @%s:%s qstat=%b unexpectedRXSRXPRXLRXSMALLRXDROPRXTXSTXPTXLTXDTX BE%s: resetting 㿘 2     `  ` >"X >"h>"p >i">"e m%s:%s stat=%b RXRCNTACNTCCNTLCNTRFIFOCVCNT TX TFIFO TMAXPKT NCNT ECNTLCCNTECNTDTIME㿘 @ >#p >"h>"p >5#>"1 9㿐!@D @H  XL  @$ X"@"D"H"L!D !H !<* (' 2&!H 4 P {4 4 $ P !D? &!D&!H!D "4 2 㿘!P!<,  # @M  `!<! ?"@*  " !" !<,  &!P 㿘 @H /* & !2  !1= !  !H @0!5=0 !69= @`4 4`4  @H @\В0;`4@  2`4r`4 ?/4`4  @g@.0$ƒ @` @ 4@  &   $  H 00H 0㿘!! @! H /* '&!0!<  !<@׽ &!@!4  !4@״ &!8 @ !<*  "* !8 @#(!< "(    !<* :` * "!8* @# !<" " $ &!D&!L&!H&!P@t@ސ  *  $c  *  $c  *`@ $c ($c @5  $b  $bP $@!@$ !@($ !$@?T$ $ $$  $X $ , ,$ (>!_$a$ $ $ $  $b,$ 0b  $b c  $c 4 @ ;44H 0!    ?#d ?#d#%s: rev %d PAL not supported. %s: no internal or external transceiver found. 㿐!ِ! `>"x 0  $  ' $   '   &!,?  ?&!,$'0>"_ %s: invalid tcvr type 㿘!,     >#J L1? @ߒ @ܒ @ْ @֒  <@ђ `? `>@@ɒ `?!, @V@T @Q *?@@J@H@F@@ @ *?@@ @@㿐a, a $  ' $   '<  2  > $  ' $   '*  2 #ђ`㿐a, a $   '  $  ` 2`'0 > $   '  $  ` 2`'0#`㿘!,    ># 0/ @, @) @& @#  <@@ `? `>@@ `?@ @  .2 >@@ `?!, `(! !#d! (! !#d! !#d#㿘 >H 8'>->#P >H /* 'V*`@`?2`H 0  "rVH /* '>O @"@> !2` ?* *   P"@` $P $` H 0 MV`` &@ * @a4 @ @MH /* 'V*`@`?2`H 0  "&VH /* '>O @"@> !2` ?* *   P"@` $P $` H 0 V* ɳ 2p %s: invalid packet size %d; dropping 㿘% @>"X T L@ 2 H L $ L ( $ H`  A? u㿐  >cT ۢ @ 4 H /* '>H`8` 2`H 0 $$  $  4  =K 2$  > $  b'  $ >H 8->- & >cTǜ   4 H /* ' 4H 0 $$  $ 4  <Ӓ ʢ l :9H /* 'P   <[P$ >O @" > !2`  *  ?$  %PH 0  "  $ ($ $ $  4   2(8 $ `` &@ !4*   &%@㿘 \a "0 2  & & # #&`=  `   ?&`%s: bmcr reset failed %s: selecting 100baseT4%s: selecting 100baseTX%s: selecting 10baseT full-duplex half-duplex %s: bmcr unisolate failed 㿘 ` p     %    ?< 2>S" ` ``  >>". `  2 `>## `  2 `,>#  `  2 >!!> #8b!> #H }"  ?],   $ F ?< > #X  㿐 @`4!!#  @$# 0V# ?$# `4"?#$#@$#D$#H$#L0I?#$#@$#D$#H$#L`4@"7777`   *;n #  @8  ?     @23 ``$ 22*   * @3   ܐ$#@$#D$#H$#L`4 =4`4qe㿘`@8$ `?: no interrupt found on parent mace-versionchannel# pri %d: rev %x address %s 㿘 D`@>\#0]>c(@[?&a0  @  8&a<  @ &`&` 4@&`>c8@D?&a <`4&a >&`4@&`8`S``T &`@>!$>#H$>"$? "44e@!>a!#H`h  8 >@7b `@"&㿘 4 $@ @4( "/$(  & & $  ?& "#$( ( "@,``a ' 8 " "@"    $  4$6 4$(㿘!  ,   Ȱ?    ? $@@   Ȱ? @ ?㿘H /*&Ր@H 0%s: device timeout 㿘 >bA  `" 㿘`a  *`2 a`#߀ @?  @  @-㿐!  @ !$ !* (' 2&!$ 4 P {4 4 $ P ! ? &! &!$3! "4 2 㿘!,!,   #  @| `!! ?"@* " !" !,  &!, %s: excessive tx defers. %s: no carrier, link down? %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... 㿘 @ @> h T $ T@ >!] T  $ T@ >!(R  T $ T@ >!HF  T $ T@@ >!h:  T $ T @>!. @>!& @  X  Ta$ X!$ T@>! @ >!   T$ T@ >!  T$ T@@ >"  T$ T@ h X  La$ X!$ Ld L !$ Lb L !$ L >"(ђ L  $ La >"@ǒ L  X`$ L $ X``@ L !$ L` L !$ L >"X L  $ L` >"p  L $ L` >"  L $ L` >"  L $ L` >"  L $ L `>"v`>#pА?㿘 @H /* & !#  ! E @ !2> !1 : '!1`4 4`4  @I @Tr07`4@  2`4n`4 ?+4`4  @c@/0  g @ @ 4@\  @롖 $  H 00H 0%s: no carrier 㿘 ! @ H /* '!  !@_ &!!  @!@V &!   !*  "* ! @#(! "(   # !* :` * "!* @# !" " $ !$ !h$ &! &!(&!$&!,$ $ $ $$ !@7T$ $ $$  $X $ , ,$ ($ 0$ 4 ,` ,`,` ",`  `,`  \,` ,` ,` ,` ,` ,` ,` ,`  ,` ,`,`,`0 #P ` >!X  `@4 @ ;44H 0㿘 >H 8'>->#P >H /* 'V*`@`?2`H 0  "rVH /* '>O @"@> !2` ?* *   P"@` $P $` H 0 MV`` &@ *  a @ @ OH /* 'V*`@`?2`H 0  "&VH /* '>O @"@> !2` ?* *   P"@` $P $` H 0 V* µ 2p %s: invalid packet size %d; dropping 㿘% @>"P T L@ 2 H L $ L ( $ H`  ⁒:A w㿐  >cT ݢ @ 4 H /* '>H`8` 2`H 0 $$  $  4  6M 2$  7 $  b'  $ >H 8->- & >cT   4 H /* ' 4H 0 $$  $ 4  5Ւ ʢ l :9H /* 'P   5]P$ >O @" > !2`  *  ?$  %PH 0  "  $ ($ $ $  4   2(8 $ `` &@ !*    !&%@㿐 @4! [ "  ,   , 0L7777   8;n  #  @2   ,  , , 4"#44?     `@2?3`$ 2`2*   * @3   ϐ ,  @ , $ @ ,  , hmeSUNW,hmeSUNW,qfe㿘`@1  >@1#  >@1ސ#  @ : expected 1 interrupt, got %d : expected 5 registers, got %d hm-revburst-sizeslocal-mac-address pri %d: address %s rev %d 㿘4``|> @0`> `00 8@ $a0< D@ $a4H P@ $a8T \@ $a<` h@ $a@>`$`@@ؔ? $ad $adad  `!$ah>`@Ŕ??$a` 8$a`a` 8 @ @c$a``((>""$`4$`8@2`4>`a @k  !>ꤠ ad햒$`\>%!$`p>$#$`t>%"$`x`D<>%>%АU?``   "   " `Δ $>#$> !$> !$? "44䥐ꀐ( 4 㿘 4 $@ @6# "/$  & & $  ?& "#$ ( "8@,``` l  8 "4 "@"   $ 4$6 4$%s: stop failed 㿘!0 "@!0     X !0   2 h>    h ?& h㿘H /*&ِ@ڐH 0%s: device timeout 㿘 > ap뗔  А`" Ё㿘H /* '  |R   H 00^!2@ !1@; ! @ !@"4F 0!5@;0 !6@7 0;4 44  @}O’0-@  24n4 ?"44  @c@d0鹒S 4 @  DH 0㿘!p 2!x!l@ɔ &!p!x 2 &!p!@!t@ʿ &!x&!&!&!| !l@ !x "h"h `&! ! ** !x # #@  %s: burst size unknown %s: setting rxreg->cfg failed. 㿘!@!<!0!4!8@{ |?#$!h "  ?$@@!$#!%* @ $bP! !!*  $c !"!#*  $c!$!%*  $c $b, $b$b!p%`!p(% !` @  $  $ >! x’ $!$ % ,   `% %@ @>! 뭒 $c @͐ b $$b !h  "$@b  $b c  D`$c "452 @ ;54㿘!h  !@?#"`` ?"`!h ?&!hА ȁ%s: reset tx failed 㿘!< $bb   ?? >!#b %s: reset rx failed 㿘!< $cc   ?? >!#xF %s: link status changed 㿘>!#7  㿐!<HL |D `X@  @$`X"H"L"D"@! !|, (!l @w &&!| `4 `P {4`4 $`P !? &!&!|! "4`2 㿐 |! !l, R 2`@`L $`L@ݒ!' , !l 9@ " ߒ&! %s: stat=%b, resetting. RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVP㿘?" >"!>" ꔖ 㿘 ?a0"a B@D@u㿐  >cT Ѣ | 4 H /* '>H`8` 2`H 0 $$  $  4  1A 2$  2y $  b'  |$ >H 8->- & >cT   4 H /* ' 4H 0 $$  $ 4  0ɒ ʢ l :9H /* 'P   0QP$ >O @" > !2`  *  ?$  %PH 0  "  $ ($ $ $  4   2(8 $  !t.`    &%@㿘 >H 8'>->#P 2>H /* 'V*`@`?2`H 0  "rVH /* '>O @"@> !2` ?* *   P"@` $P $` H 0 MV.`***@at @ @H /* 'V*`@`?2`H 0  "&VH /* '>O @"@> !2` ?* *   P"@` $P $` H 0 V*  2p %s: invalid packet size %d; dropping 㿘% |>$   L 2 H L $ L ( $ H`  3 ߔ㿐 |`4!!<#  @$# 0_# ?$# `4"?#$#@$#D$#H$#L# ($# 0O?#$#@$#D$#H$#L# ($# `4C"7777`   *;n #  @,  ?     @23 ``$ 22*   * @3   ܐ$#@$#D$#H$#L# ($# `4 =4`4!@ ` !@ !@  㿘!@" ``!@  !2 !@  "!@ "@@ %s: mii_read failed 㿘!h  #!@.`*  ?#$` ` @     ` ? 2>$#' 0- $`       >@ ` > ` > `$`㿘!h  %!@.`*  $` ` @    2 ` ? >$#֒ B ` 1?#=  $` V   P M J G  >@B `? >; `?$`> :*? 2/,㿘 4 | 㿘7 D l&` h&` l!<" " "" esp㿘` @+ "  > , `q&`4: @ dma: expected 1 interrupt, got %d pri %dinitiator-idclock-frequency espattach: no dma foundintr㿘 >%c@* >!&`\4`?`>%##0>%#&f 2&f0 8@Д &f$&   >%c@~  &f&>%c@~?&f&f["&ff `$ (&ff@(_b@`&f$&& 4`>%@# $&" 4>%#>&w  .`e f.`f`e`\`.`d `\@€ _  .&f.`e`\  .`f`\   .`f`\  `\@€ ".`f  `e `\@.`e  &ff@(#f`&f``>">"@&f &f@&ff@'$&f@&f>"$&  >`&`$>#P$&$&&@&>&`ڄ`( 8 (>%@)c0 # < @@0 >%@)c0  ?  `@ @wW >a>b> "`@wL &*` &*`( 㿘& l@㿘& d@㿘& p@㿘& t@㿘& x@&< &@audioamd|QEB;632*+,%#"""-+2LCBCA;;=43422$1*{*+#+,B.#%$+$#""A"#"3J!2,b2q"4R#z5& *c  # 3   > L!|"3"B2'"R:31,#"bQB;32*,%#"!  C3@DA1U BA` Br!" audio㿘>  >'@(#`? : expected 1 interrupt, got %d pri %d, softpri %d intr㿘!0`>'#203>'#  + `2  N0  @ޖ  N.`t&` .`v.`w.`x.`y@ >N`"cp>*@`>)#&`4&`8 @`4>(`)`>" ?Ŕ  !* *  E** *  C*  *  @2   " @" D" |" " " " "  㿘@Ð@& @?    @" mulaw@ >("` 2` "` "`"` >' vR ( H2` x(2`& w(((0 >'R(!2`$2`">'R*2`$2`" y `-*`-H( i* `,* c* `!*` 0* f* `'*`&0* d* `#*`"0* e* `%*`$0* j* `-*H  D2 "   !( ( " D" " " @ "   D2 " |  !( ( " D" |" " @ "    !( (" D   !( (" D 㿘>aj 0 `2 `2 @ 6 ` " `   " `  * v* w* x `2 `2 @ 6 w" v  " x *` *` *`   micvolumespeakerheadphonesmonitorinputsoutputs@j>)4(LxP "` "`?"` "`$>)-"` "` "`?"` "`$>)"` "` "`?"` "`$>)"`"`2`  *` "` "`?"`$"` >)"`"` "`<>)"`(2`, *`."` "`?"`$"` >)"`2`*` "` "`?"`$"` >)"`"`  㿘  H /* %  @(  |@" H 0  @ H /* %   @ ` H 0  @ 0H 0 />%/>[ᐬ%/>Np %   ,%+>``+?P `-`0+-?P%  ,% +>``+?P `-`0+-?P%/>∁@̀bwtwo㿘>  V` 26 `@&X  2/ ` &` 2 &  ? >  2  2 @bb  E"`4 @" `4  ?䀢  `@ &` bwtwo/p4model: %s, %d x %d (console) cgfourcgeightunknown%s: %s overlay plane 㿘 `4>"$ $$ ( $ `   @@ $ ,0@  $ 0 &`Ȑ0 @ &`$ 0 &`   6. >30,/0  %@  ,@ 0>*2  Eb2   E @ E &` &`&` &`ܪ>*!>*@xc0&`4 &`8$&`#&`ؘ $ @`o @)  $ $ >* # >  >>" , * J  >#@ > ?  >W!P >#@   $ 0 `@x$ @֒ ">*>*Ა# ,@@`  `@``ᣐ#(``( ,@@>`   >*#@>*#0>*#8>*#Hᆒ`>  >W!P ,@@`  @_G>b   b(   㿘> . b"@@"@ 0 "@ 08&<&@&D& H&L &@8 &@N   㿘@E bwtwommap㿘>" > 0. @@>,߯ ``?L@> ܀`А@* ̐@ 㿘>  2  ؀ 2  `@@@`א 4@6  6  㿘>  ` ؀ ` `@@ 4@`0`Њ@ Ъ@0 Њ@ ?Ъ@0  ` @ ` *`cgtwo㿘` &`  `@$T   >  V` w0>,?@@W  : @ cgtwoattach: impossible bustype: %s, %d x %d (console) 㿘>"&`L&`P ` &`,`&`T  >,">," &`8`( $#@^ޘ!&`<> A`,!@!Ȓ@'r&`@>,`4"`0R>  20>" ">J   >#@ 0&`4&`8&`Đ &`&`  &`D`` @ &`D0  $@ &`̐  @@ږ#` &`>,"@_Y`(>W>,">W!P>  `(@]ݒ>b   b(   㿘> . b"@,@ "@G"@ 0P "@9  "@< 0D "@( 0>,&0&4&8& <&@1&,&&,&0& 4&8&<&@&& ,?&$&(,&H&L @@i   &  `  *   (㼘@` C   Б,  @@+  ` ,  А" @@+  ` ,  А$ @@+  `` `   `  㼘@` a$`D ˔ 2=` @Ô 25`@ + Б,  @ 2@ `,  А" @ 2@ `* А$ @ 2@ ` cgtwommap㿘>" > 0. @@>.q!X`?@@ >  @* @ cgthreecgRDI㿘`` &``@"\  >.@"U! "   > ,  & 4: @  model: %s, %d x %d setting video ctrl (console) 㿘 >#8&`X` &`\  &`` &`8   6  &`D  &`D>    >.!>.b@uT &`D`4 $#@\͘>.a@! 2`< &`ܢ`<@%^`T>`,?@@%V!&`H&`L>.`@"`<3>W!P >#@   &`P 0  @ۖ&`P0 @Ֆ `܀ '&` ` 2$0 >#L ` `  p >." @  @ ` * @ ` ,`0 0&`4&`8 &``&`$ "``@  $ s$  $ $   >.>.̐"@] `4`Ɛ"Ȁ``(7>W!P`4@[>c$   c$(   㿘> . c$"@,@ "@P"@ 0T "@: "@D 0H "@( 0B 8& <& @& D&  H& L5& 8&& 8& <&  @& D& H& L&&  8?&$&( 8&H&L @ c! @ ! @&  @&@   㿘@ ` @( 2  :`((@ :*  Ԓ " " cgthreemmap㿘>#$ > 0. @@>0ۗ `#@? @#@?@ L@ >? ̀  @@* Ȑ@ cgfour㿘` @ t 2 `>` `&` 2  Ғ ?"  @\  @  `@ &`%s: ignoring; not a pfour : cgfour/p4, %d x %d 㿘`(>#$ $$ ( $ `  $ , >0@@0>0"@܇`0P  @> $ 0$  $#@Z !$ $  >0 p"`>  0>"">J  0>#@ 0 ?@ &`0&`4&`8&` `&`"2 *`"""?">0:"x@Z>c|   c|(   㿘> . c|"@,@ "@P"@ 0T "@: "@D 0H "@( 0B ,& 0& 4& 8&  <& @5& ,&& ,& 0&  4& 8& <& @&&  ,?&$&( ,&H&L @ ! @ ! @`  @Q&@Q  cgfourmap㿘>#| > 0. @@>1C"`#@ ?@ 4@" 0@*&@#@ #@  @@ ?@>  @ *  @ 㿘@  㿘@[Z (㿘 (@[Y:`((Ж@ :*  Ȓ *`" " (" (" (" <cgsix㿘`@  * ` &``>!    `rm0>,?@@ 6 ?"  @Z `  `@ &`cgsix/p4modelcgsix on mainbus? : %s, %d x %d, rev %d (console) 㿘 `4>#$`$$`( $``   0$`,0&`4&`8&` @&`Ԩ&`ؐ @ &`ܐ @*&`@ &``/>2!*` ʀPPd `,@@>2 >1#>  2$`0 >1 #>2`@q>2ښ 0}$`0 $` $#@Y `@!` !$`$`>2`  `ڂ>  > >`,@ " ">J   >#@ > ? 8 `>W!P >#@ `>2@ :` `S6`@%  2 *b`h$"h">2>2> >#䀢  0  @&`P@Yu`4`.!``(>  >W!P`4@W>c   c(  㿘> #. @3 㿐> .  c"@@"@"4 8 "@c"@ 0"@0 "@"X   "@=  "@ "@8  "@0 "@N  & <& @& D&  H& L& 8&& 8& <&  @& D& H& L&&  8?&$&( 8&H&L"@!İ"@ה! 2@ V & "V @0 2   6 h ;"h 6 6 6 6 6 6  $6  `6"V !|* 2 ( 2   !@[  w0v&  r&V   !'" @~' 2e   8^ "* 2` :`V $5 (5|  G   6  6 6 6  6 @T &!@&" '  6 "6 V"!@*(N!|$J@L  6  66 @)2   66 ??    R 耠4   ܀@@"@ " " R`쀠`R`R`R`"R`*  ???"R ?28    "i!|"i` :`((@ :*  ؒ *`" " (" (" (" < @ ! *` *`  *` " *` R ꀠ 2  cgsixmmap㿘># > 0. @@>4Ӑ#>#` !>  @* `&@`L : `̐@`* `Ȑ@   ?cgeight㿘` @ 2 `>` `&` 2    ?"  @W  E  `@ &`%s: ignoring; not a pfour : cgeight/p4, %d x %d 㿘`(> p$ $$ ( $ `  $ , >5@@0>5!X`0Q  @x $ 0 $  $#@V, !&`<&`@ >5 ש!x>  0>"">J  0>#@ 0 ?@M &`0&`4&`8 &``&`"@`" "@ s"` "@ "`>5s!`(@UH>`\   `\(   㿘> . `\"@,@ "@P"@ 0T "@: "@D 0H "@( 0B ,& 0& 4& 8&  <& @5& ,&& ,& 0&  4& 8& <& @&&  ,?&$&( ,&H&L @! @J! @  @y&@y  cgeightmap㿘> \ > 0. @@>6{!0`Q?#@?@ 4@ 0* @@ &@ 4@#@-@#@ &@ @@ @#@  @ >3? ,@ @2*` @ @(?!@@:?&@ "   >  @ *  @ 㿘@  㿘@Vk (㿘 (@Vj:`((Ж@ :*  Ȓ " " tcxSUNW,tcx㿘>6@cx   ` &` `?tcx: oopsTCX on bus 0x%x? tcx-24-bittcx-8-bit: %s, %d x %d, id %d, rev %d, sense %d (console) 㿘`4> $ $$ (`  $ , $   >6԰#Ȗ0"`4"`8 "`Ж `    a a8&a @@}&a8&ah  @}*&al  2>6#0[>6@m|c 2 >7@mu` $ $#@TO @ !$ $ >7  >6 Ȓcx>W!P@ >#@ al>7 2`2 2ճ @Ð$ 2 *atalh $"h>7 @>7 P՛  `( >W!P@`4@Sf>`   `(  㿘>  . @ 㿘> . `"@,@ "@R"@ 0m "@< "@E 0a "@* 0[ 8& <& @& D&  H& LN& 8&& 8& <&  @& D& H& L&&  8?&$&( 8&H &L4&P!t@.!/!t@_! )@0# T!p& "T!p@F   !l4!ph ;"h!l "!l@ "  !h" " :`((t@ :* !h *`" " (" (" (" <Rapal2ap(("(al(@("(al tcxmmap㿘>  > 0. @@>8:"8`+?> Ē਀ %>  @ * ?`&@  L : * @*`@ `̀` `* `Ȑ   ?cgfourteen㿘`` &``@    >   2 warning: can't find all cgfourteen registers... cgfourteen with only one register set; can't find framebuffer: cgthree emulated at %dx%dx8bpp (console) 㿘>!&`L&`P`(`  $#&`T &`, &`8@R`0@,`H>`,?@z@$!&`<&`@?8#@40>8#@&80 8@{ &j &jj &jj  &jj &jj &jj &jj< &k 4<>8o#`4&`@`0&`>9D &`Đ@   j*```">W!P@ >#@ >9 8>9 HӬ>W!P@`(@Q}㿘>!! `.    Ho o>a "aH 0  @  㿘> !. Ho o>? "" H 0 `@  㿐> .  a"@@"@"4 , "@c"@ 0 "@0 "@"Y  "@=  "@ "@8  "@u0 "@A  & 0& 4& 8&  <& @& && ,& 0&  4& 8& <& @&&  ,?&$&( ,&H&L @S! @! 2@ @>&@! 6$6$6$6$6$6 $$6 $Ԁ`6"V$Ԑ%X*m 2$(f 2   %@  {0z&  v&V   %'%ܔ @6' 2i   8b "* 2` :`Z $. (.  K   6$ 6$6$6$ 6$@F &%@g&%܀ +$ 6$"6$V" @$*%X@  ($@6 $6$ 66$@2$  66 㿘@t cgfourteenmmap㿘>! > 0. @@>;ж @`#@? @#@?@  @@! 8 & : @ > ?  @ *  @ ** *******`"  ``(* A( A*  ( e* #*  `` *  A  @   **2  㿘@ @( ) -  -  -   ,`@  `*@  `*@  @*@  ` 㿘@ @( + -  -  - ,`  @@`  * *  *.@`@ ` *``Ȗ*   R$*耠` ($$* 2a$$* 2!R$Ҁ?38*  *`$ؒ` "%X`" *% *% 㿘@ @( + -D  ->  -8 ,`  @` @*@  *@   `*@   㿘@ @( + -  -  - ,`  @@`  .@ *  `*`@  㿘!| < !|> "0>!  a| <   ?!x>003f#!x0㿘 #%!| <@"@휐 !| <?2!|㿘 ?##!| <@ "@톐b !| <@?2!|㿘! `  `2  " >  >( >$   2  -!| " -   2 -!|   -  2  !| "  !|>!  #0   %< # %"`㿘>  !!|  <@ d€ !|!?< " !| h@!|`<" @ @"㿘>  !| !     \0D%s: lost carrier on UTP port, switching to AUI portAUI port, switching to UTP port %s: lost carrier 㿘>  2>=!| ->="g !| <@">=>=]"!  2>=>=T">=N"!  >=>=E">=@#0>=#; 㿘` @ز " "`< : @ sbuslebufferledma: expected 1 interrupt, got %d pri %dbusmaster-regvalif_le: Lance buffer crosses 16MB boundary㿘 >>`x@n '>> @g`?>>` @``?4`? >> ݒ0>>  ֒&a&a0@v &ax` , ` @7` 2 `H "   `>>`@&a(`D`&a0&a, $`H@e 6a$ a(@ ?* @ @*&a,>>- &a0 `6a$$|& 8$ &8>K 0$h`` &>"@   < @@  ` >"@ ` @$ hs`>P`,&`>P T&`&`&`>P |&`><#&`><#X&`>="4&`>=#$&a>=!&`a >=P>=͓<   # ͜ $ #>  2a|  # ͌  % ͇   ͂   a % y  %ͪ T>N!>`` $l| "$p><"$l$p@oulUnknown3e/vmeonboardmultibus/vmeie㿘` @} 2 4 6  2  ܒ ? 0֒ ?  㿘 @ 4(@ d4(@ @(@2(@(@?Ȅ(2(@ @@0@㿘 @ d, , @ (( @(ie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s 㿘`D  n>?0&a >?"p&`>?"&`>?"&a>("l&a>Q &a@&`<0  @t &`@> !!?`< ->W"!>?ʐ"`<+6 &`8>?"> (`< @2 '>,`8  @ "`8>?˰"`<a€&`4`8  &a>)€&a >?˜#>- cL> !В:` @ `8?,&a`<@ &a$" N&a(&a >?"&`>?"(&`>?"T&a>!&a> &a@&`<0  @t(H&`@ `< 4?(@ @ +  @t" &`8&`4 (D?!4(D* 4 * 4'`8a€`<`8`8#&a &a &a d`<&a$<&a(̣# 0[`f@ `>?̗#00O` $@>E $`>I"@$`>@#$`? "4`4ʐɥ!>?ɇ#H>a !ȗ* u`( L   >A x&`(&`,@m`(8 4 8>A x&`(&`,c%`(8  >?@ax ` @"$ %s: device timeout 㿘 >@c  `@" %s: parity error (ctrl 0x%x @ 0x%02x%04x) %s: receiver not ready 㿘! ! ` @(@" >A(D 0(D (F (D!4(D!  @ `@ `P`@``@` >A `  `@k& ! ` 㿘%>! !,`!, ` 6`  & `)$ 2 * * 22`*` * 2  2`*` * 2  2`*` * 2  @ & 4  4  4 $ $4 @Ē  $@% :!,"@*`2 *` 2!. :" *2* 4  @E 0 @ `ietint: command still busy! %s: send aborted %s: no carrier %s: lost CTS %s: DMA underrun %s: too many collisions 㿘6 v x"0 6 x*` " @  >AB#     & 4  @'& >A#( >A #@ >A#P  >A#`"   &  >A#x    & `& !  "0*` "@@&!"$&( D "0 `& 2 " @& %s: receive descriptors out of sync at %d .`a,'d2a,%` 2`'`* !,# ?# @2`@ ܐ !!&@ Ԑ  R&d`"   *% @ *%@@ 2* @ @  #?>Ba@P @ ?"*` #@ !!""  l#!0 lܘ  lؘ @ $耊`Ԙ  耢@  @  @  @   @  @  @  2  p "$ $ 耢@  @  @  @   @  @      p  $耊 t    s "4  @ @  @  @  @   @  @   " G E$Ԛ`?  2  p "$ $耊`1  耢@  @  @  @   @  @      p  $ @ $   @M ? &  >cT  !$ 2`H /* '>H`8` 2`H 0 "" `"` 2` a$  0\@? D$ d$ $'\\>H 8->-\ ' >cT   4H /* '` 4`H 0 $$$4  ɐ l$ (= H /* 'P   rP$>O @" > !2`  * ` ?$` %PH 0 " $($$$  4 (8$ \ 2 $ >G# 8$  $$  $% \"V #   "- 2 * @ a "@" $!@ 3@ $!@ @$ !@ -  e2e` 2`@  &* %ܪ ?# @2 @  &-  `d  #& d !> "`$ `   'td'p'h lTh`  Dd$ dG㿘"  "*%@ @  >Ba@ @0 @` 2`* %2 @ 9 &*` e?# @2@ +  &%s: tbuf overflow 㿐 4`@"(@ @d6 4"$@ `l`"0@ *@ b b 2* *2b0@ * @@ 2@@ * @?2 @ "*`@ @`4"@@ '* @", `Ԁ K   $`$`& `ܐ?$`܀ ? @"*`@ @, 2  %      >E Ǒ`ΐ @,2 *"2@**@ @ 2@@?$@`2`@ ?"@@ $@"(@ y"$@ t`l`"0@ *@ b b 2* *2b0@ * @@ 2@@ * @?2 @ "*`@ @`4"@@ '* @ *` `*` *`@ " * @ 2 @ * @ $2`@ * @ 2@ `:*@  " *2`*@ 2@ a *@   `:  #@ +`3 +` 0@ $@ 4`v㿐H /* & ! !€! !€!  !€,` 4$' `,` ``,` `,` , :$, 2 , 4 8 4" ' `, `* `* @ @ d  !  @h `H 0  H 0 %s: reset %s: abort commands timed out %s: disable commands timed out 㿘H /* &>F" u  D%  x @6 x` @& >F"` ` @ >F"T x @6 xH 0 "㿐'! ` 4   @> !>F#!X@* |>F >F#}0@   %s: TDR command failed %s: transceiver problem %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x 㿘6@%6`?6`  : ! &@ +`3 +` 06` 23@@ 2`3@!  @  ``&@@>G `@>G Ų 0` >G  ?@ `>G! ?@ >G!@ řie: bogus buffer calc㿐!$!(!€ ?#< !(3@ &>G"!,!,& "  ` * & "  ?         "a, ?  `    6  , !, @^* !. :"@*`2 *` 4`,    ?* !,b 2"  ?         "eܐ ?  `    6  , %ܠ @* % :"@*`2 *` 4`,    ?* %ܒb 2"  ?  "0&",&"$&"( &    #  "2  4ܐ$'  * *  ?* !&"&  b?&   !. :?& "@ *`2 *`!  2% :!,"@*`2 *` 2%s: multicast address setup command failed 㿘6@#6`?6`"4!  `* !* *  *2*  6` :! &@ + 2+  3` >H@ 2 >H"L  %s: configure command failed %s: individual address setup command failed 㿘  !$? : @! $ + 2+  4`4"4 4 ! ,  , ,  ., ,  `, ,  , @ , , ,  ,  >H  >H# 0H : $ *2* 4`4!4 4 !   >H >H#!  @  `F x !. : @6 x#@+`3 +`!  0 !  @ } `!`@ 㿘  o 㿘 H /* & !@"  ! @" 4F  !2@@ !1@ < )!1 6 4  O D&0- 4 #$! 4@  2 4 4 ?6 4  @20@ DD D`4@   H 0㿘   &   "- "4   D @4    D a x ~6 x  *@ *`@}   &  2 &!xdcxdxddummystrat㿘 <"">>J   H[" 0"& 0 0 ?& 0%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) 㿘>" "` "`(`>J```* @ǐ  >J!(ƒ`- `6"@>J4`!0`¶``6>J`F!X 4`*«2` 6`4``F4` `3,` `/ ,`@ `4` `""`(㿘` @6 2 2   ݚ` ?  .` а"@`  ?ɐ  4   pri %dxdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s intrx0   @i& $`L>*` >J$``#8'$`d` " P? 6" P#`l@ $`p$`l@#&L  `l ~$`p $`h>J#@@Ւ&L  = `l*`h "@ @ * `l@ ` 4 *``l * `l `g * $`l ,a.,a/,a0,a3,a2,a1$`$``$`#\ 0#`    @ 2`l>Jѐ#P0Г,  S/,* `h* @` " >J!>J@#x>J# a1?,a1 2 a.a1 a. ,a. @* `h"  a. a.0 >J # a1?,a1 2 a.a1 a. ,a. @* ,* `h* @"` a. 2#\a.#\#`    @ 2 a1! ?,a1 ,ʐa1,@*`@`h*` a.  ,a. @ *`h "  a.  a.  !>J@m#ؔB`0A>Q!$`($`,X`(>K`Y`4"@ ' 0' '8"'?2 '`@2' @R@ '    '"@ @R. >X>aX p*w `    xdattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! 㿐 `(@E h>"X&``&`06`6`&`&` * " P ! H /* %`  !>L` !( ` `>L!8``C 6`  `#\@Y#` 2!1! ?.!1 , !1, @*`@ h*`!.  .!.  * h " !. `By!.`B`>L !H6` !>L@+!`6`>L!x   ` #\@#` 2!1! ?.!1 , J!1, @*`@ h*`!.  .!.  * h " !. `3!.`!>LX!   ` #\@#` ,  l  2!1! ?.!1 , !1, @*`@ h*`!.  .!.  * h " !. `!.`!>L! 6`6`6`.`.`6` ?2 2   }    ` #\@#` 2!1! ?.!1 , ̐!1, @*`@ h*`!.  .!.  * h " !. `!.`!>Lڠ!  `  #\@`#` 2!1! ?.!1 , !1, @*`@ h*`!.  .!.  * h " !. `!.`!>L" .``(2 26`>L"0````@`@ &"#\>L"P:    ` #\@#` 2!1! ?.!1 , ;!1, @*`@ h*`!.  .!.  * h " !. `$!.`"`!>LH"`` ` @Ơ?@Ð@  `  #\@#` 2!1! ?.!1 , !1, @*`@ h*`!.  .!.  * h " !. `ܐ!.` !>L"@ j`N6` ?#  2 " `@ ~ `2  `  ~  } ~>L"A`H 00)`ٔ"  @OS  >J @͒ `(` @"$ `(@6`  }`H 0  8>D(("   `8 `8(("`8`4(("`4`8`4 "`<%s%c: crash dump not supported (yet) 㿘  >D :`@ >O!P*`*`D&  aɒ` 㿘  >"D :` "D*@` e f@"M  m@"Ve e@0 0  h@0 0  n@" e g@M 0}0 e@n 0wv H /*%`ݔ"H 0c `є!] ` &*"* ` @R&!``@ǔ I` E C4`A  "`` 4`?# @4`2`/ `@ (` 2`< 4``<  $`<4  *  a `>P`@Βcl`8`4@  $`<  @㿀  >D :`6N D*@"H  *&" @p'' ''o"@  )  `6! . @     8 8*@$84*@$484  $<㿘>P#l> #,㿘>P#l>  # 㿘  >"D :`60?"D*@`*" `<*@2 ` p "`?,  ` ?`(@2` 2  \ ?㿀 G>D :` D*@   T    <@(`(  r& 4  " @'' ''"@Ҕ  " < G` ` !"@ " < G& 4 G@ږ  $@   >  * 0v* 0t 0.`   c.`  ?*` `*` *`   ?2`   ?*` 0Z 0.`   c.` * *  *  * "2 * *0B` .`  0   c` `  .` &6`   2 6` .` ` .`  @.`   @@ .`   @z6`   (@ @ &` $@`*   = .`xdnfreexdsubwaitxdcmd nfree㿘` \ 02g !. 23!. @z  2\ !. &!. %>R #>R P} 2K !. !. !1 aXp 2> !1 !1!. 2 2!.!. 2?>R6!h.!. J  h, * * @@. P "`"` "` "`"`"`"`"` "`$"`,"`("`0  Ɩ@xdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space 㿘!. 2?>R#8.!. J  h,`* * @@ 2$>Rڐ#P`("`(& ("G: *  PG` ` !"@`T`*`   H<@ 2$<>R#` !. .!. * ,`*  h* @"`!.  tj!. t&$`(&(`( "$%"`(`&a$ $  $  $ $ $ $ $ :` $ $$ ,$ ($ 0 0@2 , `(@  xdc_submit_iorq addingxdc_submit_iorq wrap upxdc_submit_iorq㿘 L  h .`* * )P2!3[ *!!3 @Ð .!3!0   .!005>S0?>S0 h  @; *! * L2 *` L2 *` L2 *` L =*`  L *` !/  .!/0>S0P>S 7  @  @ !㿘!0  L!/B.`B! B ?֖   `  ? @Ә C ``?  @Ę 2!01 @Ð!/ 8!0& @z !0 B!/ B.`*  h* !.@`    2!. 2 %s: off-line: %s xdc_resetx lC  l@  l @  *@ l`  `  * p Lb@* L2 *` L2 *` L2 *` L =*`  L *`  L  ?   4 L !>T l "! L l!0 @Ϣ Р"@ L *`  L  ?  4 L 4>T(!H *`  l %s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE 㿘 @!.>T"] в"@ L *`  L  `բ `4 L` ? ^  h` 0  2j 4!/?.!/"V!2&` l/   * 2` *`  *  h  8 0 "`0G 4"2!1C 4 "`4`0`0("`0`$`0* "`@`0`,H@0< h 0`< `@ (" "u`0!. .!. *  h" !. 2 4N!. 4J!1 .!1` ? @ &` ? .!2 *!!0 .!0 4  $ h@, 2 !0!. "!0&!.!0!/!.!1   ` >T"   >T >T#( >T#Pxdc_start㿘`"!0 J@ .!2!0.!0ʔ P ">U"p !0  L "!2%s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEAD㿘 L ` @ ` #>Uc @{O ? >U#8C>Uڐ#P `  *`   h` ǐ @ĕ-  l @ !/?.!/ 2  ` $`$` @ "`4`  ` @ ` Q2P`? 8L``$` ?$`$``($` `"$`( `$ <$`,$`$` , *` `  ,`&$`4`` @H`4 ` `` @B@, ` ` a >"@, `( $!2 ? .!2 *!!0  .!0J`4` ` "6 ?`0`>`46 ?:`4 `0  0$ 4($ 0`$* $ @$ @`, H@ <` < @ (" !. .!. *  h" !. !. `4 @$`!1`.!1`4 @$`!1 .!1`4  $3 h %s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries] 㿘>V #X` `  =  0` >V `G#`  a" /`a@ ? @  >V#h>V#x>V# ` ` ` !>V@:#X!>V @1#   2>V >V#>V#ȁ㿘` ``?`  ?@&`!1? .!1`&`!1?.!1? X` V `$@" `"@ ` &`$ &` `(*  &`(``  @5 @0@ @Ԓ @X?-` &` .2`*`  .2  . 6``` ?6 `   "@. ` @. !2 /?-   `` 6 `&`@2( ` 4$  &` .2`*`  .2  .&`!2 ? .!2 *! !0  *!0 %s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: %d WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout 0 H /* %!0 !/!!.!1n  ؒi H 0@ [ #\>W# @ >W# ->X ? @  @ ,>Xې `)>X @Ҡ?  @ @, >VƐ#Ƞ   2  h>X l,  @  @@ ` 2#\ h 03 #`  `40 >T#( H /* %   h `  @"  ` ?"`  h  "   4` >X Xw  ?   H 0>X>aX p*k 㿈'`  >X#*` cddf f f d@ddf      s   * t       ` 6?`!a>Y *` e@ef f f f f f f f f f f f f f f f f f f f f f f f f f f f f f ee ` @ `   * @ %6   @ ` 2   0 | @ ` v  2p  @* ``   D V `H /*%` #\#``,`1 *  h* @ `. h . !1?,!1 2 !.Ӑ!1 !. ,!. *  h"  !. 2Đ!.   H 0@Software fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatail VMEDMA errorVMEbus errorDrive faultedHeader error/cylinerHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test numberACFAIL assertedUnknown error >[* qt0t0t0t0t0t0t0t0t0t0t0t0t0t0t0qqqqqqrrr r,r8rDrPr\rhrtrt0t0t0t0t0t0t0t0t0t0t0t0t0t0t0rrrrt0t0t0t0t0t0t0t0t0t0t0t0rrrrrrt0t0ssss(t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0s4s@sLsXsdt0t0t0t0t0t0t0t0t0t0t0spt0t0t0t0t0t0t0t0t0t0t0t0t0t0t0s|t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0st0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0t0st0sssssst0t0t0t0t0t0t0sstt t0tt$t0t0t0t0t0t0t0t0q>Y#>Z >Z >Z 8>Z P>Z h>Z x>Z >Z >Z >Z >Z >Z!>Z|! >Zy!8>Zv!X>Zs!x>Zp!>Zm!>Zj!>Zg">Zd">Za"0>Z^"H>Z["X>ZX"p>ZU">ZR">ZO">ZL">ZI">ZF">ZC#>Z@#>Z=# >Z:#8>Z7#P>Z4#h>Z1#x>Z.#>Z+#>Z(#>Z%#>Z"#>[ (>[ X>[ >[ >[ >[!>[ !>[ !0>[!@>[!h>[!x" "  " " " " " " \" $" ,`" (" 0xycxyxydummystrat㿘 <"">>]   Hi" 0"& 0 0 ?& 0%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) 㿘>" "` "`(`>]```* @Ր  >] Ԓ`- `6"@>]4` `Ē``6>]`F!  4`*2` 6`4``F4` `3,` `/ ,`@Œ `4` `""`(㿘` @D 2 2   ʨ ? @b@ @   pri %d%s: can't alloc IOPB mem in 64K xyc malloc: %s: : doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled] %s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver intrp0   @V& $`L>*` >]$`X"#$`\$``" P? 6" P Hܒ@ '?  H @'ؐ H@  H@ؒ  H @>]"`0@Ò H$`d$`h  \  $``>]#@    "x`d`` "@ `d @  *@ `d @  *@ `d @  *@ `d@ ` *``d`@ `` @*``d 4@ `  *`$"x$`t   `` 0`d`h$`l 0$`p#\#` @E `p ` 2  `l"``l` !>]@ Y#>]# 0f>]#H` ">]>]#`>]#p  !>]@ ?#xv`0N`L   >c>]#l`>]i#>]f#0>!P$`($`,E,`(>^`~`4"@Ӕ '''8"'?2 '`@2' @?g ' ږ   '"@ה @?U >h>aX"p*d `    xyattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! 㿐`(@x h>"&``&`0 `6`6`&`&`&`&`*` *   `* @&`&` * " P ! H /* %`  !>_`  5 ?` `>_ ``i 6`  `#\@#`@` l"` l```>_M :6`" !>_@  ȔA.6`>_< 6`6`6`.`.`6` ?2!62!4  } &`  `  #\@#`  l"` l````  &``!>_ >_! ` .`t`( 26`>_!8````@ `@ &"#\>_!P:  P"" " `@2 ` ੀ@ >_`ऀ@>_` ਀@  >_! `>_U! ۔``@̒`@ @Đ @’   ` #\@<#`  l"` l``"`!>_+!`` ` @?@@  `  #\@#`  l"` l`` !>_!@ *a`N6` ?#  2 " `@ ~ `2  `  ~  } ~>_"8`H 00)a,Nj"  @=J  >] @Ē `(` @"$ `(@6`  t`H 0  8>(("   `8 `8(("`8`4(("`4`8`4 "`<%s%c: crash dump not supported (yet) 㿘  > :`@ >a!x*`*`✔&  a` 㿘  >" :` "*@` e f@"M  m@"Ve e@0 0  h@0 0  n@" e g@M 0}0 e@n 0wv H /*%a,Ӕ"H 0c `ǔ!] ` &*"* ` @R&!``@ I` E C4`A  "`` 4`?# @4`2`/ `@ (` 2`< 4``<  $`<4  *  a `>b`@Ēc`8`4@  $`< | @㿀  > :`6N ✑*@"H  *&" @f'' ''3"@  )  `6! . @     8 8*@$84*@$484  $<㿘>b#> #"㿘>b#>  #㿘  >" :`60?"*@`*" `<*@2 ` p "`?,  ` ?`(@2` 2  [ ?㿀 G> :` ✑*@   T    <@`(  L& 4  " @'' ''{"@Ȕ  " < G` ` !"@ " < !& 4 !@Ж  $ c@ ` +    ƛ"@$ >c#HD . P $ $  $ $ $ $ $ $ $ $$ ,$ ($ 0O@ xyc_startbuf null buf%s: warning: out of DVMA space 㿘`>d hG` ` !"@`T`*`   H<@m 2<>d  ! `&a$ $  $  $ $ $ $ $ :` $ $$ ,$ ($ 0 0@2  `( xyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed!xyc_submit_iorq wrap upxyc_submit_iorq㿘 L ` ,P d "@0K>d0 >d0] @  P` ` b@ 2>d>d!!y !@= 2 #P"3 >d"@ L *` L2 *` L2 *` L2 *@ L *`"@0>d0P>d  @   `@eӐ"8㿘 x@ ` ``x 0 ` d 3 "`h`  & x@ ` *`?@ t  ?@* & t, *` `*   2! d*`  2$`x  *  x ` *`2` x`    @ Ѡ` @㿘@  4  LBQa     ? @ '   ?  @ 2@ @7@  2@@@  " L`@ %s: off-line: %s xyc_reset㿀 p  p  *  2`  *  ` *` ߐ * p ` *` p `  *` p`"@  `  * p L * L2 *` L2 *` L2 *@ L *` L   Ĥ ? 4 L !>e p  " L p" @ = L b@ 2>e̐" *` pŒ %s: soft reset 㿘 @2 L>f P  L b@  ? ~  `` 0  2J 4"E 4&` d@ ` *` ` `2  *`` - 0 "`0- 4"'`) 4 "`4`0`0("`0`$`0* "`@`0`,H@<`0` $"` ` 0`< `@ (" @`0&`$` ? @&` 4`` @ 㿘`  P`"``Ԁ" ``  2```  P%s: DOUBLE ERROR! %s: soft reset failed! xyc_remove_iorq: controller DEAD㿘 L ` >f" p ? G >f"d>f" ` @ @*` `  *` -  x`` "  @" @  "   2  ` $`$` @ " `  ` @ ` E2D`? 8@``$` ?$`$``($` `"$`( `$ 0$`,$`$`  ,  ` *`  ,`&$`4 `` @d`4` `` @^@,` ` a >"@,`( 4 2  49 ` ` "+ ?`0`- ( ?)  `0  0$ 4($ 0`$* $ @$ @`, H@ <` $"`` < @ (" $`0   @$`  @$`  P-  %s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries]㿘>g "p` `  y  0` >g `G"x  a" k`a` ? `  >g">g">g" ```S!>g@"pL!>g @ "   2>] >g":>]7#p㿘`@V` ?`` ?`@&`&` R` P  `$@" `"@ ` &`$ &` `(*  &`(``  @u @p@ @!,@?'` &` .2`  . . 6 ``` ?6`   "@C.` @.'  `` @ `&`@ `   &` .2`  . . &`%s: watchdog timeout 㿘 H /* %    ` `  @" ` ?"`  `  " 4  >h"Xy  ? P H 0>h>aX"p*[! 㿈' , 62v  2r  n  j f "0` ^  Z*  V 2P  @ `   : H /*% #\#` 2 l  . l  . l" ^ l  H 0`@Software fatal errorDOUBLE ERRORSuccessful completionInterrupt pendingBusy conflictOperation timeoutHeader not foundHard ECC errorIllegal cylinder addressIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulWrite-protect errorUnimplemented commandDrive not readySector count zeroDrive faultedIllegal sector sizeSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headDisk sequencer errorSeek errorUnknown error [>j * 8DpP\htppppppp(p4@LXpppdpppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppp, >iU!x>iR!>iO!>iL!>iI!>iF!>iC!>i@">i=" >i:"@>i7"X>i4"p>i1">i.">i+">i(">i%#>i"#>i#0>i#@>i#X>i#h>i#x>i#>i #>i #>i#>i#>i# "8   "3   ". 4, @ & 0'% "$ 04"  0" @ ! " `4    0" ` %  0  @ 0 " "  " " " " " " \" $" ,`" (" 0sisw㿘` @- 2E >  2@  ?2 &   24 >k@b 2- > 2 & >k@b 2 > 2   j ?2` >k @b 2    Z(?   si_attach: impossible bus type 0x%xsi: dma handle malloc failed pri %d %s: options=%b RESELECTDMA_INTRDMAsi: Set TheSoftC=%p TheRegs=%p 㿘`    &d 2>>""$d,  @H ($ @ , ,>b$ <>b$ 4$ D$ H$ L$ P$ T$ X$ \$ `>~#$ d> t$ h>m#h$ l>n $ p>n!$ |``'>k>n"$ t>n#$ x>o"T$ $ d >n"@$ >n"d$ >p!$ t>p!$ x>p#$ $ >p $ >p!$ D#$ d   $ d    $  $ $c!@  r$c $c>l'   c" `$c$c>m! $c$c  " >l@Ac >l7<c !@$c>le @d>l P >l\`>" >l xS>" 0@ @4 0z4@ ?  @ @1W  (>`ʖ  @1N si_minphys len = 0x%x. 㿘 " >m X@& <uѐsi_intr: DMA conflict si_intr: DMA bus error si_intr: spurious from SBC 㿘 # #``"@>m `@>mߐ ؀` #  & !#E  >m̐ >" @si_reset_adapter 㿘>" #>m!#``2 `4   4  4 4 4 4 4 #4 4  `$  $ $ $    $  ` si_dma_alloc: already have DMA handlesi_dma_alloc: misaligned. si_dma_alloc: xlen=0x%xsi: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO 㿘  >m"$ =  >mL"01 >m#ߒ #  ``>mҐ# &  $ $ $ `@   &   @}  $  >m #8&$ si_dma_free: no DMA handlesi_dma_free: free while in progress㿘 ` 2 >n ">n " $`   @~! $ $$` %s: DMA timeout (while polling) si_dma_poll: done, csr=0x%x 㿘   '##0#P @@? >n d!@   % >" >n!h㿘@#  4 #? 0#? 2  2 ? 2   2 2 2 2 2 2 2 si_dma_start: bad pa=0x%lxsi_dma_start: dh=%p, pa=0x%lx, xlen=%d si_dma_start: Fifo_count=0x%x, xlen=0x%x si_dma_start: started, flags=0x%x 㿘   @#>n" >"  &#>n#B? # @4   4    4  ?# @4   4 4 ?#ߒ @4 44 4 <`4 4 4 4  >n#0 @ " P P* `  H *@ L @ *@  X *@ `  H* L @ *@ `* >b 4  ` & >n#`si_dma_stop: dma not running si: DMA error, csr=0x%x, reset si_dma_stop: resid=0x%x ntrans=0x%x si: fifo count: 0x%x si_dma_stop: excess transfersi_dma_stop: ntrans=0x%x si: Got Left-over bytes! 㿘  #  >o!x0 ?& ?`# @4``@ >o`! "`, `&  o``  '>#& '> "@>o!j4  >o!c  M& $ >o! & "@⸀ & >o"M 7` 3>o B"8` `%?` "? @0?`c 2 ,?`,?` 2 ,?`# @2`,?`,?`?# @2`,?4`4` 4` 4`4` 4` L `* H*㿘@ #  $ # #   si_dma_start: adjusted up %d bytes %s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d 㿘  ` @#>n"b >" &#>n#@     ?%   >"  >p!8<$`% $% @   P* ` >p!` `  H *@ L @ *@ X P *@ `X>p! n `  H* L @ *@ `* >b %  ` & >nW#`sw: DMA error, csr=0x%x, reset sw: short transfer 㿘  #  >o;!x0 ?&   ?$  @ >p -# "`, `i&  X> b`$>o"`4  >p#  D& @$ >o! & "@&  5     ">)cH&> 2 * ?2 * c 2 *>c< "c< 2 * >2 *c@  "c@ >2 *cD "cDcH "cH$ $  L @ *@ H*>" >o"states->%s%sGOT_BUS GOT_TGT SENT_CDB XFRD_DATA GOT_STS GOT_SNS XFR_CMPLT status->Disconnect Sync_xfr Parity Bus_Reset Device_Reset Aborted Timeout Negotiation Config WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNon-Participating0x%xPort DiscoveryWaiting Port Discovery ACKPort LoginWait Port Login ACKProcess LoginWait Process Login ACKLogged InPort UnavailableProcess LogoutWait Process Logout ACKPort LogoutWait Port Logout ACKx0$ COPYRIGHT 1991,1992,1993,1994 QLOGIC CORPORATION ISP1000 Firmware Version 01.31   qp ? pISpP p p?p 10 y5xc/ '  @B Qxx xxO i5@jh< !xlh(hh hhhh#hh' i6  h hhhj-  i6 h7h @hhdpxx8x/:xx32 ppxxxxx2}x}x//xxxxp p z zp@xx0x/ 5h!/xx6x 5o!e@ 5j!!! `x)xx 5o 5i! @- @xx| a`@8|ppppp 8yHVVagDk$2FZ9CJp  8y rq @xsrq @p a` P @|p@x A A Sxppzxxxx ppISpP p p?p yx 10 Y )W Qp ar P @xUqrsp 10@psr Q I4 Ap& IB ANpp q.pp@Bp   B J &Sxp @BHB&Sxp &Sxqp!^ rxppxprstprstҠ@}xrzz{~|vxxxxxxprstprst֠@xz{|xxxxxx 5Y! x 5A! x 5B! x a5@a bx 5E! x 5F! x 5G! x 5H! xyz xqā6jh@kxk xwx kj 'xwx ijk xqġxxqġ 5A"~!xuxq 1 "@#p!xx1~ 5B"!~xxd2K a5@a bp`p`x a5@ap`xq  (@c  2@c  < a5@`~a#xx3xqġ 5G"!~xxqġ 5H"~!xxqrȡ!yx "z xxqā6 rh~&@j @@@@ρ@@xxxxr̂@h@ a5@a(@衆2@<@dHxPHxCHqqrxj hhk qxwx jk phph'xqrs̡xxwx jj 'xwx jj h@Ax 'xwx jj h@Ux 'xw A I Q x 'jxwrswrsxh@'xx |  @x xww A! I Q x a5@`g`x x|wwwwƧ a5@``gxx  A! I Q xph68 |x 9 A! I Qx h i 8ݧ?8? ih0@@hK hH@ p xhK hH@px px y5x a5@```xxhh hF |xx@x`qqyJ|tsrtsr y5 @xo@x?@Zxxx` x 5h  # " $   , .%0~x/eeff`` x|p@xqpyxqq!hx ii -h p@xp@pxqrs!!yp@qrsxp@pppwqx 1&$0$"F 1xxxUUy`qqġybxy`qxyTqqyVyXqqyZy\qqy^xyTqyXqy\qxp @pppqrs 0` Sx ppq1p q p|p @KppFpqrs 0x ppp Zp lq l,Sp|xPe@w,xR c|~ y5xP b,xR| @zR @/  x | 6|x)h**h.h i 5O! h@ ``h~ x ~he@`hxxhhii|e@`` xx!x|`  @h(`h,`|~ q5@p@5- pB|~ q5@ 5r@!H!!tB|x hxe@_x),x`e@_` #`#,( 5O @_hF` `hFhxPdx `dP,h%`x`` xhh | 9 A! I Q x8j?8?j | a`xx|@xyxx` x x xx` x  xx`  xp a` @|,`, cxdxfxhyj@,xyn| ~ a5h- k`d`f`haj@-xan |x@ ~`e@x `xx|xle@ xdxf,xnxj |xeytprТ"3x@exhe @xexo@ez|{x @x?@\xxxxe xxxx xexx`yf|n}nnnn 9xx``x`xxz|x@xnx`x`@x@xxxx|xxnxx|x@xnxg `@ӧ @ 9 @xx- h+h/hh - h pxxx|xm,xx`x,h`x-`x`xxxxx `|.%0a`a@~x/eeff``gx h@? x x xxxy` F`"jh HU@U 9xzxy, he@]aiai!``hh h@@s@h xxxx|`` x xe@`x`x}xx|ypxt xvpx@xh @|h )xle@x@~x(x@ @|{yrpԢ"#|Hף||x `$@ @x@xx xxxx x xxyx xp֠|z{| 5h ~ y 5@ !4 5!4x044xD |~ # q5@ y - +#@Px##S3xCx xx p\xTpxbxxxCxSx 8pG5pC | " x[|  px" |  px! |  px" | "ϡ | ~ a`bc |" ~ a``` |" ~ a`` ` | ~ a``b `c  | ~~h@9 a?xA@' a> ~xA@ `pxx9> q5@p``q` pxx5 q5@``q` px x;   |,@X `` U`U`UxZ`xB| 5A"  ;"@j !!"|~h䠌 @`6p q@ @ 2@x x ?x !p |h~ qp. qpppÀ qp @ px~~~ #<~X|0}8?@@ا|-xPxy "%k%%&e&'D S%Jx |pp?p0@ p3p\py*Kqxx Fx$(pxx-^Ipx~xxx x`xx[ x$Ippp35pxx-^oqx~xxyxx`xx[ x$oppp35pxx-^qx~xxyx qyx x`xx[ x$ppp35pxxKx-^p hxox,,Phxn A xx-^xp\ hox,,P`` hx 1 Ax- xt@@5 0qD*H 5!de!qFpp?xv@5qD&xqF%h%Xu>,P`4gw6?@/!@@g @/`g hna@?`HB@BxHp `"g k6 ` HpJ`pN`pR*`xFx-^kpL@s@u@{ {@g xqL@) !H "H  H@z@x-wja >,d@``` ~*``` xx-^*`ay@q. ~qP@ݡ@x*ݡ@x)p`@桍yZix`(xxahhx~~~ ,x Shx~xm}}n~~x0`` x-wxr*xIx-wx;j zZxIx-wr%@;yIp2G``xQ0000QQQxxx ~ y5x@yphpxpwp hhhhhp~ q@ 5+ x 5! 5 5+ ppxpx.  9x+pxp yx !5W$@ƭh "xhox,x(xpT `h`jhhx !?x !5Wx !>x px a6`a``pxpp?x~$@ hh~jhhxx  #|P#x#y&)@/xpppy6>>@t)>t>xwx+wx,`@k !?  x@k~ !>~  x@j pjx[8Fxxwx,`@ !?   x@~ !>~   x@ pxx"yxppx"yxx$p(x(`` x(@(x$@ h-~h@- x "ihhx```` x(|x#y 5xx   0 xIxx전@!y # )  -X-X  /xp@ x"x+xUxx+xxx+xxx+xx _x$py > F S F( H( F Fxqp Qx)x(x(`` x(@(xx   0 nxIxx전@ j!y x -X-X -Pxx+xUxx+xxx+xxx+xx#y xx&ehxy䡄0@&ex전@&ey # ) -0-X-X -PxP x#y """y "xxx H+j+jy +j+j+j+ xy@ @ x+jp x'R+jy!!!!.!0!+j+j!+j+j""+j+j+j"x@!% x:xxh@!,hx-0xii!Jh!Rh!Bh@!xXx@!RxXx`@!@!!`x!z~Znxtzyx!m?k!hk"h@@!~Znp!x/:x0xgxx1jilk"@!""!|{#!@~Znxgxxg"!x0xx1xxjxxXxxx"!i@!ܡi ~pH ````` x"@"i ~pH ````` ,H @"x,x)@"x`(x~X~Z" xUxxix~X"xXxxjxx+px+p y@"xx"D#| @"<H"<x">x!$z">x"* "#@"TH"Tx"#@"hh~X 0~Z`` ~pH `` ,H @"xx,x*x" ~pH `` ,H @"x,x)@"x`(x~Z"xUxxixzx"*#@"H"x"*+vx+px+vx+jxx@"xzx+jy"+j)9+j*g"xx+xix"xx+xixP"x#y""##@"x p:py### # %%0$##x#x.@#xh@#Z#)x(`` x(@#Zx.x#A(#Zx.`` `@#A`@#A@#A`h@hhpT ~ `h` `h-#W``x~x$hh'o@###w`@#wxzh.j*6"#x#" @#h#x$x@#@ih@#p8hix(x(#`` h#x(x#pT `h`xxH#x"y#####xp@#x+xixjxxxy@#x+jxjxhh$x+x$ @$ xx+xixx-wx0$$y||`$)h/h+x$$8hH5$8x.| @$bxЀ$Fx1xx1@@$Ph/h+x$5hH5@$Jp8$\yzi.j*x$5@@$lh/h+x$5hH5@$fp8$zp;yzxЀ$?i.j*!$x$5x1|@$`` hj(i,j:i>h+h/h3 hh py$$$$$$$$$xh$x(x$pT,P `h`*` !5W$@$ x$-" k|wx+x,`@% ~ ? h  !?  x@%~ !>~  x@% p%x$8$xx(x(h'xohx1ʦ@%i ih@%$h !5Wh "j8ix& ?!h- qVn`@'@'hhhx.x'@ @'x1xЀ'xx1yzx'x,x1@'@hxtx-| x-|  '8x-|'3?k!hk"hxx+vp3P'Lx#y'O'R'\'"y'U'Z+v'Z''xp'ix(x.p4` x'np@'cp ? hp>p2"y'x+v'}''}+vxp'x(x.p4` x'p@'p ? hp>p2"y''''''xx+xixp'x(x.p4` x'p@'pzx| i?--qV h@'h@'hx'p ? hp>p2~ / p'x'jhhh#n~Zh @(Ox+x(Op(x(x.p4` x( p@(pzx|yy>--qV h@(*h@(Chx(p ? hp>p2~ / p(;x(4jhhh#n~Zh @(Ox+~Xx(O~6 `pJ`pN`pR`@(klih(t{{||ަ~Zx0x(h!#$@({{||h~Zx1x, j@( i ~Zy-p>6 Hx` @(`"`` p`&|x.hhh@hpy(((((((((xx(x(xxpxhx%h(``|`@((x``` |`@(`|x-whx)&x-whx)&x-whx)&wx,q>-- h)xhr@) hx)h hpx(h)/x(x(hh xx+j}~ii@)i@)H)Z@)Z 1++x,$@)dx*3x)x+ ~)```x*W ii~X~Z)xUxxix ~)```x*W ~X)xXxxjx ~pH `a@)bH)@) &)"0bp()¢) x)Ȣ )  ")"(x+++x,$@)x*3x)x+x*WxXxZ xix ~)``*`))a | 2 x*#bp(** x* *  cH*#@*# xxxz{hh | ~qH!` 5~`x~fxx`x7``` | ~pH ``xxx`xx |+jzii@*i+jx*x*W x,x)@*x`(x~X~Z*xUxxix~X*xXxxjx*@*qH! * x+x*x*WxXxZxix ~~)``  *`@*ᡌax* xxxzhh | ~pH `@* @`xxx`x`` |~p@+x+x+f @+fx@@+fx@+%{?+,@+M+5@+bx1xx1x+f@@+Mx+F?+b~Zyz +Vyyzzx1xgx0^xxgxxjxx+xixx+xixh#x+i ih@+hxix x+  x+ x+  x+  x+ xx~Z|~?;;6 y@+x```88y@@+ϡx```|xxxxzx`x| 1 )2xxxx}~x`x|~ xy 5F (@, !,  x, !,  d$@," #p,"x,|~ 5F"2H,8@,< !,v   2x,L(@,D !,  x,J !,  d"@,\H,\ #p,Yx,L|d,expx x전@,s$,s !x,t$|02BDTVfhxz  2BRbrfvxz|~"2BRTdtvxz|~xF| 6|yzxЀ,?|~ y 5@ !y,,,,,,,,,xxKxH,xKxH,h@hxX@xZx0,,h ,xx,x | ~h6` -.a@-. @- 2@-!x-% x-' ?x-' !` `` |xjxxixxXxxUxxxxxxxxxxxxxpxFx~x0-uxx x전!@-uxx |xx |x0@-|-x|xx x전!@--x~xx |p@- ~-`/hxk-x,h hxX?hh/h+xKx  @ x전@  x+p ~h6 ` HpJ`pN`pR | b G  0 8~*89(œèd;0(â0 (GajV:(✠d)0 0(ᜠ( dgo;p#vwxn> (+dgo;p#vw> i( D! ܢr<no00 Ht.?a22!ℨhe*#`B`*!0 ׈"(H0(0(= 0 &:  ~*8~ " I.prr p@.x.p |p/ q.x/x.p @/ p/p.p@/.px/ @/ x1k/@.x/Vp |d$@/0,p 9/5'hh 0h)!@/08'/pu@/0 9/2x/| ~ " y5 qp pp q p pp Ix | I/Vp/pqp/^0@/k0/^p/p /q //Vx/hppp/pqH/xp I|~~~~ "qx/ |r!qp /ꡄ / y/////////xp/ Ix/x1k/x|p/x/x1k/x|px/Vx,h@/h|xxx0Prqp (x@0xx03x0P',X`c ""c!$@0)0) +`x0+`/2=,holkpx/V|8'0D`@0M ` 9/2Q@0Lp| Q|P9'0] 9/8`d0]-`|~ ~ " h `hklW/2~ h@@0y~ yxX@@00pp0p@0x$0x0,X'``~p`p !0Ƞ@0Ȧ0ppvpx`p`pb $pb#pvp+`x08x0x1k0 |~ ~ " pp0p |~ ~ "  I0pp0p@1x~ h@@1h$@1 P 9/5-`x1k1 |~~~ ~ " ~ h@@10 I1h$U@1h-p.` 9/5'hh "hH1UQ1Gx8'1;pu `@1h 9/2x1:" i $"i#1dx q x0 |p@1'!p!p!p!p~ yxX@@11vpx08|~~ ~ " I1 q1h$@1x.x1q1x/x1pq1x/p1p1p I |~~~~ ~ "  I1ʭ 1p h&ppp@1Spp1 Ip |~~ ~ "  I1h `hklW/2~pp2,X'``p`pppvp 1 2,qp 2, H29x/ꤠklp Ip | 2Q2L|~ @2w2wH2j2k2_x2o#2_~2 |~2x2s2 `x x"2x$x" i5@h@2@2h0 @2!@2 @3o a6 `4@2`62`@2xp2x2x2x2x2 |x<x>2x@x>xH@2ӀxJ2x|x4x62x8x6 xD2 xF> @ e@2` @2`"@3(`,@x2|x(x*3'x,x*x03 x26#@3' "@3 3'# x| i5@h@32h<@3o``?````` Bgoxh@3Jhhh h3Txh`/`+,hx i5@ hyD3ji hx | 5O!d ixk`hX?``H``/`+h0@@3hK hH@3p3x3hK hH@3p3x3 p3x3hh hF 5h xLxJ | y5x4x3x3x3x3xGxK|  5F"2@3  "<@3 {*{.| 0 5F"2@3 9"<@3 '{6{:|  5F"<@4  {>{B| / 5F"2@4 9q"<@4 &&{"{&|PTI,ptispptispSUNW,ispQLGC,isp㿘` @̛ >@̔ Ѐ>@̎ >@̈ 耢>@̂    2  > , `&`4: @  : expected 1 interrupt, got %d clock-frequency㿘4`>!0>q">&b$cP&b(cP`&b,`&b0` &b4`&b8`&b<`&b@`&bD` &bH`$&bL`(&bP`,&bT 2&b0 8@0D &b>b$" @ " 4"T! @@b@4"T>@ Ѐ >@ "(4"L"(&`T!&```X &`X @).`[4#X 4#Z"4#\$4#^4#`>4"$"$""$@)Ԓ"H /* % `f2    H 00"`f2    ćH 00`f2   vH 02` PX `" 2` PX `" 0㿘! Yi &!p!p " !p@fg &!x( YY &!t!t "  !t(@fW &!|`? %s: bad handle (%d) in isp_sbus_dmasetup %s: kdma handle already allocated 㿘`$``  62  ?>>!L   2 ` ` @f  2&`, ?* @bX ""bX>!3 `(   @6 `$ &$&  6%s: bad handle (%d) in isp_sbus_dmateardown %s: kdma handle not already allocated 㿘`( ` `$`(>4€" ?.>"В bX>>#   "bX` `$@f} 㿘&   &X & @ 㿘 ZA firm_event㿘` c (H /* &@`@  %>;,`!p֖ ;@`@󀎠`@ !`" H 0` 2 4.@$`* j@@ ``#$@  `0H 0 #H 00 4`.j$@㿘H /* &` `0 @ H 0 ޒ 0 H 0  H 0 >#stdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. keyboarddevice_typeserialstdout-pathconsinit: bogus stdout path %s. displayunknown console input source %d; using rom unknown console output sink %d; using rom >>""b>#%l !%%>!>2b%` ?`@>b`€ `>("0?x` @ " >`@ >"0(>`€c   >@c>@ɦc Ox? `J@ 2`J@ :J` ` z$?@>c(`€ >ې"I x` @ " >@ >#8Ē0>c@>@ac`  >W$"!P@>@Uc ?Ox `J@ 2`J@ :?J` ` z$? `HJ`LJ    >2 >2    /   @ϐ"">#hs >>>#   >.0"#>!%>> "Ԑ#Q> %>>!"ascreen-#rowsscreen-#columns㿘># >|# $1  ($-  H$) C>#  >@>@"c>"c> ? C># >> #|>@cؘ  K   * * *:` K?Ѐ` >*2 "c># >> #|>@c蘒  K   * * *:` K?Ѐ` >*2 "c>  >>"`> 2> `Q"> > `P">"# p  $%>  " h%  #"$  $ %$ #$  ($ p ȟ€  >#>#4 4 > h`*@ €㿘!>#> h*`@ `€ 㿘>#> h`* 㿘>#`>`p ( (># > h`*  㿘  b@>1>#  > ] 2&# #> h`+   @ 6   㿘6  * u㿐 H /* & p!  H 008>2" `$  T  ; HH/` /` / 0 H 0& H  p  ?& po? H  H 0㿘>a€ 㿘H /* & p  H 00*V  H   & po H  H   p  & pH 0!@%0>#(:L H 0H( p a`" pH 㿘H /* & p " ? ?& pH 0 . h& pH 0  H P ?   *>2"   H`€ H< h` > *`@`@0a㿐>#  >2"      >X > "# 㿘H /* *>c?"cH 0 ,># c" @@ >8 J    J   > h`* € 㿐>2   Ho o "  "H 0$H/` /1> ># $ * P `># $*H 0 " 㿐  Ho o>2"  / 0T@H 0㿘>!($@(%s: /dev/fb already full %s: forcefully replacing %s %s: replacing %s %s: attached to /dev/fb 㿘>a$  >!( > (H#"a$ , `3>a(> (#(` &a(> "! >,"!$3>a(> ( (`&a(> "a >a  >!( > (#"a 3>a(> ( (`ݔ&a(>!(>`( 0Ւ`㿘>!( $ 㿘>a($㿘>($ @㿘>!( $ ?widthheightlinebytesfb_setsize: inappropriate bustype㿐```~>0> `x`& &  (i `2f > ,@ A" 0 "\ '2  E"U 2  E"O 2  E2  `"D 2  `=>#*` 0,00000<$& -#*$%& '$&@& #%"& ! " J  "$   $   %  & #&@& %%& &  @" & : & >@b& >b@&  >@  &@:& >"J *   * J(JЁ㿘   @ screen-#columnsscreen-#rows㿘  4$  $   & 4$   $ @ 4Ԓb 4>>"0"@$ \ \@@ \ $ `@  >``$ >" P P 2  8 $  " Q 2  8 $ >  1> >#|@ia P  8 $ >#|@^a "  8 $ >  " $ $ @+ $ ">$ $$ >!$ @qҐ>>#L"cT>( 2H>( 2L@#``#dd"@@d`?"@0 d0E Ed0# 02   0#dd` 0 #>'  "! mouse input parity or framing error (0x%x) ms_rint㿘1>'"   >~a?6" (6"" * : `-*`>! 8x55566< 4: ,    4* : @$  4* : @$ ?4* : @$ >~=!8 L  4L   *@)@> > 1>L   ?"FL@ @ * @  # 3 # `#    4 @   "   ?"!#3 # >L #   #    4 $     ?"#3 # >L #   #   $ , $ w $L 0 "L 1, 0j L 1  ,_ 㿘>'" , "& , ɐ >  2  $"`"` @  &  㿘!>'"$   @ $ , 㿘>'" - ~@0  @! }@  0$ v@ @ 0 >'@ (>' @  "   㿘>'">  dkeyboard-click?true㿘>  d$ $ >  $ > #|>@bP >@4b`  , #kbdattachkbd: reset failed kbd: type = %d, layout = %d 㿘%>X @ސ>G"cؐ@ْ >2> "pd`%d``@ $ & >|"П@`!>Xh " `%>~I"@ `%> `&~B"Unknown keyboard type %d 㿘 2  >"P&>"& &   " N   ".  " N   2.  " .  @H . >~ #. kbd_translate㿘``(6   @ $ ?`*`>!0 ==D=L=`=T .`  .` 6` .` .`>|z V` "@`&`?"?N`   2 6  ?  >( 㿘H /* & H   D ` >>2ap!4bH 0keyboard input parity or framing error (0x%x) keyboard event queue overflow 㿘#> `d H >$ H!4p>"}w   $  , $, % 5    +  ğ@`hƐ0V?, $, &h 0O 8 K, $  I  B`d`?x $ H$ D>>Gcؐ!3021 , @*  ? ("   >{b00 6   # >L #   # $ ,a 0L < "L =, <hw (L =  8] 㿘> `d 8 6 `d$ 8   @ H /* &   ğ@ !>>Xf #" H 0 > >   " 㿘!>  d&  ( d 2& 8 @ & 8 㿘>   -㿘 "~@ > W d## @" % Z#@#@E 0 Z#@"} %#@s 0 "}@ 0  v@" 8 #@"Y #@ 0 # @Q 00#@" # @ 00# @) 0  -  & v| - .   0q>"P>"?#@g c*    0[>"P>"  Q6@Y M  I$  & E& ", ' H /* & H x  >K# >xe H 0  6  , '.:  &  @ ' . @ , = ` @ 㿘>  㿘>  d`  B " `% 4;  `0" `%3     *`# "+ *`#' `H /* & H x  >K# >xeQ H 0O   ğ@ fpu_cleanup 1 fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3 ` : D`> * H H4H|H|HH>{2":'2'>yĐ#>p?  >[F('` 2$'>y#(>y#8 >cP  0yϔ>#p 0z' ? ['L&`>#z >y#` 6@&`>#p>#`2` >2` ??̀ >yz#'@- " '  `> >0`  @  * '   Z`yU#` &`&`㿈>@"(2 ! <  42J `:  @ ?& &   2  >",  KKKMMMMMMMKMMMMMKLLdLLLMMMMM|M|MMMMMMMMMMMMMMMMMMMMMMMMMȑ, , @, *@- $  $ @@ @  ,@ @  ,@ 0`& 0@b @ߖ  ,@ږ0K @Ԗ  ,@ϖ@rI @Ɩ  ,@  @  ,@ @    @p*@ $P bL$`H  @  ,@`@  @ @w  :`  >p*@ #PJ   $*@$`- $` *  $ * $ * $ fpu_add㿘  ,@,``2   @@| ` 2    z&   v&  r "L   L$`$` 6  $`  @" $`  $`  2   $`  $`  $`  @#@$`@ ` 9$`        d#   2$`$@`?$`  @>` >w"$` d $`$`$`#$`@㿘   , ,` & ; 2"6 2- 2* &4"  c    "    ( & 㿘 ,` , `,@`2  @@   ! ,  " 2  "|"        c@        ?" !  C@ c@ &0@ 0!   C@ c@ &0@ 0!   C@ c@ &0@ 0!   C@ c@ &0@ 0@ !   ! 㿘`  & `&  & & & & @ 㿘6`?.@2`*?  & & & & & @~  2 ?2&  & & &  ?& & & & &  㿘?.@2*6`6@g.<  & & & & & @M '2 <2&  & & &  ?& & & & &  㿘?#@*6`#6@.6.7 @ / ?#  & & & & & @ @  ?2&  & & &  ? @& @& & & &  fpu_explode㿘.@3`&`&` @>0>07 F `m  ```  u#2 &@` 2&@ &` & ?&@㿘````6/`7`/ 7 .` @16  0*& "``!` ` &`  &``2&`  @F&`&`&`&` &`&`&`&`  0"     `?㿘@ ` "`` 4` r@"@ "`` $``  2 0`1# ? $`fpu_ftos㿘@``* @Β [L `D`2`K`  Z@"@\  `@28 @$`+@ Y`@2>tא#: @`@"`   t"  "1 1 4. `?*@㿘`@`* @q >L'``@2`&I  =@]"@  `@2 &5@   @& ! @B < `@"'  "  ?&1@&1  4@`1?&, `@*@㿘`@`* @ V#``@2`& &&V#@ ! @"@  @`@2 & &&=@   @& $ | `@" #  "  ?& &&1@& &&1 4@`&`, &`@ & ?`#@fpu_implode㿘 >>& &&o&s#㿘  ,@,@   `  2 @ `   ` & `      3 +`@3`(@0(@ 0@@  `    3 +`@3`(@0(@ 0@@  `    3 +`@3`(@0(@ 0@@  `  3 +`@3`(@0(@ 0@@*   #` 3 +`@3`(@0(@0 ` & & & & & & & 㿘 ` ` `@c```` ` B : $`" B @  " *`@ B 2``@ $`  b  ` B  b   *` B 2`` $`  b    B  b   *` B 2`` $`  b B &    b   *` B 2`` $`  $` fpu_rightshift 1fpu_rightshift 2㿘`  &>r1"8`r@  2 >r#"P     1`_      `?     `$`    ` "( 0+ 3* 2+@@3@     㿘 ` ?   ?`:# ?  7@*6`@ )1(@0@/ /@:&.`@ & 0@@(@1)7@/@##### " ?" L L" " " " " WARNING: matchbyname not valid on sun4!%s 㿘>   >`@{  `?rѐ!H` >r̐!p  9 Ff  (  9F<("@/obio/interruptinterruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/countercounterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter properties`>  />!>  Ȑ!> L @# L>#($ H,$ L$ T\$ `$ X$ P$ `$ d$ l$! $ $ t>2`"">#"@>@!X!> $ @  T X@(1 \>@V" P>  2t>>@ ["P  @>@ b` >pi"p>@b` 2>p_"  >pY" >pT# 0Ԃ`  ", >#HpJ?P@@G` ?&`, >Ȑ 0Ԃ`  "?p>p3#@G ?p" >@ #ؔ  @I>@c蔒 >p#>@c耢 >p >*"`?*  >"#<>   > !?P=@> И @ ?P*㿘!>@!@$!#>2b` ` @@Cb   {L -w#>HU ` ";,'>OL /4 L" ** L`@ `/ *L @? QL , : IL :2 `  L?$` $@`  <  $<,>@@!>2"  -L`( L - #>H L b"b d  a b  sb  $b $b@T L $btwas brillig.. vmelvmesx%cc%c%cobiosiswespbootpath_fake: unknown system type %dfdsbuslecd㿀>  2'>p!0''N` (>`ƒJ@ ,>`J@ ,>`>  N@ x> iN` d2>>!&!!&! >O. ?& & & `<  "`<>N`pb@?& !>O& &  < `$ N`prb@ْ <&  $ <& &&  l2&N@N` e2"N@>"?&" !>O. & & &  < `$ N`pHb@& &  <&  $ < sN` d t r> ">  >Q>4 L>>?!>O&! >. & & & b <6b>?">O&" >. & & & b  <6b ` "<. & & & <   "<>"?&" >O. & & &  <>"(`"<&& `"<& &  >`nB"0># LJ 1:  :  N@>N`o’b@)& v&  f2N@N` d2N@>"X6"X . & >O<&  "<d&  l2#N@N` e2N@>?"`>O&"` >. & & & bh <6bh ` "<. & & <&  @"< s=N` d t r5>"`?&"` >O. & & &  <>"(`"<&& `"<& & N`r >oUbp>N@oNb@& & >O`<&  "`<bootpath: /%s%x/%s@%x,%x:%c 㿘>o N > ? >> ?n ?n`> n`a N  >nߐ ؁> 0 0WARNING: %s map is bogus, using default 㿘>  . >2"  ) > #|@ ">@D  >!n  "?` @&@&` L *?Ѐ &@ $L 0 "?sd-targets㿘!>#  >>>"a4 $#>!4.  st-targets㿘!>#  >>>#aT $#>!T.  configure: no memreg found!configure: ROM hasn't mapped memreg!device_typecpuPROM root device type = %s (need CPU)mainbusmainbus not configured@ > "#4> N>>"t<> >!\  )%  > @ @ R` *` *   "  ז$ 2 >l#`' > ,''>) "c>l#>  #>@>@Ғc>@|c #>>#lj` >@>#>2>x"'`}' 2`>lP# `  `  H / @@>" PROM sync command㿘>l."%d㿘@##>t>@m@#耢  #@m .,%s at %s %saddr 0x%xio㿘`> m]#8 4  0 >#H>#X>#` mL 4 no PROM root device㿘>! 2 "!@V 2>>kА#"!name㿘 " !>@  (@̒ @<  property lengthreghierarchical%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored address%s "address" %s = %d (need multiple of 4) intr%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector 㾘@!>`@!?>c@Y  @>@^` " @ > >l ] >!plV   > ؒ>l & &@  &  ,>a @M ? &   >!>lw < & (>a@ @5 @?"  >!H>la < &!0? > , ` ?` "` 㿘`@ `?qqled`xp`XH8virtual-memorypackagesoptionsopenprommemoryinterrupt-enablealiasesauxiliary-iocounter-timereeprommemory-errorr`8p`XHeccmemctlSUNW,sxSUN-4/%d series: %s obio missingfbno options in OPENPROMcould not find %s in OPENPROM audiozsP>  2 >L >>ka >>`(!>L@ @|>!(>Lk`>  7 @!D>#'%>d^I @u!D>@!''>"'^: 2>>j0!0# #''cd^(  2'0>> Ъ >  %@ 3>#>@ec@ @4!D''''>d] @u >2 >2@!D'>#'''>d] >2"   >a@@= >W"aP@E>`X> "c|>iÐ!H>@!'L & 2'>!`ki<  >d] 2iL `V>#'>>  @  @>@c <>@ג`( @}    % >@ia>@ea 㴐 $㴀 $ 'H 0+'>d]H @ >findzs: unknown zs device %dfindzs: no obio nodeslavefindzs: zs%d not mapped by PROMfindzs: cannot find zs%d㿈>  &!> "<  >"h > "h<@ ''8'i '> ,k' !>: ? 2>@b ` >b >hߐ"@T>a >b@=? >a@6 2>"hĒ@B>"hpre_panic: makememarrmakememarrmakememarr: hope version %d PROM is like version 2 makememarr: limited to %d makememarr: cannot find "memory" nodeavailablemakememarr: no memory foundmakememarr: WARNING: lost some memory 8>  >0 >#$ >#$ $ iŐ xt >2"  " ' 4&> "`0%" > hB  @O P>`$` $ @` A > i`> i Ȳ G@>U`p >h >0>! > h   @3)`@    > $ $   >g!0iQ!PWARNING: getprop not valid on sun4! %s node 0x%x property %s length %d > %d 㿘>  >#i1 >2"  €> 0#i 㿘>2" `€㿘>a~ʖ ?" .㿈  㿘>2"  @㿘>2" @search_prom: null nodeiommu㿘 >c!>à @n  Ր >>gX!x (>#@[ #@I >@N`  >@Fa ƒ 2 ې WARNING: opennode not valid on sun4! %s 㿘!>2"` >"hz `@ " @  㿘>2" `€: @ 㿘>2"  8 |@ |€0@' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !0>2"` `  @>c>`hG&@& " @" PROM exit failed㿘> ? >2" x">2" tPROM boot failed㿘> ? >2" x">2" d@>fx! 㿘>2" l㿘>"&"> ` `*`" *  `@@?" >`@$>$> (: * $`@? @ rdstxdsdxy㿘  '>@#@@  ``?use one of: %s[a-h] %s㿘@(  >gq">O  >5>3>  gc  2 cg\   2>gU ؁parsedisk㿘`;   ,`: ?.,&>O  "(,  @Ւ  2  >e#* *@& 2  @  ڐ?  2,no memory for mountroot_hook㿘  8p  2>e @ǒ $ $ > c4c4 $c4" "c4$ root device (default %s%c): swap device root on %s%c can't figure root, hope your kernel is right ?>O <  'p* >@!`@   >!  >H">Hb "b>H" >!Xx>f!H >  a f>f!h@  @ @ ?L@ *  ,@ t t t >  A>!X>#>f_!p >   bfT>fQ!hx@Ē x" * XXPXXvw*  a  p >@ >?'p>?"`t>"!p>""&">! o> z >,`,  @" `2` `*` ! @>>?"b'p>p?"`"  !>>> @"a> X"aL>>#>a"2` `` `: , "@>!eԔa ?eА!0=""""@06>"@ " @ `: >?2 ? >b> >""b> #4 #> 2 a2` `  @ 0 2  %c㿘 '> "+  @   #@ @"   #  @ @eb, >?eY"0ҤeU0> >>eL"0Ő"eH,config_attach: device name too longx>O >be[@@ >c#@@Ւ @؀     㿐Dcache enabled 㿘> <x> " (@> "!X>`  ` ֢@  Њ@ Ъ@> "`>dݐ ؁㿘> >>   0*@"(> "!XҀb ģFa2# ģF# Р # # !> ؒ`d#!㿘!> @  Ԣ @ @*> "!X> > 0 *@"(Ђ"! ֣ ֣!2#  ֣ ֣# Т $  L $  쀢  p"Л@` pк@!$  $!>ds ؁cache_enable: can't handle 4M with hw-flush cache㿘>   ԃ@> "`(> |"`(>  "aX 6  ڢ  ԣ@>  " >bҐ#0>d5 ؁㿘#>``@`Ԡ`@ @*> "!X> > 0 *@"(ԃԣ `Ē @6 > آA@ @> ܀  Ԓ @6 > آA@ @>`쀢 2 a "a "`>c ؁㿘>> >   "!X> 0*@"(҃@ z a    6 a ڢ a { ң@> " >cƐ ؁DVMA coherent 㿘#>``@&`Ԡ`@! @*> "!X> > 0 *@"(փ `Ē @6 > آA@ @> ܀  Ԓ @6  آA@ @ ֣&҃@">>c}!> " >cw ؁>7 >  >(>: , ֢@@ 0 8  ֢A@ >7# >" *`*`8>:?  Ԣ@?@>7# >" **`*8*`> >( >: , ֢@@ 0   8   ֢A@ >7>   ֢@0 >,8  ֢A@㿘'> => 0>7@> (c` "`>`,2@@ࠀ  .? " ֢@?@0ਐ%,? ख ֢A?@0c @ 2  6 6 z `?06>7 >    :   آ`>7# >" *`*`8>:?  ԢB@?@>7# >" **`*8*`>:?  ֢B ?@>7>,> ":@   آ㿘>>7 0> , @ >(%>2@".$,? " آB?@0c @ 2  ?6 6  `?0c @ 2  y6 0b Ġ>ᨀ >b ᨄ o??  Ģ2`> `$  2`> ` `?2 >@6?`o >*`( ?2 >Ԓ@ ? >(@"(n(?㿘@2  ?`" ` @&@&`<* & fp align without being the FP owning process㿀`{    2` 2`>cؔ  @ ` ?{ 2  '  *  '* `H?z 2 *: '2   '쀢  *  '* `H?zÐ  4쀢`  '>L ,>_#X4 }`2  *@<'* @7" 2  '  *  '* `H?z `` 2   " 4 *  "* `H?ze q` z\d` zMఒ Z"7 *  6 7?7z= I4 `2  |" `2   * "|02 2  ` *` "  *``Hz  ` 2   䀢` *` "  *``Hy  㿈y  2 2  2z y 2  ' 4 *  '* `H?y̐_ 2 *: '2   '쀢  *  '* `H?y  7 2  `? ; `* >4€( % O씒  2   `*` "  *``Hyv  `  㿘 ?`` "@ =&@6   . `,+?%  $(,048< @?܀        "6 . ` k``?6 . ?6 8&stray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%b EC EFSPSETcrazy interrupts㿘 >   >^`>L>ᰐ"  >a   "a>]x!> "a"ᰁ㿘>2"  >Oۮ >O>O4 -J4 #>OHo o>H"T""TH 0 *4. >Oin>O 4J` *` intr_establish: level %d interrupt tied to fast vectorintr_establish(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%x㿈Ho o>!:  >"]  >>  7. > >`4 . !@>"!>"!@" : ?.)@  > `@>`(R@>"В?@*@ `)`#\  #`(R#d\Ŕ. > @@2"@&`H 0 intr_fasttrap: already handling level %d interruptsintr_fasttrap(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%x㿈>. !6` `4c@Ho o>!:  >> .  > \u>  2>">"!!@": #)  > @>(R> ؒ?*@)#\ #`(R\E#d!> ! #>2`  @$  q8 $$ ` > *@"H 0setrunqueue㿘  `2 >\"+ >2!&>' ∑* @"& ""remrunqueue㿘 >'b2 ; 2>[#X "` "@& *>2!@@  * +#breal mem = %d startup: no room for tablesstartup: table size inconsistencystartup: cannot allocate buffersunable to create DVMA mapunable to allocate from DVMA mapdvmamapavail mem = %ld using %d buffers containing %d bytes of memory 㿐>>`Đ!p>7\"b> ``>>`(#\* @ >-#L%>$@ *@ >[z#@")>B>[q  '>D , e1>%&  '  ">>[T 8 H D@!@ǒ)>,@ , ,@` `> D ꀤ'>$ >W"a>?  !>5?$# ?#>2?$a > !* >W"!|>[ `a # " #@ ">2>Z > a >Ȓ"@ >0>`(@ 2@ 2 `Ô!> , &': " -  ,> `"!g :` @b>O`@ ɤ > "a\>'"|>%>!| "`X"?  >'"|, "?>[a>>2`, \* >> H!>`,>D@$ Ȕ\/> @̒(8> !?H > !Ж @ >  >?L?H@/a"`L㿘>'""|>>!|!* >2"">!l>O * "8* >B>!"ᐑ*" * >K " * >O" 0* * >L @"0 ?>J>"c >O1>"` * >M"#T*` * > "!*` * " *  H`>  `@ & H>`D  #> H "`D "`D#>`D  $`D`D ̐#3*`@(`D$3$`D`D>`,@* 1> H@4& H>@ 2 >8`D2  :  ?!"@!"@>8>" @>*`" * > D"*`" * >2`" `:`>al ?>"!ȱ. 㿘   ?& ` %>L,wL$,.8 *& @ P$`D ?$ =#$  $ H$ ,$ &㿘`   -3>`TB`T  `T S >}#́>#p@$ `H  ` *@  $  ?P ?'H'L>#H@2'X'L 'P'T'X'\'``'d`'h@'l`'p`0't  * @  0'L'Dx>3Dtv?@4 HtW ?u =   ,*@  >&!0>&`0" =c"@$`$` $`$`H㿘tI@4U < @`23  ؔ ", ` `  $ <* `< @"` "`"`"`"0`"H@  $a  a ?"a ?`?" @$ āhalted WARNING: not updating battery clock attempting to power down... rebooting 㿘> >Z*#$>H "">\ >cp >7!"cpۦ"\(>Z#ؓHo o !>">>Y 0>Y#@>>Y  >! s*   @>! d*  ->*!!* >*!>!㿘>"">2 `*`" *   `@ @-z>`(> `` *  * $@>$ " h>" d>   dumping to dev(%d,%d), at offset %ld blocks dump area unavailable mmu memory @%p:%d device bad device not ready area improper i/o error succeeded error %d 㿘>s @#>b?> d '>h>b"x2 `YP >b`2  *"@ *`@`@>Y@"?b>Y:"0h2  * "@*`@>`Y."Ȑ@- @,>`(* >Y!">7">B K  I 7>5 #  >,<` >"Y@@:,`/>"8, @ >"X4`@@# >"̟@> ̐!@@ 2 `4 @@@ ۠"`   " 2>!̓-  hxxxxX(xxxxxxx8xxxxxxxH>X"0>X"0>X#0 >X# 0 >X#00>#@XFrame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p 㿈q>"Xs>Xp" > (44@@ <  $ ( 0 ,#\ 4#` 8>#d 8"XV#h 8 >mapdev: zero sizemapiodev㿘>Ā >-?x">-#L: @`>Vΐ# @?@@">VÐ# >-#L@*@> > 0 @@ , '> %> >[! П@ `h@&㿘@v: 2curproc = %p, pid %d no curproc cnt: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace 㿈>#p`">>`0W!>[W! >[a`a#\``` >`W!0qe#>>!pW>!`,? W`,   > <  $ ( 0 ,#\ 4#` 8>#d 8!W#h 8  >> ,? " <>Wr!؁g0 panicw: case 4 w: unknown case %ld w: arg not allowed 㿘N@  t>#p``">>>U#8#HWD#X0 0W>warning: ldcontrolb called in sun4m 㿘>  >W)  H/` />#p`2`> Đ` rK$` H p@` * ( 22#  *@ `  `" *`0*@2@  `*@㿘 r* P 㿘 !<@ P*r @<  "@ `    `  㿘> 􀢠 x r! 㿘 `q!     4      mmrw㿘 >aЀ  #>!В!b!Ж  @*$!а !Ѐ !> "a` Ѐ π - 7> > !+>G'>@`  ``&@? &`>T">#(ݨPPPPPPPP` @ 2` >-cL c ,   П@ ` > 0, `"@ @8c9 c,@@ u`` ?G# ,?H `>/#$ >8!0 : ``  `"@ @8 `@@8 ` @? S (` "&`J >  4 )0` !>4`   , ,'$ ,@$ ,`@8 9\$  @`@$@"$``< @ B `>`"&``  ">@ !>!Ѐ !@$!Ё ->   㿘>2"耦  "  @ " @  㿘#  & &n, ?㿐#@2> #| &`'>؀@> #|@"'Ho oH p@  $'' >20"c@    #@O0#@ݰ 0#@0#@m 0Ҁ`ΰ  2Ho o€H 0 @` $  &A 'Ho o H 0Un` \  U xHo o H 0 @2_ ^A`d / 2RHo o€H 0@ @ $$  n2"< Ho o@H 0>`% ! Ho o@H 0>"!& "'8  '2 VA2PA: Asked to translate unmapped VA %p㿘 @  @  $@ `@ $@  oΕ*$$ `@>@">G"@>B>-l>7?  `?`>2,0pmap_next_page: too much memory?!㿘>B>[ *  >/c,@  >0>7"@  *` 쀢>/>K"#c,>/,>."@*&>RK!`,>`,  ",pmap_page_index: pa=0x%lx㿘>-#l@ >>."@ >R."P>7" >B?  >2 , @ * @*  ?2@>2 ,"@6@>7>B @* ` ` mmu_reservemon4_4c called on Sun4M machine㿘 > `>Q#``#?>/"#$)?>8"!02 #?>/"#$)?>8"!0@N> !/>2-> 4` *` `$* @@`Д@`>`p &> T?  > ? >  4`@  , >  2  @ *`? @> ,Є@Ф@?@ @ >&&mmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry type㿘 !҂>4  *`L  ТЂD ```>0 >0> h>!pQ-"@>Q*!@>Q$!`4 `L  mmu_setup4m_L1: unknown pagetable entry type㿘?. # %?+`$І `% )`2%>   +`@+`@**? @` @ + `" ``?   @ P֐" ``Ͱ mmu_setup4m_L2: unknown pagetable entry type㿘?.  #?@, @І `*  `2>  **?   `+  "@  @#  P ?װ mmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry type㿘?.  ؆  ">*  >`*@ .` "@ Pa!P_!H? me_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptes㿘>5# -#` "`" "@&& ""& `& `" &`> !h>2!x$"$( "(, ",.`$>B!( !(>O! `2> >O"!@2>O"8` "`" "@&& ">2!x "> !h , (" ," ( * @`$*` `2 >O"X* @ @>O"+ @@@ %`>j>  `"@>@@>a< € >    *` *`:`* @>j>   "@>+ @@>    Э`  е@` > !'# >2#??#փ@   ,>0 *@ >2!("@ @ 2@ >)#t*` : @" $ > ,@@  >     > * : *` `> >    *`  *`:`* @@`>  5  ` "` $`  "@- 䭀@& `& `" &``$.* @ . 2 & 6 6 me_free: no segments in pmap㿘> .`"`* @ $+  * @>  + + :`* @>   Ь`  д` #> !>2 ,>0 >2!(##>)#t! > ,҃ @2 @*" 2* :` ` " `` "` &  "@2> >N#`!>  *` 2``""`>2"!|"@> ah`(?"`(`""`>B"!,"@> ah`,?"`,"">5c`"`""`> ah`$ "`$㿘 0 6`*  $* @`6` ?*@@<  > `  4 І@ "/?0-?@H /f * ' >B!(>`` Ю@`> ж@`> !> ,ڦ@`@H 0 㿘 >   0 4H /f>* '>p    l"p#+: tx@T@"t?"t?`> "t"x>`t`l, "a > @    `0&`4@4#&)>  @& - 䭀@H 0>!D  >  $ 2 `,`,`: $@*` *  k  ?` ```Ъ```в``?ٰ 0P N> ,, h:  "@ ! 3@ ҂` `  *  % $`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   PM= !H€ ">!D "`H 0ctx_free㿘2>>M"  &"> @>! (#> >h,>   "𢀀>@>!D>   "Ԣ`  "Ԣ-> Ԫ@)>`    h`  "𢀀 @ "Ԣ` >g>   "Ԣ> Ԫ@>`p$"`ppv_changepte: pm == NULLpv_changepte: no segmentspv_changepte: pte == NULL㿘gH /f4 * '    H 00 @ )>- 2>L~ p4`*`  $* @4` ?>Lq *   >   2 >Lc 2<` <`  | *c$ $ > !@ >W!@*T  ?#@?#@(H  ڨ@@>!8@   ڨ@  ֫@` ֳ@`  2<` <` >`( >`( ?* @ <  @& *@   2<` <`  | "@  $ " ?$ 2o @H 0pv_syncflags: no segments㿘gH /f4* '   H 0b  @ S+>)>??#4`*` $* @`4` ?>K#* @ >  @"5  ت@@@>!8@ ت@` ҫ` ҳ`` 2<` <`  (  ( ?* @"  6<   @2%  @H 0pv_unlink0pv_unlink㿘  >KV!! > ah "ah & &  & &   #   &  &  ?<& > !h>` "`K*!2    #"   >  (   2  " Y㿘`    @ > ah` "`&&  :&  7& > !h `"   !  /&  >  (` 2 !` 2!@`2`   # "@"`"` "` "` &pv_changepte: invalid PTE for 0x%x 㿘eH /f4 * '    H 00" )>`2`>J} p4 * @$*` `2>Jq 4  !!@ > ! >W!*m@` ?#?#(b@"ڣ!8@ 0 ڢ`<  @  > KL@: @& *" ! 3 ҂` `  *  % $أ@`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   PJ !H€ ``  $` "@` ?$` @`2r`"H 0㿘e H /f4* '   H 0 " w)>4`*` $* @4` ?>I#* `^ <` "ڣ p ڢ`<` @  2N `"K<    @" ?!8@ p آ` ?<`  " !`3 ҂` `  *  % $ڣ`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   PI\ !H€ 2% "@H 0㿘  >IB!! > ah "ah & &  & &   #   &  &  ?<& > !h>` "`I!2    #"s   >  (   2  " G 㿘`  ` > ah` "`&&  ;&  8& > !h `"       &  >  (` "  ` 2 @`2`   #z "@"`"` "` "` &㿘cH /f * '  `+>   "%>@%>#>@  `"Ԣa8 Ԫ@a8@  >    "ࢀ0@H 0㿘> ,>["!> (> : >``"@,`@pmap_bootstrap: unsuitable number of segments (%d) pmap_bootstrap: no kernel memory?! 㿐'D'H> `'L` >>0 " > >0 "`> ,>[["!L>"`p>8>ܐ <"`>B>ܐ!"`>O>ݐ 8"`> >Ր#\"a>)>ې!"c>/>ܐ "c0>->ܐ!t"c@>7>ϐ#"cL>B>ѐ "a><>ܐ#"a>2>ѐ#"`>N>̐ "c>M>͐!"c4> "!!? " L> 'L" "" >5 "$ +><! T# ?, @ * 2 ~??HL>d> `> " L*"@ *`@˲@ >" l> D"!(`@>5"##" >B"!(!(" >2"!x!x" >!>B  ->,+>-0 @ * @ %cl'>7$  >Hΐ"> # `cl>/"c,?* >.@" 0> ( `@ 2@  "` >7>"` ,`@"`@>G"c@>)"#t>G?"c> !$@>`"p>-cl>.">2`," 2 >-cL*  * @ >@""T 6 $@``$@T &`$@>"t?>"x>2 ?耢 #@  2 >`  >` ?3>> !  >2!x> ! > ah $ ++`? D6` `  D 6 %@'D % & "& &&" %( "(6> !&6``? ?$@6* @2`> !``?  ?$@`* @*` @ -@@> (* > !  @ > ,  Ȧ@@ L>>5#> !h 2`%"@""$ "$`L > T . >0 @@ >  >  >`   ?38  ?2@@Ȯ@`@ ¶@`@ 連 > T    Ȩ@@> 4>^! @ + #> ,І@ Ц@@ @ rp->rg_segmap == NULL! 㿘>8>ܐ!"`>B>ܐ""`>O>ސ l"`> >ؐ 4"a>)>ې#h"c>/>ܐ"L"c0>->ܐ#$"c@>7>Ґ""cL>B>Ԑ "a><>ݐ!\"a>2>Ԑ#|"`>N>̐""c>M>ΐ"\"c4> "!!? " #>5`" $" (" ,k@  `!><!@ k.$@$` ?+ @ * $?>d> `>"`l> "!`T*` @$!>B >+>`,)>-`0  *  %#l' '>7$  >F"> # `#l>/"c,?* >.@" `0> ( `@ 2@  "` ?#2 * >0"`>%" ` ҂` `  %* $Ġ`҂` `  *` ?҂` `  *`?,@҂` ` > *  PE;>""#>`T$@  , @ @$`ha <!>2$!@Q$>/"#4@K$>2"! @D$> ,>`0!?* >K"b> "! ҂` `  *  % $Ġ`҂` `  *` ?҂` `  *`?*@҂` ` > *   PDԒ > "!>:`h " 5  ҂` `  *  % $Ġ`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   PD !H€  > !#?#>(+%|$>/#4- @ 0҂` `  *  /% $Ġ`҂` `  *   ҂` `  *   ҂` ` > *  PDV(-  2 " 24 ҂` `  *  % $Ġ`҂` `  *   ҂` `  *   ҂` ` > *   PD H€   $>Ey"- ><!@$  , ,`@>2- a* @ 0҂` `  *  /% $Ġ`҂` ` 2 *   ҂` ` 2 *   ҂` ` 2> *  PCӒ2  ,`"@  3@ ҂` `  *  % $Ġ`҂` `  *   ҂` `  *   ҂` ` > *   PC H€ ``?%@    !> !<>7>"` ,`"`>G"cD>)"#t>G?"c%>"p >-cl>.">2`," 2 >-cL*  *  >@""T %T &%>"`t?#>@s"`x> ! >-#l@ >0 @ _>4`* @*` $4` !@@2  >`* 4@ >^! @ >>  <`  |<` @"! 4> ҂` `  *  % $Ġ`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   PB !H€ > ,@@ >-@>>! >`('@: 㿘 "֣!$ $ $֣` h0҂` `  * /% $֣`҂` ` 2 *` ?҂` ` 2 *`?.@҂` ` 2> *  PB2  ?!Т $آ`㿘>      > |> ܔ$_>҄` `  $أ@`!҃` `  "҃@` ` #҃` ` > *  PB[  * 2``$`_! 0҂` `  $ڣ`!҃@` ` "҃` ` # * ҃@` ` > *  PB0 * 2``%^! ҂` `  $أ@`!҃` ` "҃@` ` # * ҃` ` > *  PB-`2``$ %& h& |pmap_init: CLSIZE!=1pmap_init: unmanaged address: 0x%lxpmap_init: sva(0x%lx) < eva(0x%lx)㿘>[!> ,@ >Aא#p  >7" >B M 9>)5>->[!7> @>-#l@ ` " >2 ,@ 2 * >."@*"@ >A#2 #t* L, @ `h@@ >ɐ#A  * $@->  П@ `h @$`  >$!> "!>)€>-#l>0" >.">2" "a(㿘>[@!%> #> Аa@ @@ 㿘    @ "  @| @@㿘+ " & ]+&  & >  & $&  & $ " & ( 0҂` `  *  /% $أ@`҂` ` 2 *` ?҂` ` 2 *`?,@҂` ` 2> *  P@& , #>#?# (, "@ a 3@ ҂` `  *  % $أ@`҂` `  *   ҂` `  *   ҂` ` > *   P@ aH€    ( #>#?#, `|  #"a 24  ҂` `  *  % $أ@`҂` `  *   ҂` `  *   ҂` ` > *   P@z aH€   $ ( & 4㿘   ? & @Β "pmap_release: segment list not emptypmap_release: releasing kernel㿘H /f4>* '>     ">@6!    >@-" H 0 "> ">   "  (  >@" (x "& (& ,  " 㿘 V> !>N#[>M#4>   "@0@@H /f@* '@' > 6` 6` ?**:` * @ **  $* @ ` "@@ >H 0>   "@0@@㿘. $*  ` `/ |@ `x  ث@@> (&2   >a<€@>! @ @6)>#@ , ,2% 2>2>!8@>2 , * >0 >2!(" >)2 #t* <   "  ئ@ ,@@ `(,>  ../ : /  > T > >   ԫ@@`2خ@`ڶ@` - ` ?-` 㿘. $*  ` `/ @ ` "أ@> (&2  >a   a<€@>! @ @s`)>>`  @  d><2# >2!8@>2 ,4 >0 *@ >2!("@ >)2 #t* <   " }p آ`>`  `"@ ! 3@ ҂` `  *  % $ڣ`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P> !H€ > ,@@ >` `,>  ../ : /  ./  ! ڢ`>@"@:,["!pmap_rmu: no segmentspmap_rmu: no pages㿘. $*  `  / >>G!Ь  `2>>;!>  D >  2>` >`  | @'##>) >2>2 , * >0 >2!(" 2 ct* &> ,@@ -l "% ` ? -` @c "%@ > (  &2 ī@@   >a<€$>! @   ī@@>  `>`>  2>` >` >`( >`( ?*  @C#@ 7>2%  2>2>!8@>2 , * >0 >2!(" >)2 #t* <   3"  ڤ@>  2<` <`  | "> ,@@ Ģ@8->  ../ : /    >  >  Į@` ڶ@`ɒ "%c ` ? -` @ "%@>    0@"& 0 4"& 4㿘. $*  8 / >=/!Ь `, `2>=#!耢  " ģ@> > (&2  <€@  @t`+>>`   f><2# >2a8@>2 ,4 >0 *@ >2!("@ >)2 #t* <   "  p Ģ`>` `"@a 3@ ҂` `  *  % $ڠ`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P< aH€ > ,@@ >` `- ./  ! ڢ`/  >"@ ! 3@ ҂` `  *  % $ģ@`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P"@ ! 3@ ҂` `  *  % $ģ@`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P<  !H€ q "% m "pmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V: ctx %d, va 0x%x, pte 0x%x㿈 !!>0 >2a(& `V` >) >2,&2 #t* !0>) >2`,&2 t* @H /f4'* ''   H 00ڋ@@'7> ;> ?' $4`-* @ 4` ?>;#h@* @ 2>;# - `@2  @<` Q |N<` @ڒ "&@ ? - @ђ "%@    ī@@>!8@0 ī@@ Ҩ` Ұ` 2<` <` >`( >`( ?* ֆ >ϐ# ;7:  @' Ħ@W2> >  | @M"> !2> T?  Ы@@`> > Ĭ@`?`@ڴ@`?    ?+- "  ``Į`ڶ`\ "%  ? - P "%   0@"$ 0 4"$ 4< # "' 2''  ڨ@H 0 pmap_protect: last segment㿘 0U 숀@H /f@* '@ )>/#'> 6` $ 6` ?* * @**:` * @ >:{ p8 "i+   2`>  2   >`  |>` @O@@ "@,@@`F@ !  ڨ@@>@> !h@` @   $`` >a8@$` Ц@,@@뀦@0# ڨ@  ԫ@` Գ@`  2>` >` >`( >`( ?@ * ,Ђ@ Т@@ @@ @ { H 0 쨀@pmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! 㿘U> ,> ! @  55`  @6`6` ?H / * ' *`  $*  2 >;$#X0~2> >;#0wah`+  "`  >  @ >   >`  |>` @@ P*E"@@ "  ڨ@@਀@=>  2+>!8@% ī@@>  2 Ҩ`>Ұ`>  2>` >` >`( >`( ?* @ @@> .@ ਀@H 00 > !h `" H 0pmap_page_protect !PG_V㿈!>0 >2a(& `TO` >) >2,&2 t* | 0m>) >2`,&2 t* @H /f4'* '' "H 0 0Mڃ@' 5>#?#'$6`-*  6` ?>8#h ,` ` 2?>8ؐ#-`  "ڣ8@p ڢ`>`   ` ":`>8"h  #'"   ҂` ` . $ڣ`҂` ` 3҂` ` 8҂` ` > > P8 > !2@-,` ! ڢ`"  Ė ҂` `  *  % $أ@`҂` `  *   ҂` `  *   ҂` ` > *   P8[ H€  -,` ! آ` ,`"@  3@ ҂` `  *  % $ڣ`҂` `  *   ҂` `  *   ҂` ` > *   P8 H€ @  "%@ ? H-  "( "ڣ`(-"@  3@ ҂` `  *  % $ڣ`҂` `  *   ҂` `  *   ҂` ` > *   P7ђ H€  8 "%  4 " . # "&&& "أ@H 0 㿘 0R"H /f@* '@ > !h< '>> 6` $ 6` ?* * @**:`* @`@>7r p8 *  2a " ڠ> (@$@: U% >`  @  H>  %  " 8@p ڢ` ?&`3 ҂` `  *  % $ģ@`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P7 H€ > ,@@>` @ z>H 0"㿘R> ,> ! @     > ah` "`H /f * ' "䀀 6` Ơp`<  2>!8@*` *  $6` a>`  @2> ah`  "` N>"Ԁ*6`* @*`6``l    $p Ƣ`>`  `"@ a {@  ҂` `  *  % $Ġ`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P6] !HF 6`*` *  $6` a>`  " > 5  ҂` `  *  % $Ġ`҂` `  *` ?҂` `  *`?*@҂` ` > *   P6  !H€"䠀H 0pmap_enter: no such address: 0x%lx㿘 M>0 Ԁ >`  E*   #>0`>2a(&  א >)>Ր#85ے`>2`,&2 t* @ >2 ,6 ?*@ ∀@> ! @   @ ⨀@㿘6`6` ?,` $* @@- @H /f * '  > ` "< ؆@ 7 # @@ H 00e' ?>2 ,+ >0 *@ >2!("@  >)3 t*    Ĩ@>!8@  ,  U@ @ > ` )>2!x 4  `  -` > T>  Ҩ@ Ю@`ж@` ?@> !> , Ƣ@@H 0pmap_enter: segment filled during sleep pmap_enter: pte filled during sleep 㿘P!6`6` ?+   $* @H /f4>* '>    4 0" 2  :  & & 4    & 0 2" " ` >6(# , "Qw"$,  ?>  4``, @@2` "> ! * w@` >6#8  "@QQ$@ ,`  , >  @ > 2>` >`  | )@    Ĩ@@>! @  Ĩ@>  Ҩ`>Ұ`>  2>` >` >`( >`( ?* 6@ `# @@H 0U < p& <?m& <* ?>2 ,, >0 *@ >2!("@  >)3 t* Đ >!8@  ,` < & < @ @`>  @$>   ƨ@0 ƨ@>  Ҩ`>Ұ`>  2>` >` >`( >`( ?* @>  2>` >`  | $H 0㿘 E@? x*  <#>0`>2a(&  ᦐ >)>Ր#83`>2`,&2 t* @ >2 ,6*  " > ! @ "@"⠀pmap_enk4m: missing kernel region table for va 0x%lx㿘6`6`*`  $* @@  H /f4 * '   >ؐ!X3U>` @ @  23 ` ?@ <H 0H0q# >2 ,2`>0 *@ >2!("@  >)3 t* ߐ   "Ġ>!8@  ,`  7`. /@p Ģ`>` `@>"@ ! 3@ ҂` `  *  % $Ơ`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P2֒ !H€ H 0㿘'LM'T6`6` ?-` $* @H /f * '  2 " " ` "O]"%- %   2! "i  ` " %  '>#?#$ 24 0҂` `  *  /% $Ġ`҂` `  *   ҂` `  *   ҂` ` > *  P2RH€?Ƞ  p҂` `  *  o% $Ġ`҂` ` 2 *` ?҂` ` 2 *`?,@@҂` ` 2> *  P22  -` (>"@ ! 3@ ҂` `  *  % $Ġ`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P1 !H€ / @`đ>` ! " ` >36#8: "$ , 5>#?#  - $ 24 0҂` `  *  /% $Ġ`҂` `  *   ҂` `  *   ҂` ` > *  P1H€?Ƞ  p҂` `  *  o% $Ġ`҂` ` 2 *` ?҂` ` 2 *`?,@@҂` ` 2> *  P1V2  /  >"@ ! |@ ҂` `  *  % $Ġ`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P1 !H€ JT @  2<  ?@<H 0L  < & <?& <(T>2 ,2`>0 *@ >2!("@  >)3 t* 眐  >!8@ T , < & <T 7` /@  >`  "Ơp Ƣ`>` >" !`3 ҂` `  *  % $Ġ`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P0 !H€ H 0> h 㿘 s6`*`  $* @6`j ?*   > ` G @ ` @Kz>   "ڣ0 ګ@Ԇ@, >Ki>   "ڣ> ګ@>    Ы@`> г`>  2>` >` >`( >`( ?* Ԃ @@ `>  2>` >`  | @6  ?*> (> 0* @@  2`( $(2`  :`  > >2,2 (?*@ o> $Ƣ`㿘 >0 >2!(&  >2 ,>)ct6* א ?$ 㿘 2 >0 >2!(& >2 ,>)ct6* @`  㺐   㿘 >0 >2!(&  >2 ,>)ct6* 㡐 ?$ 㿘 2 >0 >2!(& >2 ,>)ct6* @`  ㄐ   㿘 {>0 >2!(&  >2 ,>)ct6* b ?$ 㿘 {2 >0 >2!(& >2 ,>)ct6* @`  E   㿘 {>0 >2!(&  >2 ,>)ct6* , ?$ 㿘 {2 >0 >2!(& >2 ,>)ct6* @`     㿘 >2>0 >2!(&  >)>2 ,ct2* E@>2 ,?6* <@>7 Ҥ> ,K ֤㿘>0 >2!(& >! 2 >0>2 ,>)ct2* @>0 >2,>2&@ !(6 ?*@(  >! " >2>)2 ct* @>2 ,?6@* <@>7   Ҥ@>`,K>>!8@ ؤؤ@㿘 {>2>0 >2!(&  >!  >2 ,>)ct2* Ӑ@>2 ,6* >! `` ?" Ơ>7> Ԁ*6 6 * @`l  *` $0 Ƣ`>  `"@ a 4@  ҂` `  *  % $Ġ`҂` ` 2 *` ?҂` ` 2 *`?*@҂` ` 2> *   P. !H€ > ,Jǐ>"Ԁ*6 * @*`6  l    $0 Ƣ`>  `"@ ! 4@ ҂` `  *  % $Ġ`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P-Ò !H€ "ࠀ㿘>0 >2!(& >! 2 >0>2 ,>)ct2* @>0 >2,>2!(&@ 6 *   >! >)2 ct* @>2 ,6@* >! ``"䀀 ڠ>7  >`Ԁ*6 6 * @ l  *` $0 ڢ`>  `"@ ! 5@ ҂` `  *  % $ģ@`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P-8 !H€ >"Ԁ*4 * @*`4  l    $ 0 ڢ`<  `"@ ! 3@ ҂` `  *  % $ģ@`҂` ` 2 *` ?҂` ` 2 *`?*@҂` ` 2> *   P, !H€ >`,I3>a8@"Ԁ*6 * @*`6 `l    $0 ڢ`>  `"@ a 4@  ҂` `  *  % $ģ@`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P, !H€ >"Ԁ*4 * @*`4  l    $ 0 ڢ`<  `"@ ! 4@ ҂` `  *  % $ģ@`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P,Q !H€ "䠀kvm_uncache: table entry not ptekvm_uncache !pg_v㿘>  2"䀀 Ơ w#>0`  "<>,""@>2 ,4 * >0 >2!("    >)3 t* m ?"Ԁ*6 * @*`6 `l    $0 Ƣ`>  `"@ a 3@ ҂` `  *  % $Ġ`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P+ƒ aH€ <>a8@> ,"䠀0/ .##%>) &>2>+"h , * >0 >2!("  2 t* 2>>!8@> ,ٰkvm_iocache: 4m iocache not implementedkvm_iocache !pg_v㿘>  2>+k!P  > І  +axЦ> ,> 2$$   ((@ "8>0Ԁ@:88> X" "@㿘>  D >"Ѐl* @  $>+ڠ`" 7 ҂` ` $ *  $ ڠ`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P* !H€ 0 >ڠ㿘>7" *`>   @>  > a@sG * > 0> (>㽀>   "  ګ@"#'Ӯ>`(* ?>$``>7"'" `">    " >7"* "><!!)>$@`@ "ƀ" `? 4` ?@)>' $@`@ "ƀ" `? 4` ?@2'>7" (>->>B  ?? $@`@ ƀ" [`? 4>7" >  B>   @1>7>   `> `> !ڄ' $@`@ ƀ" (`? 4?> , >  `@>  >   ث@`  س@`耤@ >"ƀ"㿘H /f * ' >0 >4€. >   "怀>@>   "Ġ> Ĩ@>  > p@`    H 00>"Ԁ*4`* @ l*`  4`$ ! ƣ@`<`  `"@ ! 3@ ҂` `  *  % $Ġ`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P)X !H€ .>"Ԁ*4`* @*`4` l    $ p Ƣ`<`  `"@ ! 3@ ҂` `  *  % $Ġ`҂` ` 2 *` ?҂` `  *`?*@҂` ` > *   P)  !H€ >  >@  H 00֤@.@>a4€ >   "栀0@H 0㿘&>a 3 0҂` `  * /% $أ@`҂` ` 2 *` ?҂` `  *`?.@҂` ` > *  P(H€㿘>"Ԁ*6 * @*`6  l    $0 ڢ`>   & ! 4  0҂` `  * /% $ģ@`҂` ` 2 *` ?҂` `  *`?.@҂` ` > *  P(]H€㿘6`*` * 6` a $>` ` >&@  4@  p҂` `  * o% $أ@`҂` ` 2 *` ?҂` `  *`?.@@҂` ` > *  P(H€2`((2` $:`  `  trapsvr4 gethrestimesvr4 gethrvtimesvr4 gethrtimesvr4 setpsrsvr4 getpsrsvr4 setccsvr4 getcckgdb exec4.4 syscallsvr4 syscallinteger overflowfix alignrange checkclean windowsflush windowszero dividebreakpointsyscallv8 store errorv8 idiv by zerov8 data errorv8 cp exceptionv8 unimp flushv8 cp disabledv8 text errorv8 r-reg errorlevel 15 intlevel 14 intlevel 13 intlevel 12 intlevel 11 intlevel 10 intlevel 9 intlevel 8 intlevel 7 intlevel 6 intlevel 5 intlevel 4 intlevel 3 intlevel 2 intlevel 1 inttag overflowdata faultfp exceptionalignment faultwindow underflowwindow overflowfp disabledprivileged instructionillegal instructiontext faultasttrap type 0x%x: pc=0x%x npc=0x%x psr=%b EC EFSPSET%s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_INTOF 㿐>[a``@ 3"`  E @  2  E  >> >&`&">(b >!.  >#P&>#p 2 >7! $ + #  "w' g 0< u  06 "' …  0, $ * 0& 3> >   0   0 2  0*?"$ ?"z` > >">'b'  >"  0''  @Eu > I ݐ'        >8! * >`xBՔ!$ >8 0 2  '   Ș  #>L`, Cr C$`, &@ "    >` >%ڐ# H` @ߔ @   ` "$`>%ʐ#0@@  H` @Ȕ @   `X``@ @   ` ?>%#@m$` ŝ "R'   [#>L`,>%#PC  $`, O    F>&s#p'   <'   5   &`&*'@&T#>&O#   &@   $ &`&&<#   &`&' `  (( Ā@ Ő " e >7, cX   "cX (@*@ $ (*>B!d ", (H 0. `D $"`DH o@ `  (( Ā@  " (%  *" >2*b@>L ,*@&㿘 ` `   x?ϔ @ 2??  @$` 㿘? " text fault: pc=0x%x ser=%b WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGkernel faultdata fault: pc=0x%x addr=0x%x ser=%b 㿐>[! >p` " >7!Ѐ  >0 Ԁ >  o @ @  >-#L @1. 2 Ho o> >%>$Q! "> >'#䀢@K> 2H =#@ >$"|w 9 $   @  Ғ &) @P @|^  耤@ > 0>@> ("@ ܓ2@ @8& "  @ժ + @"'  @2` 2'`Ho o>!>%O >#! {'` @    e @n `  (( Ā@ ^ "  >7, cX   "cX (@*@ $ ()S>B!d ", (H 0.LJ `D "`DH o@ `  (( Ā@  " (  )" >2*b@@>L ,*@'@text fault: pc=0x%x sfsr=%b sfva=0x%x CSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWdata fault: pc=0x%x addr=0x%x sfsr=%b 㿐>[! >p` " >7! ` @ +  `` `c@`  {@ >->`$q"`$$Ђ`  k@0#L`@.  `` `@2_ 쀎`  @3`@ 2 Ho o>!>$J>"! "> >'#䀢@9> 26 =# >$"{ ' $   z 耦 > 0>@> ("@ ܓ2@ @8& " (@@"'  @2` 2'`Ho o>" >#!>"! w'`   􀌠@n `  (( Ā@  "  >7, cX   "cX (@*@ $ ('>B!d ", (H 0.- `D c"`DH o@ `  (( Ā@ Đ " (d  'Ô" >2*b@@>L ,*@'@syscall cpcb/ppcbsyscall trapframesyscall nargsp>[a` "`@>`@#p>! x>  쀢@">!#(#@@"$ >!ݐ#@ `0   ,3   0`0`4  >#@  `8  .   * )@@T`2 >!#X,@ `H"*< \    @`2B  T`<; >@*   @`2' T`)'А`4'`Ш??$+ 2 &`0Ԁ &`4  @ "&` @` *@  `- @&`0@` &@&`&` `  (( Ā@ ِ " y >7, cX   "cX (@*@ $ (&ΐ>B!d ", (H 0. `D 8"`DH o@ `  (( Ā@  " (9  &" >2*"   @`2@ 赔@@>L ,*@&@㿘   `  (( Ā@ \ "  >7. cX   "cX (@*@ & (&Q>B!d ", (H 0.ą `D  "`DH o@ `  (( Ā@  " (  & >2*"   @`   (   B 5 pagemove 1pagemove 2㿘> ,?2>뀎2>뀎@> K!؀!'>)> !>[!㰟€ 2> :!h9 > !Ж @ h@㿘>$"@B㿘 >-#L. >0 @ 2&@> (ӓ6 &@>$"@#  h  㿘>-cL@ @.@ Y physiodvma_mapin: null page frame㿘> 0@ >-#L&@ * > (@ :@H /* ' '>2%   >  H 0D H 0??> (>5#*@ @)+>)'> >[!c€ 2>->##L>  * O  ?> ! П@ ?`h?ߤ>a 2a4€㿘> > 0`.>-#L .?0> !YH /*'>#>2 0>( >5:@ `&  2 %~ `H 0>a a4€vmapbufvmapbuf: null page frame㿘 0@2>$>"" H'>0%>-L ,  <  @@*@& L@L& H0-> ( 4??'>)%> >[!㰟€ 2> >"!? П@ `h?@vunmapbuf㿘 0@ H>Ӑ#>$">-cL <>`0;`      L>& H& L  H < @4" 㿘 9`H$`;q"  `>L ,!< ! *q &` ;^!&`c &`@ ;P P $"& 0 & & 0 & 4cP> $  "`>'#$ $ $  ?$ P>' " " "  " " 㿘  #>L`,2;Ր$`, *G >$" 9"!G& 86 6!X&( : P `>L ,;  :!"@c\!"!H'' ( ' #\#`#d#h#l  !X #\#`#d#h#l  &sdcd㿘  ?>#p`@b˔   >#x@bĔ  0``>  `$N` s>   , >  >  2  ,N` s2 ,  ,*@,@  "$`disk label read errordisk label corruptedno disk label㿘<  #&< 6 "`"`  `* ` 2&#"`&&@ K&(' D' T' @(' <`' 0@! 2 H:/" ' 0 "1>+ 6"@2@@ْ! !W@@] 1> :!   @bl"1> Ȱ 㿘`8 "; `( !25 @, !W@2- ` 2) * " ;o  * `@ .* @    @2 @  @ 9! 㿘@ \( H9"$ D$ T$ @($ <$ 0@㿘 G` ` < !"@*  @`8 &: `(`@e<2`  T@`2 @ 0@2@2@ "$ 4`( T@e(2` @  < $ @.  $ 4$ <`(`@e2`  T`8@dq $ @  0?($ 0SunOS disk label, bad checksum㿘"  @`@ *  1>!@!W&@&`&` &` &`  &`$"&`(!&`,!&`0!&`4!@d!&`8@d!&`<! 6`B! &`D!!6`H> (! 6`J6`&`&`@@d$ ` &@, , 2  $$  ,  4   !@$ &@,   gG#ꀢ@246`  Ȁ@  @`@  2&6` > (! @@dz$ ` &@,  , 2  $$  ,  4  6`6` 㿘 ("2  , "  0 o  &@ &` &` $&`  H6a 6 F 6a B6a J6a 66a F6a 2 6a .!a6a* @d-2  @b F@@c&@``% 6"6a   `  `` ````4(&`gG#&` ! @b @cV$``$``Ȁ@  @`@  &`  " " `` &` b@ 6a@`@ 6a 㿘 @- @"+ `>?  @29?@`d & ` 66 ` F6 ` 26 ` .6  ` J6  ` B6 ` H6 ``6`F 6@`G   8` .  @bK  "@b&& *`*@ @    (@  &?} ?`   * 㿘`=#>^!  :N . ` i7i6i5i4i3i2i1i0l7l6l5l4l3l2l1l0o7o6o5o4o3o2o1o0g7g6g5g4g3g2g1g0wimynpcpcpsr kernel: keyboard interrupt 㿘>!  >H" @>!?@kernel: %s trapFaulted in DDB; continuing... 㿘W? #>[>a * @>">5 4 #>[>d;"(#>[bؐ6 P`P`H6 `!>! @/$!py * ! ``H6$!6ϔ P 㿘>2" lprom㿘>cʐ!?%s(0x%x, 0x%x) at 㿐N `?#>[#  5=#>#x%> <, 8( ooo  "'># ` `. > #o >#Դi7fpi5i4i3i2i1i0l7l6l5l4l3l2l1l0o7spo5o4o3o2o1o0g7g6g5g4g3g2g1g0fqwstateotherwincleanwincanrestorecansavecwppiltlpstatetbaticktttstatetnpctpcillegalasrfprspcasiccryxcciccfcc3fcc2fcc1fcc0pageone_writen_writesone_readn_readsfqtoifdtoifstoifdtoqfstoqfitoqfqtodfstodfitodfqtosfdtosfitosfxtoqfxtodfxtosfqtoxfdtoxfstoxfdmulqfsmuldfdivqfdivdfdivsfmulqfmuldfmulsfsubqfsubdfsubsfaddqfaddd34efaddsfsqrtqfsqrtdfsqrtsfabsqfabsdfabssfnegqfnegdfnegsfmovqfmovd4efmovsswapaswapcasxastwa8r7rprefetchaqrprprefetchldstubaldstubt2ds2dcasaldxaldshaldshldsbaldsbldswaldswstdastdstqastqsthasth6q6pstx5q5pstbastbe8e7eqepd8d7stadqdpstlddalddldqaldqlduhalduhq6p6ldxq5p5ldubaldub8e7eldfaqepeldf8d7dldaldmovrgezmovrgzmovrnzmovrlzmovrlez1jdmovrzsdivccsdivretrydoneid2dpopcudivccudivrestoresdivxudivxsavemovomovulemovugemovuemovlgmovulmovugmovuojdmovvsmovvcmovnegmovposmovcsmovccmovleumovgumovlmovgemovlemovgmovemovnemovn0jdmovasubcccsubcflushTdsmulccsmultvstvctnegtpostcstcctleutgutgetletgtetnetn0F12FtaWdumulccumulqpreturnPdUNDEFINEDmulxqdpdjmplYdrdaddcccaddcimpdep2sraxsraxornccxornimpdep1srlxsrlornccornFPop21Edsllx1DdsllandnccandnFPop1mulsccsubccsub1iT12Ttsubcctvxorccxor1iW12Wtaddcctvorccor1iP12Ptsubccandccand1iY12Ywrtaddccaddcc1id12daddfbofbulefblefbugefbgefbuefbefbnefblgfbulfblfbugfbgfbufbnap,mfbabrgezbrgzbrnzbrlzbrlexap,1lbrzap,ubvsbvcbnegbposbcsbccbleubgublbgeblebgbebnebna,mbaCdsethimilltrapncallnop undefined %s,a,pt,pn %%%s%%f%ld0x%lx%%asi0x%-2.2lx%%fcc%ld[%%%s + %%%s] %ld[%%%s + 0x%lx] %%asi%%fsr0x%lxl#%s%%hi(0x%lx)%%psr%%tbr%%wim%%y(UNKNOWN), 㿘>#ؤ  []@@2 > H +0p70~#0~2 :  2  2 @  @2 @ 2 ? 42 @ @  2 @"    22>>V P  ` L *L ,2" :#L a p @">  h@> p> xo*LL ܀ ,>c L  !>>" 4` * 4` * Б* : `E>#*` |بذ@L Xtttttttڴ(tttttttDtttPtt\thttttttttttttt t8T|٬ ڔٔ٠\@ `* @@>  > >  > ?,@ >  g> ?,@ 4`H `??,@* kc ,`k] ~>y > >  r `* @@> L 72g> ؓ4` ``> ?@,@ L 82V>Q >N >K >! `4` ` D>c4` *@>#>!6>"># >!v,` (> p `"> j `?>"># ` > ! > !(>!0>!8>!@NL >H!PL  >!X@ 㿈`d >\># `*` 44  4"@ 4"@`    @ 4"@  4"@ $ "#\;`@%!`?   @ 4"@  4"@   @:㿀\`` d 3?` @\ * @ :* @\ ` * @`:* @#\`#``:`*`"" #d#h#l#p  ; + ""   " /`/` /` @  @\ * @ :*@\ * @\  *@\ & : * Ȗ>#`>   ``.` `?G?$c +` ??`+ `*    `   4D $A +` + `*    `   4" $  +`  + `*    `   4  * *` G   " A?@\  *@\ &:* @[   *@[ & : * #\`*#`. `:`*`" " #d#h#l#p *  ; + " " @ 㿘  ¢` @[` * @`< , `@:/ ""@[  * />c.`>@  `. j:`"``"a?" ]?  @ ( @$ $ * 䀤`J >#.` > `. :=8?/ ``"``"+?" '?  @ ( @$ $ `" `` ?  ?#  2#: #  2  2#`"``"?" ?  + @# # * Ұ  @[ *@Z &`?` :`*  , ,  ,  `.`. :." "@Zݴ * 0>c.`>@  `. :`"``"?" ?  @ + @"   " * 〤`x >#.` > `. :k8 . `"``"Z?" V?  @ + @"   "``"@``@??@;?#@`@2#@@: #@`@2@`@2#@`"@``"@?" @?  #@ .@  @#@ *   㿐\'P`l 'Ld p& @Z"'* @` @Z*  / @ @@ h) @ @'/ ??@h@) ?  @@ @ @,`&@@Y'* @@Y*   -h 0>>c.@  `(` @:,`. " "?" ?@ @  /@ @ @ @&@@  `(` >#. < y:@" h`)  " "y?" u?@ @  /@ @ @ @&` "@ @\?@X?`: #@`@``@ #@`@ `#@`@2` "@ "/?" +?@/@ @  @#@,`@.@ @" h) &` " "@?" @?/@ @  @& "@ @?@?: #@@@ #@@ #@@2 "@ "@?" @? @  /  @ @#@,`@.@  d"h a>>c.@  `L(` +:@" ,`. "@ "@?"@{?* @  /* * @ @&@@e @"b ,`. "@ "@V?"@R?2 @  /2 2 @ @&@@< > `(` >#. < ,:@"- h) L@`* `2% " "?" ?@3 @  /@3 @3 @ @#@+` "@ @?(@?'`3: #@+`@``@3 #@+`@ `3#@+`@2`# " "?"?@2/@ @ #@@22@  @#@,`@.@n h) P&@2 2`& " "|?"x?@+/@ @ #@@++@  @#@3 "@ @W?(@S?'+: #@3@@+ #@3@ +#@3@2" " "!?"?@* @  /@* @* @ @#@,`@.@n 㿐@S#\@㿈   \%`@ 8%`,= ` @V 45    0 .  +@*` *   `, `,  4      ` ` ܦ 0@*` *    ``  #\#`<#d ? #\#`#d & ?` ` Ԧ  㿐 2/>">cH >" @]0H /* & p!  H 00= & pH 0 HN d>"@5H /* & p ? H  & p`& p>@#Hٔ V  H   p  ?& px"Y H 0㿈 (    P    #\#`#d  H/` / 0   & 0  & 0H 0 0& ,H 0  @ > !>!X@P;!Ԕņ㿘H/` / , "  0& ,?& 0H 0  @  >!X !>@P!Ԕ$`,H 0 `@ > !>!X@P!ԔJrcons_init: linebytes assumption botched (0x%x) 㿘>a& P"a " "> `"">l"0j:`"  " \ & X@O` @ 4&  \@O@ @ 4& ># 2` `2` 2` 2` \ @U^@ \"@2`@:`  & H@US  \"@2`@:` & L@UI  & @  H ?@ @$& @ \ @U:` `& D $ 2 (>& >b& $"b  @"@> & (>#>#"`ā㿘 ( 2(      "? `  @ @&  ( @Ԑ@],H (@ 2  ( & < (& 8# 37& (  @0`?@? ^ # $ "@@4  @ ^(   &@@?@&@N`<@ ( @㿐 $ \@T   H @T  (  2` ` L  : P :  P \t#\ $@"@ $ @& " @ "@  @@ϒ 㿘`=> *` 0p8T$ $." $  '?%&  $"@@^"0 @ "@  @@ 0 0  $` " $@ ?"@㿘`[`; ( 73$2 ( ;-(   ($! >& (& 8 8*` * ?А& 8(" =& (& < <*` * ?А & < @ː@ ( ?& (㿘`3>"*` T L,<L 8@0~  8" "  $ 8 " $@  $ 8" " $ &e&0c $"  8 " @ W?U"@ < $?"@ $@6 "@?"@ 8 ?"@ @6 ;"@8?6"@@v02@0/ 8@0+ 8@(0' 8@0# (!2& 8 8  ( & ( ?& (  (!2& 8 8 & 4 (& 4 ? & ( @&㿈 \ $@S   H @S  L P #\#`#d   ( & (㿈 ( `2 P0` P    #\#`#d X (: & X`& (㿈 $      P X  #\#`#d@  \`@RÐ  P H L @ D X#\#`#d R㿈 $ \@R   P H @R L @ X#\#`#d "3㿈 @4 "@" @ &"@ \ @R P H L @ D#\ H #` L##d P H L D @ X#\#`#d" 㿈 $ "@@ 4  \@@RU@RQ` @RJ @RF P H L  @#\  H@ #` L"@#d P @ H L \"@ @  X @ #\#`#d㿈  "@@ 4  \`@R@R@R  P H L @  D#\ H #` L#@#d P H D L @ X#\#`#d" 㿈 $ "@@ 4  \@@Q@Qܒ` @QՐ  P H L  @#\  H@ #` L"@`#d \ H L P @Q@  X#\#`M#d㿈  "@@ 4  \`@Q@Q P H L @  D#\ H@ #` L#)#d P \ H L @ @Q  X#\#`#d/emul/svr4㿘7 2㿐N  >@Z 2$#Ė ; >"8&`T&   / &>x*                           ? 2 2 2"2$2(   `2 2!2"2$ 2(R "  "2@?? 2@ 2` "` "`"`  "`R"  "2`?? 2`2`: :@: :`"`R "  "2@?? 2@ 2` "` "`2`  2`R"  "2`?? 2`2`: :@: :`R"`㿀 4>0#@ ="`# ?'@@Y @'=`'`L' " @2    2  ( 2  @* @R` 2    `a  㿀 >40 # =`" '@@Ye@'`'& '㿈 >40 # =`" '@@YG@'`'p@'`  :? J'  @'`'`'؁p@'`  :? .'  @'`'`'؁㾀@'` ] 4 0 $# =`" `"( @'W' X" ` ߐ@@  '@ 'P?H Wš :`      0 0@ B 蚢@ b Ȁ :@ C  00@'0?8` '> L*` ttt0̐`''`U' }5&x  E'찒 m` `@''''4]` &༢0 4 0 # =`" `! Js@' '' <L`1  4 0"="`" ?'`!_ $ %![   쀢 !F   ` $!B N㿐` "{`)& "" 07"" 0 "~, "| ( @  !*@ @ ?*@!  2 "| 2    㿘 @` `@*@"G  ?A # "@,>@#>'#@>- @! 0'"@> !@> @2 >(!@   !"#   @` "`"` "`  "@ "` 2` 2` "` "@ "`"` "`  "` "`㿘 &`, 6`0 &`4 $&`8 (&`< ,&`@㿘Β 06` 4&`  8&`$ <&`( @&`, ``4`0'`'` " ? ="`" } ?>"* @d` `"b'``]`XU'`# O'`# F'`# =' ')" 7P@ @ .{` T$ ''"`ޔ T 2Pu@ؔ @ 2 )u 㿈`'`'` '*ݒ㿈`'`'` '+x㿘@ 0  0 G 㿘 &`, &`0 &`4 $&`8 (&`< ,&`@ 0&`D 4&`H 8&`L <&`P @&`T D&`X H&`\ L6`` N6`b㿘Ԓ ,&` 0&` 4&`  8&`$ <&`( @&`, D&`0 H&`4 L&`8 P&`< T&`@ X&`D \&`H `6`L b6`N㿈`'`'` '`'#ϒ㿀`'`'` '`'`'%㿐`'`'"㾸 ` 4 0'`" '="`" ?'` "%'<  29  '"5 0 \ (xb`  p '` x p 2rܔ \ 2 " 㿘@ 0 s ~ 㿘! &`,6`4 &`8 &`< 4&`0V $&`@&`D (&`H&`L ,&`P&`T 0&`X&`\㿘 ,&` 8&` <&`  0&`4 B6`$ H&`( P&`, X&`0㿈`'`'` ',㿐`',j㿈`'`'` '.ђ ``4`0'` " ="`" # ?'`   ? ` ` @5 p 2\0 8 "`O'`?` H>#*` ##$$$$$###@ '-6 1` +  8 $@P`  p '``" '` `"'  2  '- 㿘@ N0   N0M V [d㿈 "``h耢  //77 㿈''@`2 '  4 0"@="`" ?'?'P t 㿀 >40 # =`" '@@T*@'`'T'㿀 >40 # =`" '@@T @'`'`6'㿐@ @2 &svr4_getdents: bad reclenH'D'''L ` 2`( `@  @ 8  ɔ 'D2` 'Ԑ'ؐ ''''?'D'7 Q 2 2F =5 ' "> "耢2 @ `  ?@6@ʒ `''@F7Ȑ&@%4: L" D  "  x`2* ` 2'$ `'`  *'`'@'` :?>-#L `@*@ *'ؐp㿐   *@. $` (v`@     @8 &  ~` "$` ~$`  x'L >40 # =`" 'ܖ@R՘L<  ''L+'0'L'㿘@``Ғ㿘``` ɒ @!^> $(-L,,,,,-,------L-L-L-L--L-L-,-<-L-L-L-------T-`-p 6">l2">x."„*">,&" #" < " ">">">""  ">[">["  㿐@   2@ &@@ 2@ &@@'`'@P2㿐@   2@ &@@ 2@ &@@'`'@P9sbrk: grow failed, return = %d sbrk: shrink failed, return = %d 㿐@>-#L @ *@ '" ` >`52 `$@:  1> (*>-cL  * " `' ">> "x 0 (@  ؓ:@  6  ʔ > "  > 0 (@  ؓ:@ " $ ذ 0 40'# =`" ݾ' [ʔ H T#>@H:aX'aX@B@@BaX@H-'aX@B}@@Bz'?'ݕ 2 H ,@HaXaX@Bb@@B_aX@H'aX@BV@@BS'@GaXaX@BH@@BE&@{ 㿀@ ""`  "  J = "C D    @A . aF . 6`  > &1  *`  4:`0 ?" =b`"@   A?耢 2 ''P "      `$  &  &㿘ϐ >/#< "   0  2 0 㿈@`F> #*` 4L3344 4`''؞ "$ 1` "  "(     0 q` "   2      &`'`m' 㿀` " ` N А"@&  ` А"@'''` 㿘@ 0   0 Nx@C  'x ' 0'N - 2 ! '! ' '``>`'  >">`*` '    "*` `'  '|xH svr4_wait㿘@ "    " P ?   &`&` P `" L - 0 " L -   @2w HL - V` "SL -& ` 2` 2  T "4 հ 2p$ T4  ! H!S   G? `? "`  C * {Im `"  "`   "@ H`" L L"`L L H"@& )>`  ?G"` L - 2 H (@ 2 Hh` " H` 2&@ $ (& `*`&`* 2}`2` " @2&! > 誖 "f P1Y E   `  㿘 &@ &` &` &`  &`  <&` &` `$&`  &` &`4   &`4   `4 &`4 &`8`< `\@Bq @L >40 # =`" !'L@@N@'N' #!  P`  `4`0@'# =`" Y' !  P` x `4`0 ''" =b`"@ @''  '''L ͔  "   ' &㿐@   -@ 㿘"` N 0  0`  㿘 㿈@'`'`'l㿈''@ ' 2 ש  㿘ה㿘 ,  ) 㿈X  U ?倢` ->"x*` >>??????>>>>??                 $ -@ K  2  2 >bp" @" ( &X@*n"@ 㿘 (@@ R 12㿘  R` "`(0 >"p"`  1Ρ  `@?&& & $ 㿘@@   >#: *`  *@" * ?@*@&@㿘@@В   >"+@"*@  ?: * @ +@&@ 㿘 `&@ &`  &`  ` &` "` &`@"` &`@@"` &` "` &` ` @&`㿘`&` &@   &@   @ &@  " @ &@  " @ &@  @ &@  @@ &@  @@ &@"@ "`"`  "` `"`"@ "`"`  "` `"`X@ ( P `` 4 0"@="`" ? `   ؒӔ 25DΔ "( >@#'* 'y' Ȑ W  p ` 4 0@"@="`" ? ` `  2/d| "'" ''Ԑڳ 2ؐ` V[  H@ 4  0"@="`" ? ! ?&{ >#* b"B h`a N0j"G'd6 N0b@U N0^` 2' '-'' '` @?3''ؐ  E ?=& 6а 3&' ' * 'ޔ$''Ȑ ' @?'ٔ ؐ " 0   ę+ +@ '㿀`  `Ġ `  :` 4   .֒H/` /@```?  "`Ĕ @  $``Đ*@$`?" @$`ēH o@㿀@   0%` 2    Ē '@>   : *  +@& `M 㿀@ >  pd'㿐` @>'`c* @'٣  &@  "` N $a  Ē@і ` !x!x "@㿐 Ĕ' svr4 socket cookie mismatch㿘> `(  >""""  "">" " > 2 | t2 | x2  |   "& &   2 㿘`(>  `>""""   ">""2| 2||`"`"|"@  02㿐>c   >""""  "c  @ $  $ t h$ x$ ǒ 0 , `, >bb $ |b |"` |">"""$  㿘`?`>"*` NNNNNN̐ &`  &`  &` &` &` U 2 2 2  2 @2 @2 2!2" 2(H0 !`H&!W  0Q0!K >M#H' ` '` `'2  ˔ 2*ؐ@< @ W7Ȑ   2 @  unknown㿘@<’ &@ 0&` <   &` &` &` &`  &`$ 4&`0 &`8 &`< &`@ $&`D (&`H ,&`L @&`P <&`T>!&`X! &`\㿈 '@'`'@㿈 '@'`'@R㿈 '@'`'@㾠 >40 # =`" '`@H``' `'' 2"  ` "|< 0 ``   㾠 >40 # =`" '`@H``' `'' 2" ݔ ` ";< 0 `G`̔  㾨 `4`0`'# =`" ' 2  ` `  㿀@; `  " 㺐@;%>aH@;=!/> a@;7!/>aP@;1!/>J!p!p` J (J  (J:J*J  ) J`#"JJ  J: **J  : *>cД!@:/@6%0unsupported㿈@ 2`! "'>  +  N0a"!>4>>"<  ! ">.!"! O N">?" N0G> ;!9!P7!p5#>2">/!H-!>*"("Ь 2, '   `ܯ#\ К 2 '   `ܝ#\  @: 8`㿐``  N`@ ' `'@ 'p >40 # =`" '@@GS@'`    ''''@ 'x'܀ "0'ܐ8㿐 >40 # =`" '@@G ? '>h(ZZZZZZZZZZZZ             ?㿐 >40 # =`" '@@Fۘ`?&` & & 㿘`?&` & & `(  4!= 0"`"@ $ @9Ǡ ?' ?'ה "$c 2  ` 2 <  2 2  ]'    `2`2 `"   ``2 ` * ( ?  ((㿘` @@9 .`. `6 `& 㿘 i` j@@9``. ` .   *@`*  @".㿘p  (&@R@ "      &`   &`&`  &`&`&` &`&`h  " 0  ) 2)˒Ȁ    N'ؐ ̀`'ܐ  ''@'ؐ '' ''''' ذ㿈  㾈 "5   2. "'(  'Q쀢 " &  '   N   ''t('x '| Ð  h ," /  , 2)O耢    N'' 쀢`'̐ '' '@'Ȑ '''''''  ,㿈    w 2'T㿘?"@` +>" *` b4bHb\bbbbbbpb̒V F hȐ@8\ , . " 2  ''̐ 'А?'?ؐ?'' ''' ,&  ,     x   2Wx "Q   L N 3 c༰x ) jiOz "z 21'`4`0" =b`"@  ͒  'h'l'phPed `2  x@7ޒ!'| ' 'x  x  㿘       U~    'p t |@  v N'Th j'T`40T "@ =`" T `   Z 2\ "'X "'XO N I E N0D'\'`XT8 " :'\'`XTc T $ 2,T   2%@   NhkT'hnhT 'phT      㿐' b    &&  ` 2 % ?   ˔ $ 2 ' '̀ 2 'Ā 2?& & 㿈''~K㿐'M㿈   2%?c !@@    0 ֖  w 㿀? `O&>"*` mo o o o o o mnnno o o o no o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o notPƚI' '䀢 ?` @ ?'@ ` ''ߔ )`  ' 0'  &Ou x  @`*@@ 2`    "`{?'`    n?' ܀b   2\  2V N܀ 2R NȐK ܀ &E @ @ `ޒ 2 jXE j `4`0" =b`"@   2(؀ $ "'( NH@'H'LN'P',H'0 '4'8'@'H'L@` N(&㽨@ *@`@4!@ *@`2`[  b "`0Q?''`  U 0D?''e ; ?Ȁ?5 N  /  j4' 0  "@ =`" `   , `" 4 ``  @ M @>װ  '' '?'̐ ' $@''Q4'    ' 'Đ ' ' '  2հ N'7 (`'9 ('? ' ' '?'' $@''L'ఒ  $  '' ''Ġ ('Ȑ '  2 N' '@'=6"''А '`' ('?''  Y$ $ # $' ~ o  i N̒'В''' '''И''@O L U F '  2? N' `'0 N'' $)$` "` 1 ` * `` !  ` `    &ntp_adjtimentp_gettime#247 (unimplemented sockconfig)setsockoptgetsockoptgetsocknamegetpeernamesendtosendmsgsendrecvmsgrecvfromrecvshutdownconnectacceptlistenbindsocketpairsocket#229 (unimplemented)#228 (unimplemented)#227 (unimplemented)#226 (unimplemented rpcsys)#225 (unimplemented open64)#224 (unimplemented creat64)#223 (unimplemented pwrite64)#222 (unimplemented pread64)#221 (unimplemented getrlimit64)#220 (unimplemented setrlimit64)#219 (unimplemented fstatvfs64)#218 (unimplemented statvfs64)#217 (unimplemented fstat64)#216 (unimplemented lstat64)#215 (unimplemented stat64)#214 (unimplemented mmap64)#213 (unimplemented getdents64)#212 (unimplemented lwp_alarm)#211 (unimplemented lwp_sigredirect)#210 (unimplemented signotifywait)#209 (unimplemented)#208 (unimplemented)#207 (unimplemented pset)#206 (unimplemented schedctl)#205 (unimplemented signotify)#204 (unimplemented install_utrap)setregidsetreuid#201 (unimplemented door)faclnanosleep#198 (unimplemented timer_getoverrun)#197 (unimplemented timer_gettime)#196 (unimplemented timer_settime)#195 (unimplemented timer_delete)#194 (unimplemented timer_create)clock_getresclock_settimeclock_gettime#190 (unimplemented sigqueue)#189 (unimplemented p_online)#188 (unimplemented processor_info)#187 (unimplemented processor_bind)auditsysacl#184 (unimplemented tsolsys)#183 (unimplemented)#182 (unimplemented)#181 (unimplemented)#180 (unimplemented)#179 (unimplemented)#178 (unimplemented kaio)#177 (unimplemented)#176 (unimplemented inst_sync)#175 (unimplemented llseek)pwritepread#172 (unimplemented lwp_cond_broadcast)#171 (unimplemented lwp_cond_signal)#170 (unimplemented lwp_cond_wait)#169 (unimplemented lwp_mutex_lock)#168 (unimplemented lwp_mutex_unlock)#167 (unimplemented lwp_wait)#166 (unimplemented lwp_setprivate)#165 (unimplemented lwp_getprivate)#164 (unimplemented lwp_self)#163 (unimplemented lwp_kill)#162 (unimplemented lwp_continue)#161 (unimplemented lwp_suspend)#160 (unimplemented lwp_exit)#159 (unimplemented lwp_create)setitimergetitimergettimeofdayvhanguputimesfchroot#152 (unimplemented modctl)#151 (unimplemented)#150 (unimplemented)#149 (unimplemented)#148 (unimplemented lwp_sema_post)#147 (unimplemented lwp_sema_wait)#146 (unimplemented yield)#145 (unimplemented lwp_info)#144 (unimplemented sigtimedwait)#143 (unimplemented fork1)#142 (unimplemented vtrace)seteuid#140 (unimplemented)systeminfoadjtimesysconfigsetegidunamerename#133 (unimplemented putpmsg)#132 (unimplemented getpmsg)memcntllchowngetrlimitsetrlimit#127 (unimplemented clocal)xmknodfxstatlxstatxstatwritevreadvfchdirvforkfpathconfmunmapmprotectmmapmincorepathconf#112 (unimplemented priocntlsys)#111 (unimplemented async)#110 (unimplemented acancel)hrtsys#108 (unimplemented sigsendsys)waitsys#106 (unimplemented nfssvc)#105 (unimplemented)fstatvfsstatvfs#102 (unimplemented evtrapret)#101 (unimplemented evsys)contextsigpendingsigactionsigaltstacksigsuspendsigprocmaskfchownfchmodsetgroupsgetgroupsreadlinksymlinklstatpollputmsggetmsg#84 (unimplemented sysfs)#83 (obsolete libdetach)#82 (obsolete libattach)getdentsmkdirrmdir#78 (unimplemented rfsys)#77 (obsolete rfstop)rdebug#75 (obsolete sigret)#74 (obsolete rfstart)#73 (obsolete rumount)#72 (obsolete rmount)#71 (obsolete unadvfs)#70 (obsolete advfs)#69 (unimplemented reserved for unix/pc)#68 (unimplemented reserved for unix/pc)#67 (unimplemented reserved for unix/pc)#66 (unimplemented reserved for unix/pc)#65 (unimplemented reserved for unix/pc)#64 (unimplemented reserved for unix/pc)ulimitfcntlchrootumaskexecvefsyncutssys#56 (unimplemented exch)#55 (unimplemented uadmin)ioctlsemsysshmsys#51 (unimplemented acct)sysarchmsgsyssignalgetgidsetgid#45 (unimplemented plock)#44 (unimplemented profil)timespipedup#40 (unimplemented xenix)pgrpsys#38 (unimplemented fstatfs)killsync#35 (unimplemented statfs)niceaccess#32 (unimplemented was gtty)#31 (unimplemented was stty)utimepausefstatalarm#26 (unimplemented ptrace)#25 (unimplemented stime)getuidsetuid#22 (unimplemented System V umount)#21 (unimplemented old_mount)getpidlseekstatbreakchownchmodmknodtimechdirexecvunlinklinkcreatwaitcloseopenwritereadforkexitsyscall!,"^ ! n"Z  2"V  S`Q K< L` "H  5 C` 2 >`)`": $"6 "X' 1`'$ ,` "&  `% `           * `2`` 2``2  8>#P(# ! 2 K n   !,"X$' )` "#%" !㿘  " .`  " .`  " .`  " .` !   " .`  " .`.`  .`!  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`"  " .` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@$@" =&@(@( 7&@@@$ ;&@ "@@ *@&@  `  ?&`  `  ?&`  `  ?&`  `&`( |&`  0 " a  0c b&`  @`$ ;&`  `( 7&` !` `*@&` "` `*@&` $` `*@&` ("``   *@&` n&`$ `  ?&`  ` ! >&`  `   ?&`  `   ?&`  `   ?&`  @`   ?&`   `  `  *@&`  !`  ` *@&`  "`  @ ?&`  $`  ?&`  (`   ?&`  @ `  `  *@&`  @`  ` *@&`   @` $ ;&` 㿘  2.`.`  2.`.`  2.`.`  2.`.` !"    2.`.`  2.`.`.` !.`  2.`.`  2.`.`  2.`.`  2.`.`  2.`.`  2.`.`  2.`.`  2.`.`  2.`.` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@"@$ ;&@(@( 7&@$@ @*@&@ "@@ *@&@  `  ?&`  `  ?&`  "`` *@&`` ?&` ( `@ &`  #!" ` "#`0 ` &` $` @ ?&` (` ?&` @`! >&` @`" =&` @`$ ;&`  @`( 7&``*@&` $W`@&` `   ?&`  !`   ?&`  `   ?&`  `   ?&`  `  ?&`  `  @ ?&`  `  ?&`  @` ! >&`  @` " =&`  ` $ ;&`  ` ( 7&`   @`  ` *@&`  @`  ` *@&`  $ `  `  *@&` "@ "` ("`  "` @   ( 2@ 2` 2`  2`*`@  (   ` "  "    g -  h `Ȕ@ 2@) $  m h $`Ȕ@ 2~  '    D $ 2g :  2]^ R Ԓ?#`>'#*` DP\dddddddddDP\      ȟ@&`h@  x  2 `g@^ *@ *` *` *` *` *` *@ *` *` *` *` *` *@ *` *` *` 2` *@ *` *` *`R "` *@ *` *` *` *` *` *@ *` *` *` *` *` ?# `wK&>(!|* 00\``w@ 2İ  2  2 `v`ct`@ %k ؒϔ  2      }`Д@ xB   2hǒ `Z`t@ U   2EԒ `u7@ 3 o,c  2% ~  }     }   ~@ 㿘'L `(P`\  @'T!x&`($ $  $ $ $ $  $ $$ ($ $,$ (0$ ,4$ 08$ 4<$ 8@$ <D$ @HL$ DL` D$ H ? &`$`Q$` &@pc or npc are not multiples of 4! 㿐 $`(`!  ţ @ 9    >)/#@ <* `(< @" " " "  " " " "  "$ $"( (", ,"0 0"4 4"8 8"< <"@ @"D D"H H"L@ 戒@  `В?" @& İ?>*`"" " " " U" >*(@B ?" " < : 7" "" 01" . , "" 0&" # ! >*d(   "  "  "   "  " 㽐>#p@`$`aa H   a*@ aa#a  = ?x|͖!' ''x'l'$ ?"  ?, "$Ĭ $>&b4>&!0"@=#" $ $$HT_SVR4_GETCC T_SVR4_SETCC T_SVR4_SETPSR 㿈>`"8@`< ?``88 >+ *` l0>+ᘐ !`>+ᓐ 0`@&`0>+ዐ @`&`0*`" *  *  &`0&`4` &` &`(sparc) svr4_sysarch(%d) 㿘>+@א!h 㿘E/emul/sunos㿘` `   `!" ! ! 0  %    >#H&`T       @   2 "@  2"`  0"! @0 0@0 "#@22  @"`> ("`("`$ (  2@22 2@2 2  "` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` ! " *`"`   `*` `   `*`!㿘  @ @ @ @ @ @@ @ @d @@ @&@  `@&`  !"   0 "#0   02`@2`2a2b2d 2h@ @&` 2 `` @`2` 2`@&`2a@2b 2d2h @@&`  (>ap & ` &` `  .` `  .` `  .` `  .` `  .` `  .` `  .`.` `  .` `  .` `  .` `  .` `  .` `  .` `  .` `  .`  "`  .`! !2.` .` !.`.`㿘 6@ 6` 6` ` 6`  .`  㿘&@ &` &` `&`   .` X @` @*@`Ű ` 2`  `!`!!B r# "  !h#t0 _ $0 d"' !Vʐ0 I 0s  <0m  %#  "`  !0R  0W  e  !0K  0E     +  &̐07 4!0!"+`3 !,- - !"`  ! !0 !) !(     !2 !1  -0 !0!"`#0! 0! 20!B00!"_`0!ѐ00!g00!/0!-0!0!00 !0!!0 &``ܒ  ܀ "'܀   `Ā` `  'А `bПĀ`hĀ `  } `g7Ā7r`hĀ i''`Ҕ `  vX&``w̔Ā  P`(`M`@ I`D  "D 0B` = a6&`8  `Ā .;` @ h/` ` $`h|   `8Ā #``Ā `X $ `` Ā ްȒD  װ `fĀϰ`Ē4  ǰ`_Ā`$ Ā ` `x Ā `  `X  aĀ8 0a~Ā y` t`ٔ l0a#Ā d`є _`Ĕ W aĀPؒ I0aĀ A` < 5 aĀ.` &0aĀ ` `x~  aĀ ؒp  Ā `i "aĀ h 'h'l'p't'x'| ''''' '$'(','0'''/'''''4'8'<'@''D'H'L'P'T'X''/\''` `  'h'l'p't'x'|'''' ''''' ''?'''$'('',0'4'8'<'@'D'H'L'' /2   /H`O `/2   /А0"ahĀ G0:a Ā3 '` +`` '`` ' `Ā`  ' - b}Ā컒R "  "2@?? 2@ 2` "` "` 2` 2`R"  "2`?? 2`2`: :@: :`R "```?` Z>1"*` ((DDD    ` >p@ ?*@ @;&` @ 4 0'`" '="`" ?'`  9  / )Ā &   v`  -p`` >bp` ?@. 㿘@ ?"@㿀 >+40 # =`" '@@+l@'&'`e'㿐 >+40 # =`" '@@+Ng㿐 >+40 # =`" '@@+6@#=㿐 >+40 # =`" '@@+@#G㿀 >+40 # =`" '@@+@'`'`/'㿀 >+40 # =`" '@@*@'`''㿐@''b4.2ffsnfs ` 4 0"@="`"  ?  `@@&`@  2s>2c`@   &@>2#hٔ  "^`>2cp@  U` Ô 8 2R  2J8q  /8&`  'H`X'L 'P 'T 'X '`'d >'\d 'dd'h`'l@'d'pL8Ĕ 't'x' 2H` ~ X 2_͔㿐 ''n㿐  Đ @ '@a sunos_getdents: bad reclenH'D'l0'L ` 2`( `@  @ 8   'Dne` 'Ԑ'ؐ ''''?ئ'D'qi O`2I ?7 &' ">3" 2 @ !`  ?@@ ''7 `@7ʐݔ&@%4: L" Dq  "  x`?2H ` ` B *@'@`'؀ >-#L `@*@ *'`'`'`'` :? `*@@`R` `(`@ 2`Dw ?' 'Fǔ㿘`  GI㿐  @9?`2`   " " $ `( *` 2 ``>"*` &`` l `   2`  7 ` "` m0 $ `` (.`㿐  ϒ *@j $` (m2`@     @m p  S` "$` TN$`   10@ e>!H > !ؒ />!P >5 z >#Вu @ e㿘`  @ 090L㿐 4>+0#@ ="`# ?'@@(U `  K  `2`2` 2`&`a      (  @* @R`    `a  N㿀@u `M  "  㿘     ` `|`x    :   " & n   "& S&  X@? @' ' ' ' ' ' ' ' $' @H >+40 # =`" '@@''Ԑ @''@'L'܀ SM   D  >4``㿐 @i  (  ` D  >6 ` 㿐 >+40 # =`" '@@'g`<  a0b4@'>6t(ٔ٠ٰټ">l" <" ">x " "„"  㿘@   "@@%!㿘@   "@@%4㿈@`>#D@6 >#*` " '`'`'` ' 㿘   >#H#H@  @@" @|/ 㿈@ = $` :`"A ` &,`  '$ $ * 2$  "  $  +@   $ +@ $ `֔ 2` ǔ " ?!   $   @ % * ,  @l, '* ,  @a, ' HH`* ,  @T, '`` * ,  @I, '@ Magma P2 SpMAGMA,P2_SpMagma P1 SpMAGMA,P1_SpMagma 8+2 SpMAGMA,82_SpMagma 4+1 SpMAGMA,41_SpMagma 2+1 SpMAGMA,21HS_SpMagma LC 2+1 SpMAGMA,21_SpMagma Fast 16 SpMAGMA,16HS_SpMAGMA,16_Sp_2Magma 16 SpMAGMA,16_SpMagma 12 SpMAGMA,12_SpMagma 8 Sp - 422MAGMA,_8SP_422Magma Fast 8 SpMAGMA,_8HS_SpMagma 8 SpMAGMA,8_SpMagma 4 SpMAGMA,4_Spmagmamttymbpp㿘?!@  &&  .`"@*`" * * @^2`@@ , (` H(  h(  *H MAGMA_Sp㿘>8@`p`?magma_prom pri %d softpri %d: %s (unsupported) %s 㿘>8`k>cxcx @@ >8`<@ 2@>8  @ >8>8 ޒ0`ڐ $`,$(`0 $x4| `@ $l`@$p`@$t` 6G`0 @ K , @$ $  @$ *@   @   @  *"@ *`" *  *  &!: !@# ~* `  `0  * $ `è `0  |4@$ `0`>:b̔  >>a  >8#$$u>: T$$ਐ uےँ㿘 (  *` ,` g@ ]l 2 *` ,@ `I @ b*`"?"8  *` *  ,@ @@ b    %"@ `$@ b*` "``  ?`" ` "`? 2*"`$  @ `*@!t 2 * @*``, ` @ m    " "@ `*@`p &2 *` ,`  c h @*  "`\" @ *@  R"*` *  ,@6@  @ c* @ *@   ?"   c@* @ *@   ?",`$, c 4,( ", "( @ *@*,` , "@   @   ?*   ? " @ `*@` >   ﶒ 0 %s%x: fifo overflow %s%x: ring buffer overflow 㿘  r (n >  , `p "a(  $@'    @    $ @ >:` ѹ `h*`@`€  $@ݘ Ho o ?$ H 0   `h*   €   >:`8ы  `H (`P˒" `p `h $`p*  @ ( 0% (! ,"(Ho o ?"H 0  "(  (  >:̀  `?: %d tty%s s㿘&    3>= >=" ,&@ @`"  $ " &`( m$ $ $$   $$$`` ` ?@"`   צ0&`( >:#>:# >:#( ,mttydcd㿘 `>8`2   `8* @ (, *  ,` p _$ l"$ pP #"$  $ #$ `  @$ ` @  $ ` %  $ %$  !$ $ `$` $`$H /* & `  h*@@   @  , * @2 .  *@ ` 2 p`  p !$ p ?$ p$    0BH 0 p =9$ pH /* & `   p "'>; $ p !P x   p "H 0> h*` €㿘>6   . 8*   , > h*   €H /* & @  p  @6 H 0O 㿘>6  `  . 8 *   4> h`* 㿘>6  `  . 8 *   4> h`*  >2  * c8@(4㿘>6  `  . 8*   , > `h`*   @ q i ]@X  y@; x@7W  z@' {@"  L   k@0  j@.  \@"3 ;   l@  m@0      $ T0%    @ 0@ 0@{ 0 @v &  &ג "  $ l>0 (c8(,H(p 2 "p " H 㿘 l>2` `*` 8* @  ,@H /* & p V  H   & p Ha  H   HĒ $ , P$ ( p & p H 0  H(   h(":"'`0SCPl  m2@2 2 "@5 "1@0/@2 m*2 l*0! @` m (  l(0 @` m( l(H  㿈 `(> l 2` `*` 8* @  ,@ @   2 `$   耢  H /* &`(    Z `(   v*@ r*@`$   |*@ x*@@,   @) `@ @ @ @ "`$2 #!"  " "" *@`@@  " *@  *@ @   @ N *@ *@`@@2  "  ``  !*@ *@ *@ H 0 >>  `?: %d port%s 㿘 &   @6&`( , | , x @  "&@    `@ &`(`>>!>:# >:#(Ν 㿘 >` 2`X `*@`"S `(6O .  ,@H /* &    H 09  & H 0$& @5?& @2 & @ "$& H /* &  h*@@=   @:   *@ H 0  >2  ` * " 4 㿘@`㿘@Z㿘  @ >6   c`. @ ,# @&9   @24 #8/  &+ $$ ' @$ @ $  &@ &@ &H /* & h*@ o&H 0  mbppdelay㿘 6  > `. c` ,@ 8  # 2   ` & & >@ ܔ ` `i`@8 ` D Z  V` @@` 2   & <``7 3  $"`H /* ! & >@  !>? H 0 ` 2 `"`$@ 2`H /* !    >@   ?&   >@   ?& H 0`  $@` &` 㿘  g" 㿘  _" mbpp_send㿘& & H /* &`  h@ r*@@ *@ @Ȓ   @Ŕ  @ *@ !>@  ` h@*@@ *@@   @ @   @ H 0 &mbpp_recv㿐& & H /* &`1 a" h@* `, `@ |*@ @ x*@ @ *@ @f   @c H@\   @Y  @ *@ !>@h ` h@*@@ *@@@   @= H 0 &㿘  . "* >aX@ * 㿘 >!X@D@ #谒 #@ 㿘@    @` ( spifsttysbppSUNW,spif㿘`@  >A@   : expected 2 interrupts, got %d : expected %d registers, got %d revlevverosc: rev %x chiprev %x osc %dMhz stcpri %d ppcpri %d softpri %d 㿐4`>A!00>A!X˷ 0v0 8sm $ p>Aa b$ `$ X>Aa `b $ \ 2   $ \ $ d  p$ h hk$ l*h@ p @( p h@  p l k  p*(@ p *ha p *hb p *hc p *hp p *(q X l>A \!#\i \ 2%&%"$ \>Ac  >G`  >G!\$ @$ Dl֒ @>E"L$ 4$ 8lϒ 4>F"$ L$ P lȒ L>A t`?: %d tty%s s㿘& t d 6(&`(>E!@>D! ,@,`0 p *$^ "&`(,$ $ &@$`$`$ x   $` $$` d4&`(>B (>B 8>B @ sttycd㿘 >`2   >c 6 c*  (+   *  *  , p` Q$ lb$ p #"$  $ #$ `$  @$ `$ @  $ `$ "%  $ %$  !$ $ ` $`$`H /* &p `  *hdp @(@ p P*h`$ 2 p`(  p !$ p ?$ pd    0BH 0 p =9$ pH /* & `   p "%>B $ p !0E   p "H 0> h*` €㿘>6   . * *   ,>`h*    €H /* &`@ `p   @ `p*(d`p *hH 0 㿘>6   . * c* @ ,@@> h`*   `@ k c ]@R  y@: x@6Q  z@" {@"`,F   \@"7  j@)9   k@  l@.  `, $`,p ` *hdp h *h0   @ 0@ 0 @ &`$ &ْ "  $`$H(  p(d"5``0P?MJ0   p(2a@2`@ 2` 2:`08  *0 p( `*0 p (`$ p(#`*0 p(`@` p(` `*0 p (` p(((H 㿐 l>2` `*` *  㴑* @  ,`(@    \@ 2 `$   \@ { H /* &`(    ^  p  *hd`@@ @ @ "`$2 #!"  "  p"" p*(`@@  " p*( p *h p N@( p *(  p *(  p*(  p*(  p (*h p G*h p @*h`(  p*h9 p*h:`$ "  p p*h1 p*h2 p @( p (( @$ (H 0 㿘>6   . * c* @  ,@> h`* 㿘>6   . * c* @  ,@> h`*  >2  ` * (㴅( ,l>0 ((c(,H(p 2 ,"p , " ,H 㿘 l>2` `*` *  㴑* @  ,@ H /* & p" V  H   & p. H  H  Hr $  P$  p & p`p *hd`p h *hH 0㿘 p w   "0 P p A 2  *@*`@*` t`,  =*@ p (x`*@`@ " @2 ? @" , &", 4*@"" A2` `*` *  *  t ,@ z*@ p (x@*@@@" @2", ","  p*( p v  2T p A 2  * @*`@*` t`, , C   *{ p *h{,  ?",, "   p*({ p *h{,  ?", `$ 4  "  "  p *({ p*({ `  " p,   p ( `*(,  ?ߐ ", p*( p u  2 p A 2  *@*`@*` t`, @ ,", p*( p`*( >   K 0$ %s-%x: fifo overflow %s-%x: ring overflow 㿘t  (>  ,p u``@)``    ` $`$` @ >FaД L h*`@`€``@۰ Ho o`, ?$`,H 0   H /* &p*(dp ((H 0  `@$`( h*€   >Fa    H`PK" p h $p*  @  (`4CCR: timeout 㿘.`@ . 2 2?#@2..  >G x`?: %d port%s 㿘& x h @6&`(`@&`&`(`>G >B 8>B @    㿘@ 㿘@   㿘a ` "  2>Gž 8. bppSUNW,bpp㿘>G@ Vb`?: Zebra : DMA2 : Unknown type 㿘0 8mY &`8@% `8< @@>G(@">G>G"@"P"Xń@<%s: draining still active (0x%08x) 㿐 8'  ⺐  8`'   >G"V ! 8` " 8@ ?"@ 8 ( 8 (㿘>`  6 `. @ 2N 4  2  .8$& ,& ( . 4ߐ 㿘>  .  ( @ΐd d _ dŐ, ,. 4 㿘 ( "J 8 ` L#    8 `  `  8 ` 22  ` " 0,   8 & 0*` 8 ` *` 8    %#  4 8 8   8 ` "  `` *`2 (? & (㿘>  . `$8$ 2 ,  HT$ 0$ ( "`` ( &`$ (   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyz>  %c㿘 '>HAx ">H   & &"      >H#$,@ ٰ? ?0Р >H >I>H#0Ő ,@`" " H";j" &."  v" 㿘 2  `?. &   &  @"  6 & @@6  ?@2@ @ ?   @@s&㿐`@? `2  ?7 x 8" >’`   @)  @^ XH   @ '@+'  @5ک x @/  ) 1  :1#V /@  / 7    ۘ@ (@  /`7` @0os"@ @)  (`0`  @=_# @/Ȗ  ) 1  "* /@  / 7  * "@ (@  /`7` @?Q!@ @)  (`0`  @`& ؘ @/  ) 1  "=# /@ܖ  / 7  ?֘#@ (@  /`7` @"W5#@ @)  (`0`  @!" @/  ) 1  ?f! /@  / 7  )P#@ ?   /`7` @m !@ @?`'  (`0`  @=!b @@ bQ@  ) 1  0,#@  @' / 7  ) @ /`7` @:mc@ @/ @ (`0`  @5Ě`] @/@ @ ) 1  `S (@ @ / 7  6(yb@ ) @ /`7` @9cȚ@ @/Ȗ @ (`0`  @xsa @/@ܖ @ ) 1  0c֚ (@ @ / 7  =5Ca@ ) @ /`7` @V`@ @/ @ (`0`  @*xa @/@ @ ) 1  ?;c (@ @ / 7  bٚ@ ) @ /`7` @#J`@ @/ @ (`0`  @?!B @ ) 1  !}"  / 7  gX!"@  /`7` @?yN @ @ (`0`  @)/"D @ ) 1  # Ȗ / 7  =Ҙ#`@  /`7` @/ p@ @ (`0`  @ &ߘ"Ƙ @ ) 1  :I#  / 7  5;̘ @  /`7` @"!@ @ (`0`  @6u4 9 @ܖ ) 1  9!  / 7  蟘 @  /`7` @1+"e@ @ (`0`  @= H"D 0@@  ) 1  ʿ# 1@  / 7  *#@ 7  /`7` @?$ 9@ 7@  (`0`  @V֘!Ø 0@@  ) 1  #3  1@  / 7  ? }@ 7  /`7` @!a!ј@ 7@  (`0`  @"O 0@@  ) 1  ?9" 1@  / 7  (P#@ 7  /`7` @!@ 7@  (`0`  @=ߘ" 0@Ȗ@  ) 1  /N"5 1@  / 7   "@ 7  /`7` @:ᴘ#@ 7@ܖ  (`0`  @ & &  @& @=&   `*@0* @*  @ * `     +``   (*  ( @   @* * @ * ** 㿐@㿘@   *  @    "@ @b  8:`  b   㿘  `  `  @4 0%@/  & &@*&& @@ג "   ` 㿘?c @ 6 @6` `B  & $ @*&@$@@@2  *   , "@@ 4 "  "  ,`@@ 4`   ,@@ 4  @@*  㿐  `  ` @͘` ?2   2@  *2  ?*@   *  2@*@  㿘  `  ` @  `  &  4 @     ?: : 2@  *:  ?*@   *  2@*@    B 'D'H'L'P'T'X@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@; + @ @` ``z   @Z( 2 " " 2 @    * " @@ @   `@ @ "`" ?* ?*  @(`(  (02 @2J@  J ` 2J@  J " @( @ *(`  J@   J@J`  H" @ J2  @*`(  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*2J@  "  J@J`    #*0 ` + +    "*2"*"  `  ?2   8 * 8 * 4 & 4 &P 'T> X@  )'?T 耦 ؀ 2;  0ؘ'Ĥ744`4`44`4`45 5 45 5 `A ڸ? 28```@@ `*  @@`*  @@`*  @T  @T ;--`2 @- ,`đ2 @ Ĩ  ``"`` ?`   . İ?3 "* ' #@'.`@ '  @@  @?   75@, @7@+ @ˑ2 , . 2`   ?#  $. ?@, @@ "@"@4@6`#?# "6` 6 *. @ ?  @4@ 6`6Į`@6 T " @ " . ?:@ * @2. 4@T*  *`@;Α*  Г*`@ +     ( 8 2+ ( 2@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@`@ "`  " `2  (, '`'` '`''`'` G'`'`'` '`1'İ`@``` 0-`  0(`'`'` !'`'`'` '`' `'`'` S'аX@ "  " `8  "&`2 '`'` ''`'`Ձ'`'`'` '`9''`'` '`'`~'Ȱ>[ "x@'`>U'`aX J@''` '`  '`   '` ! '` ( '`'` :`?% 2@ "` 2` 2`  2`  2` 2` 0? 4"` "` "`  ("`( @"`0 <"`4 D"`8 H"`<㾰'4 D'8'@','<  K3$  XĒ` @㾰'4 '8'@','<  K~3  X` @ofstat@`*@@`2R` ) "`(  >U0 >U0`(KM  `(#Xi `з @㿈@'` :`?G]㿈@'` :`?Gx@'` :?`'Cj &㿈@'`'&'@ N @IV 'x` 2`( '||@   ` '``''''''`K'` |?` @ 't ؖ` N 'x=:`  1'x???'?А'` '` '| Nm 'x :` `Ȓ"@   * *  'x]  |Nx C`@ > <`|ؖx???@? {|x &`@t| t `< t`1'||  "(2+: \|` ϼ `'x"@ &x㿈y ` ϟ   7`ϛ   㿈Ĕ `ς  2 7`   㿈r `f  2 7`c   p''ܐ' '`'` ''` '@㿘`   "` 8`0  6#2 (`*`  `  '* '`@쀢`   ` `] p''ܐ' '`'`'''@` [8`ܔ  '## (`*`  Ǖ*   ''@`2 CLGET: returning %x 0 t@ . c@"^ | b@J  @"N ]?@"/ hW? @"5  |@J? @ C?  @  @:  @"' 1  @-  }@*,?   @  u@"?>`d ?" . > `d?" ,`, `@ , 4  ' ' ' ' ' ' ' ' ' ' 'N`4 '쀢`>' *` 'N`4 '`>' *` '/@/? ?V  @<& t  @     `. ` . ` . ` . . `. *`*` *` *` . *`N?  *` *` *` *`*`*`*` ` . ` . `. `. `. `y.' ' ' ' ' ' ' ' ' ' @j' `~@   }@ ?  @" # *` * * *& t@4 `#@>: &> ` />X ,  %&  `& `b‘ &     2 00&? getflags: %x 㿘``` @ ``  "  @ ! 2  $2 "   " `t # ` 2@@` 2 `2, @ @  @(0(0  >```>Y"@` t` `" ? " "  @( @*  :$ >! @"    * * ?  #  " <" @ "@"`"` "`@``  t` " "(@(" " @2   @(0*     2 ? @ (   @"@"`"` "`H ?"@ Ē @ " ćH H "?@" ćH 㿐 $!'! '``˱  @  ˠ  ! $!$!$! ! ` $! 㿈@  $` `2`B  -,`  '$ $ * 2$  "  $  " (  $  ( +@   $ +@ $ `] 2` N "  p" 㿘``@  㿐@`  *`  ?'#'@ * @` ?'#' 㿀`     :`? :`?@*㿐 ?2' `?'/'T㿐 ?2' `?''>x 8" >H "㿈 ' ` @'#\~ p` ʜ  @?# @c"K ea" b`) -0$ -0/ fd) -02!@: -0''` '`'`  '` [#\l  ' `'`  ' ' ܘ ` #\S ' ܘ ` #\G#>7cpc `>7"^ P `& >"aH  `& $>aP $ `$cp> c `$` `' ܀8'ܐ`  ܀ ``?``  &`` 㿘   @>H""㿈     '@ ` #\㿈 ' ` @'#\ 㿈 ~    '@ ` #\sparcX>aH^ x> aY >aPT >J!p!p` J (J  (J:J*J  ) J`#"JJ  J: **J  : *>]` X@[ 㿈 40?'''# =`" r'쀢 : @$  ',@ @ ,*  `$$` "   Ɩ tL /o `J?`/?N /2.'Ԑ @'ؐ '''$ V /2.'Ԧ @'ض '''$ G''?h'$h ;D 1xD )@ `@` `' "@@ @ &@'ȴ  +` +x0+x+ sun4c compatible0 0 f8000000 15c6a0 map-pagesspurlev1lev2lev3lev4lev5lev6lev7lev8lev9clocklev11lev12lev13profd'(r$  <<d d@@((HI5wG1vuF-|E@ @D@H  0 0   H@80( =;<=>?jklbcde123@AB&'#$12gh56*:pm745H\ 4p@T@Tpppp  p `tpp`t`tp`tx`tpp p,p,ppppp@T(@Tp @Tp h|p p p p 0Dp XlXlp XlXlp Xlpp p p @$p $p h|h|p p H\H\p p pp p p (X40D`td`tL(p p $8"L`"x׌p נ״""p .6pIx -0 8@Fds|ۜ@ >;!@U U3#f#UfD"D"3"####$$$""3""""3DDa#!!1111(DA  ( )UPTUHU U|UxPUpUhTU`UUXU4UYPUYdUYxVV]VxYVpYVh_V`VXVPVHPLV@PLV8PhV0V(V VVVU0U|U|UǤUXUTUHU<UUVUtxxMMP|tx0 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-|2@-Pa$8$0$($$$##wPXTFPNRRHCEST(NMhCL0PL0RE@RRHCEST(SLRRHCEST(ER\CEST(ƈƐ PXhq8X`88q9q949`9949:д:<q:h ,:d:|:;ӄ;Dq;pӌ;q;<q<4qܼ8>H>tq> >q?Pq?|q?q@$8X`8p8$9$949`H9949: @:< :hq:::;$;D<;p$;$;$<$<4$ܼ8>H >t>$>$?P$?|q?q@$ P8X`889949`9949::<:hq:|:(:;;Dq;p;;<<4ܼ8>HD>t>>?P?|q?q@$, @ ݸ4 native#@x00Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-1999 OpenBSD. All rights reserved. http://www.OpenBSD.org native#9D00(¼:B q u ]X >Yxbf4¼[Z `,m( nB$ Yl Y0LSL    ` h`kl`VV WTtPDQ ,h8( x~Xd j /l~8\DWpU@AB¼¼U`D@p   ¼¼ h , Xv8<ptpx¼ |X¼w4   d \`_^$ t¼ mDklL@l ^ _¼8,¼ s v qln^|powXX)pb 4z,{(r¼ ]DpsnoDnWY ]¼¼¼¼TYXX¼¼¼¼¼H¼¼¼¼¼¼¼¼¼pq¼¼¼¼D ¼¼¼¼iL Xij|!T¼h|( ¼gu|v`P e@t4t¼jjjjjjjjjj4  ʤ   ( ֜Ӕ d¼¼¼¼¼$¼¼¼¼¼¼¼¼¼ B  p | 4$ ( X@,0yhy`yXyPyHy8y0y(y yyyyxxxxxxxxxxxxxxpx`xPxHx@x0x xxwwwwwwwwwwwxwhwXwHw8w(w wwvvvvvvvvvvxvhvXvHv8v(vvvuuuuuuuuuuuxuhuXuHu8u0u(u uuttttttttt?? 0 B@`H8+ KKJJJJJJJJJJJJJJJJJxJpJhJJ`JXJPJJHJHAPxttyclsttyopnttybgttyinttyout< \qxqxqxqxqxqx< \=>>qxC?,8P9qxqx;(D,=rtpuwzqxqxqxqxqxqx@ @== @====?B== @Ah==== A==== @Ah== A==  4,T4,T yT { { yHmp|34,PnetionetconnetclswffsX |0mfs~ext2fs>cd9660UXmsdosphnfs@LXprocfs Hnull PunionP umap IportalB`fdescEkernfs 48,y0z| BXEP}rsptCKI|PHNtH "R Wp2lockf@` 0000/////<8X`9`q;DKl=@L0=lq==>L84L748|X8 8 89 9,  9X p9 9 X9 ::4 :` p:::`; ;<H;h; x; ; <, @p>@>l>> H>??H?t?P??0@ 8X?@$8889949`999::<:h:::;;D;p;;<<4>H>t>>>?$?P?|??8X`8x89949`q999::<::d;;Dq;pq;;<<484>H>t>>?P?|q?q@$qA( qqqqq8X`88q9q949`q9q909::<<:|::;q;Dq;pq;q;\<q<4q<84>Hp>tq>q>q?PT?|q?q@$qB   8X`889949`999::<:hq:|:(:;;Dq;p;;<<484>HD>t>>?P?|q?q@$q\D0fifoHqqqqqq a @m8m(P$ E$ "$/ _X$5$$"$Y$E$H$ P$E$m$(`$xE$pG$`EG$X$P[$Hp$@k$8X`8@8q9q94,9`q949t9Ǽ::<H:q:q:;q;Dq;pq;q;ˀ<q<4q`84>Hʐ>tq>q>q?Px?|q?q@$qXG|0H҄ҴӘӠq8X9մ=@@=l\>94=ׄ=88?,@$X<Iؘ(0qqqqqqq8X`88q9q949`q9q99:q:<q:q:q:;q;Dq;pq;q;<q<4q`84>H>tq>q>q?Px?|q?q@$qI     xph`XPH@80( ,qqqqqPq xph ` 8X`8889949`|999: :< ::;;D;p;;<<48q>H>t>>?Pq?|?q( M,devopndeviodevwaitdevindevoutdeviocdevcls8X`8p8$9$949`H999: @:< :hq:::;$;D<;p$;$;$<$<4$84>H >t>$>$?P$?|q?q@$NpX`D ( 0 X @q8X"@9' =@(L=l(>)<*<=(h=(?) @$)LPTADDEqFqqqq+q8X`8J`8O?O9P<94Q9`R 9R`9SX9T:U:<W :hW:X:XH;X;DX;pY;Y;[l<]0<4^g8h>Hh>tiP!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Hqhqdxq. .. 8X`88à9Ō949`9909::<H:h ,::;;D;p,;;؄<X<48>Hl>t,?$(?4@$(U 20123456789abcdef^^YZZ80123456789abcdef#2F$We6tHZl~3"VG,ud>ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$*8FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"0{jNXI\=,jxiiiiiiiiiiiiiiii0123456789abcdef $t<$X\XX\X           `Z[4[??      #+3;CScs !1Aa  0@`  * +X +P +@ +0 + + * +P _` yT h { 0 yH  x }_,_`,2b V   )b 4 ѐ i 0 b l 4 X  Ɉb v x z {b H x z { b vP x z {b P x z { 0 <b3 z x z {b2 h x z {b v x z { v x`b u @,2(@AAA==(A*E@ 8@8@ @@@@@@@@@$     D@R @=Zf @x /<xxxftp ? D C X6666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\ ] z< zD zP z xH \ \ d X X \  \ t | H  \ h g  @ `   X%(%d&  \  ,  ` h  P p  8  (8   8 T   p  PX%(%d&  @\  ,  hX%(%d&  X\  ,  @` h z<' @   0  #H 1 N e u z 8 Ӑ  L | \||@      ?BEFF'' EF''' ?F''F'' F''' F'' EF'' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''n"n&n2nLn`nln~nnnnnoo0oNovoooooo@`HŀhƔPXp`Ɯ8X`8L84 9394̀9`ϸ99h9Ԭ::< 8:hq:q::;;D;pq;Q;j<Z<4484>H>t>>?$q?P?|?@$p8X`8p8$9$949`9L9h9Ԭ::<P:hq:::;$;D;p$;$;$<$<4$484>H >t>$>$?$$?P$?|q?@$\r8X`889949`p9L9h9Ԭ::<:hq:|:(:;;D;p;;<<4484>HD>t>>?$?P?|q?@$`sx0123456789abcdef?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@u`u`u`v`YŸiklnqhq>s8X`88h?t9Ȥ9449`Ɍ9ʔ9t9\:t:<x:h ,:::;$;D};p,;4;<`<48>H>t>M>>4?$?P(?|A?>@$+xw8X`8p8$9$949`9ʔ9t9\:@:<:hq:::;$;D};p$;$;$<$<4$8>H >t?P(>$>$?$$?P(?|q?>@$+0y88X`889949`9ʔ9t9\::<H:hq:|:(:;;D};p;;<<48>HD>t?P(>>?$?P(?|q?>@$"z$ i0lnqhqs 8X`88994|9`999::<:::;;D<;p;;<<4H84>H>t>>?P?|?q@$H|h ... ...@,ŸMO0P<RTTT ...8X`8!<8V09Vl94V9`Ɍ9WT9W9YL:4l:<7|:h ,::;$;Ds;p,;^;^<at<4kp8>H>tpX>;>?Pt?|@?`@$T~X8X`8p8$9$949`9WT9W9YL:@:<:hq::;$;Ds;p$;$;$<$<4$8>H >t>$>$?Pt?|q?`@$d8X`889949`9WT9W9YL::<H:hq:|:(;;Ds;p;;<<48>HD>t>>?Pt?|q?`@$%uu\w`xyz3{P}~`D \ @8xI8ILJKK,KLpTp u yTQl {STx@@@@@8@@ `bb,`b7b7LB`bBBbb3B3LBb b,`@ 7b7LBbbbBf@b3B3LB@~~}<\4@<\H<\P<\X( (X 8(l@( H(lP (PH4t߿sparcsparcXPxL$ 4L$ 4ð@H44444(X4ø(HXL  44444XxdXLDpXLŀHXL DDD  4$  ƨƐƈxxXpHp80(p p̐x`PHH@HH( HHH H(`HޭޭHx $lP @TP ` #P( *P( *PP #PP *P(H4<*+H))P78$7P>?|>RRRRRpR`RPR@R0R RRQQQQ4H0X@8(8X88x8hPH8 888h8PH08 8888x8hPHh0(PHxp`88P80( P80( 88x ph` phX H@80(8 80808888888x8`8H808 8888x8`8P88(8(8(8(8(8(8xp8Ph`8hX8 PH@88 0888x`8H@(  888p`8pP8@( @@pX8@8 ``@   80(KHpLʠ٨٠ و٠x`٠P8٠(٠x٠ x٠ ٠ذ٠ؘ٠؈p٠`H@0٠EEEETڸp٠٠٠x`P@ x8(@ @ .. hXHpXp@p(pp < 4 0P,lh # |*+*P|2+*XL;< ;P\=>=CTCD,b0bcd{|{4 00`t <Hamd7930xaudioamd8xHPhH`H@l(0dT\@+ + + + |  `h Ӡ̈p`ppppp p@0pP 0p`$ԸՔ԰<|ׄ<tۄTp(@ (08pp p@ p p p <L0$hPh`XP($|hx4*,(03(Clv`xt0|\~8tp(Ȟ$d  pp  PPP Hp  @`@@ pppHpPH ,p@`@@ x``   @@@x \P      @<   <   $ p   T  <    8       @  h@  @ PPP   L0H@     0  |PPP PPPPP  pp((p  `HP @P @@h 0 @ D @@@  @  @  p  (  t0 @   p  X @@  PP   `  <p @  pp 0PP  p lpp  @@@ ppp Ppxp  p p   p 0 @ 4 @@   @  @ p  dpx  P HHHpHHH Hpp HHHHHHH  , xpp  p p \8`   @ Œ pp $ ppp ü ppp T  Ġp PPP  8 ńPP PP PP   @@ hp@@@@@@@p ƴ@@  pp L P ǘ 0 0pxx | pp xx `pp ɬ0H@@@@@@ pxp D ʐ ` p 0` ( t` p    Xpp ̤ xx < ͈p`p @@@@@H0  h lPP  θP P P Php Ϝ @   4  Ѐ   H PPPPPP d Ѱ   pp  H0H@@@@ ҔPP PP  ,  xpppp P pp \`p Ԩ(PP(  @x Ռpp p $`` p  ּ` @ ` ` T` נ xh((((( 8 p  ؄0  ` p pp hP(P ٴ@@H88h @@H8$H L` p88h ژ @p 0p 0`p | Pp h P P P ` P p ܬ<P pp0 D0 ݐ`  P (P t0p p `p p  Pp p XPp p ߤHHHHHH h <0pp `pp  Ppp  hpp lPpp P P xp P0p `p  Pp 4Pp `PP   ` d0pxx `pxx  Ppxx Hhpxx Ppxx  P pxx ,(xx xpp0 0pp `pp \ Ppp Ppp 0` p @0` p  P` p P` p $ xp ph 0pp `pp T Ppp hpp Ppp 8  xp 0h `h h Ph Ph `hp L Php  0|`D(t X< lP4dH,x\@$pT8hL0|`D(t Xä<Ĉ lŸPƜ4ǀdȰHɔ,x\˨@̌$pͼTΠ8τhдLј0|`ӬDԐ(t X֤<׈ lظPٜ4ڀd۰Hܔ,x\ި@ߌ$pT8hL0|`D(t X< lP4 @?? U@*U@*U@*U@*U@*U@  DDD|DDD |@@x@@@ 8D@@@D8  @ p@@@@@@| #aaq: P DddTLLD 0DDD((     `   @       p    P    0xx  pp ?111` @ 0`@  000>|? ?1 `  @   000` 3ff ?ff`f>``f`? 8`DDE9  2 2 a p>wc`aaa?`    P 0  0 0f`vvf`        `` 00` 00000000 @6? ?a@ 0    @````@``@?  !?  ?1```@```0 p 00`gop``````p@? ?`@@ P000  000  ``````p?```< 0       `xx`  `88` `9  ?0```g ollg`0? @ ? @@`@` ````a``````````  ` `````` 0 @ a``````````````````@a  0@0@000?00000 0   p0@0@000?000000x  ` ````a`` `0`` !P`````````````````````` ! "080 "acflxx|ngca`p #x00000000000 0  #p`pppY`Y`Y`M`N`N`D`D` #p` p x X L F G C A@@@`0 $` ````````````` @0@ $00`0`0`07000000x %@ `````````````0@8@# %a````|ngca`p & 0`` ` p<@`@`` &F  'p` ` ` ` ` ` ` ` ` ` p@? 'p`@000  'f f f v w@3@7@;; (Pp` 0@8   @` (p` 0@  )0?   ? ) *``00  *|| || *1` +` + ,@0009 , ```gop````````p`xO - 1 ````p@0 -`````1 ````````p9`p .0``````0` .p   . 1```1?`? `@ @ ? /P0p00790000000y / 00 08 0````acf|x|ngc 1 1nf`f`f`f`f`f`f`p 1'y0000000y 2` ````````p@8 2q``````````@p```` 3@  ````````p`8```` 3s48000000x 4 00@8 0? 4  @ 5y00000009` 5pp` 0@0@  5pf f f 7@;@;@ 6Pp@8  6` 0@0@  xp 70`A8 p` 7 8 88    8 8 >`6gC 9`UPUPUPUPUPUPUPUPUPUPUP 9 :@ : ; ; < 0 > ? ? ? @` @ A@ A B B C Cp C DP D E0 E F F F G` G H@ H7%dlhx90 I  000>|? ?1 I` w@;008.@` Jp` 0@ ?? Jp J`0 8 1`p`8A@a KP K @/@YYX X YY/@ @ L01?? L @3 ` M```` M M @?@YY_[ [ Y9 @ N`?? N#aaq: O@ O  P  P Qy00000009>`0000` Qp>~~~> Q RP  R S0 008? Sf3 "D T88 `?@ 2dG T0pp0 0`013`2``A T8|L  `L};@ 2dG U` 000@9 U ? @@`@` V@ ? @@`@` V ? @@`@` W 3 ? @@`@` W ? @@`@` X ? @@`@` Xp  @'&@>&FFF X` `````` 0 @  YP0@0@000?00000 0  Y0@0@000?00000 0  Z00@0@000?00000 0  Z0@0@000?00000 0  [ [ [ \` \a````````````````@a ]@ 3p` p x X L F G C A@@@`0 ] ````````````` @0@ ^  ````````````` @0@ ^ ````````````` @0@ _ 3 ````````````` @0@ _p ````````````` @0@ _``00`` `P`!!c`c`f`l`l`x`8@0@8o `p` ` ` ` ` ` ` ` ` ` p@? a0p` ` ` ` ` ` ` ` ` ` p@? ap` ` ` ` ` ` ` ` ` ` p@? bp` ` ` ` ` ` ` ` ` ` p@? bp` 0@  bx00?00`0`0`0`0?00x c`1136663104`6`w c0009 d@0009 d0009 e 30009 e0009 f0009 fp6@&``?fffg`? f1 ````p@0  gP0``````0` g0``````0` h00``````0` h0``````0` i i i j` j01 ``````p@8 k@ 3'y0000000y k ````````p@8 l  ````````p@8 l ````````p@8 m 3 ````````p@8 mp ````````p@8 m nP!c`f`f`l`x@8 ny00000009` o0y00000009` oy00000009` py00000009` p` 0@0@  xp p````oq``````````@p```` q`` 0@0@  xp q   x  X  8     h  H   (     x   X   8      h  H  (   x  X  8     h  H  (   x  X  8     h  H  (   x   X  !8 ! " " " #h # $H $ %( % & &x & 'X ' (8 ( ) ) ) *h * +H + ,( , - -x - .X . /8 / 0 0 0 1h 1 2H 2 3( 3 4 4x 4 5X 5 68 6 7 7 7 8h 8 9H 9 :( : ; ;x ;  > > ?h ? @H @ A( A B Bx B CX C D8 D E E E Fh F GH G H( H I Ix I JX J K8 K L L L Mh M NH N O( O P Px P QX Q R8 R S S S Th T UH U V( V W Wx W XX X Y8 Y Z Z Z  [ \H \ ]( ] ^ ^x ^ _X _ `8 ` a a a bh b cH c d( d e ex e fX f g8 g h h h ih i jH j k( k l lx l mX m n8 n o o o ph p qH q r( 1234567890-=` qwertyuiop[]asdfghjkl;'\ zxcvbnm,./ !@#$%^&*()_+~ QWERTYUIOP{}ASDFGHJKL:"| ZXCVBNM<>? ({xp h rX`rpqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqx:Tqxqxqxqxqxqxqxqxqxqxqxqxä˴<svwl@<Cl==xBxdPqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqx x 4   "#,#$"H"P <`jqxqxqxqxjqxqxqxqxjqxqxqxqxjqxqxqxqxjqxqxqxqxjqxqxqxqx"##@#%$dqxqxqxqxqxqxqxqxFpqFG\GqHqxڨqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqq<<8qxqxqxqxqqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqx x  L | qxqxTqxqx\qxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqx <qxqx H d qx ݔqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqx<|qxqxׄqxqx<qxqxqxqxqxqxqxqxqxqxqxqxqxqẍqxqxqxqxqxqxqxqxqxqxqxT0qqxqxqxqqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxhqxqxqxqxPX|L4hLqx<Tlqqx 8 H 8dLqxLTd|qqx lqx""qqx($Ppqx$qx"#,#p#$qxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqxqx(qxqx@sv~~qxqx - .p 6` 9 3qx =qxapdlqxqxdqxqxqxjqxqxqxqxqxqxjqxqxqxqxqxqxjqxqxqxqxqxqxjqxqxqxqxqxqxjqxqxqxqxqxqxjqxqxqxqxqxqx0LqxLqx lqxqx qxqxqx|<qxpqxqxAAHA\qxqxqxqx{ hXH0 PPPPPPp`P@0 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPxhXH8(PPPPPPPPPPPPPPPPPPPPPpPXޭŨnŠnŘnŐnňnŀ!xnpnhn`nXnPoHo@o8o 0o(o ooo o$o(o,o0o4o8o<o@oDoHĸoLİoPĨoTĠoXĘo\Đo`ĈodX4ɸɰɨɠɘɐɈɀxph`XPH@80( XPH@80( ʐʈʀ8xph`ʸʰʨʠʘ@@80( Ӹ ӰӨ ӠӘӐ@ӈ@ӈ@ӈ@ӈ@ӈ@ӈ@ӈ@ӈ@ӈ@ӈ@Ӹӈ @Ӱӈ@Өӈ @Ӡӈ@Әӈ@ӐӈӀx$pxhx `x XxPx@H@@8@@0@ @(@ @ @ @@@@@@@@@@@@@@@@@@@@@@H80 (   Ҹ ҰҨҸ ҨҰҠҸ ҠҰҘҐ Ҙ҈ҀҸ ҀҰxҸ xҰpҸ pҰҘh Ҙ`XҸ XҰPҸ PҰ@Ҹ @ҰҘ8 Ҙ0(Ҹ (Ұ Ҹ  ҰҸ ҰҘ Ҙ Ҹ ҰҸ Ұ Ҹ Ұ (Ҹ( ҰҸ Ұ(Ҹ( (ѸҸ( ѸѰ Ѩ0ѠҸ0 ѠҰјҸ јҰ0ѐҸ0 ѐ0шҸ0 шѰ р8xҸ8 xҰpҸ pҰ8hҸ8 h8`Ҹ8 `Ѱ X@PҸ@ PҰHҸ HҰ@@80( 0 HҸH ҰH@ PҸP ҰҸ ҰP@Б иа аиШ ШиР РиИ ИиА АиЈ Ји   иЀ Ѐиx xиp pиh hи` `иX XиP PиH HиX@ҸX @Ұ8Ҹ 8ҰX@0( (` Ҹ`  ҰҸ Ұ` ` ` ` ` ` ` ` ` ` ` ϸ` ϰ` Ϩ` Ϡ` Ϙ` ϐ` ψ` ψ` πψ` ψ` xψ` ψ` pψ` hψ` ψ` ψ` `ψ` ψ` Xψ` ψ` Pψ` Hψ@Ҹ @Ұh8Ҹh 8Ұh0Ҹh 0Ұ(Ҹ (Ұp Ҹp  ҰҸ Ұpp  xҸx ҰҸ Ұx$ЁxҸx(ЁxҸx,Ёx Ҹx4θЁxθҸx8ΰЁxΰҸx<ΨЁxΨҸΠ( Π Θΐ ΘΈ΀x ΀ph` hXP( P Hΐ HΈΠ@ Π80( 0 (  ΐ Έx p` X(  ΐ Έx p` X    ͸ Ͱͨ ͠(͘( ͐͘ ͐(͈( ̀(xp( xh0`0 `X X0P͸0 PͰHͨ H͠8@8 @8 88@͸8 @Ͱ8ͨ 8͠@0(@ 0 (ΐ (ΈH (H   ΐ ΈP(P  ΐ ΈX0(X 0 ΐ Έ hΐh Έ(  hh ̸̨̠ ̨̘pxp x̐ ̐̈ ̈x̀(x ̀ xΐ xΈ ph@`h`XhPhHh@h 8h@0h`(h  h@h`h @`  @ ` ˸ ˰ ˨ ˠ ˘ ːh@ˈh`ˀhxhphhh`hXhPhHh @h`8h0h(h h h@h`h@ @ @ @ ???? -  !" _`abcxyz{|}~ZN]Y^YBYYYYY.YYYYsvr4x 04Px?  xph`XPH@80( `@80( xXPH@ `XPH@80(h8xpX80(p`XP@0 h`@8xph`XPH(x`X8`H0pH pH ~~~~~~x~X~@~ ~}}}}}}}p}H} }||||||`|8|{{{{{{{h{H{({zzzzzhzHz(zyyyyy`y8yxxxxxxhxPxHx8x0x(x xxxwwwwwwwwwwpw`wP¼:B q u  %@bf4%[& +m( n.Q Y0¼¼L¼¼;RDKY¼¼D=¼VJ¼ 3d¼t/¼¼,FD X¼$( ¼¼Xw4 &,~8\D 1¼¼¼¼¼¼¼¼¼¼¼¼=¼¼{(z, '¼¼¼qxo, Rd jhn ql HJpE CIK¼¼:l;(¼¼6¼5(¼¼¼Z )|  p[BZ s v Rx S| T+¼.- p =L¼¼wU\=+ V¼ ¼¼¼¼¼¼¼¼¼¼¼*8Y+< X¼¼¼¼¼¼¼¼¼¼¼¼¼¼$¼¼¼¼¼¼¼¼¼¼=(=D¼¼¼¼¼¼¼¼¼$<¼po¼¼¼¼¼¼¼¼¼¼¼¼¼¼¼¼¼¼¼¼¼¼¼¼¼¼ NT t \ d^$^| ^_ _4 ]D ]¼pqsunosˀ9D00¼:B q u   ȀȰbf4[¼ m( p B$¼ Y0¼¼Lܰڈ¼¼¼¼¼¼(¼¼VɈ¼tܸD¼,¼¼¼8¼ ¼d j H~8\DW¼U@ 4B¼¼ЬD@p   ր¼ h Ը X¼<ptpx¼ ư|X¼w4   d \`_^$¼ $t¼ ۀklL@l ^ _¼8,¼ s v qln^|powXX)p¼4z,{(r ]Dp¼Hn¼¼¼ ]¼¼ ¼8|(׈P4tXt¼xؼt@RPT,SH¼ <ZH¼¼¼¼¼¼,j|!TL$2Kn,X  `  % K2Kn,X `%K@  @@ @  !"#XH8(@` @` @`  @`ްޠސޠ @`ހh @`XH8(@`@`ݸݨ@|h,,plx|D,<hK%  `   X,nK22Kn,X `%KOpenBSD2.5GENERIC#149 @(#)OpenBSD 2.5-beta (GENERIC) #149: Wed Mar 17 15:34:56 MST 1999 deraadt@sun4m.openbsd.org:/usr/src/sys/arch/sparc/compile/GENERIC  !)19:h!/&x.˴7L FTxT W\1d8m~p "h l} " "p7~$~Hd*9@AFF<Ua "xt " "` "8/8لBh* "4>=JQ_p ~/dd @dp "W #N+B6ӔB "KW]bhlwH  "lP HB̸ " "~X) ";=E pS (b "o0BX "/` "Ā<G4,x8I #8Y )b Ippdy(, (  <Ő x$3 B<H%POBVDe #<r`8%d,$d.V!9tD,Oa u #@}` #4(h+! #6 #D HR #cXhlv~8 # # ls<;D   c| "˜ , 6 $ C R: b $ j$ q } $ K K  R( MH x Y = %  d (Yd ;y K X=H ] l | E  $ >  L Q@ P T  a T $6 0t 9 $ D T f u3  )   +d L $ Ԉ h , :` H  4 = /$ & $ 1( A $ R: \:T l8 x V ܀ RP e e KP > L` C` $  N H +N 2 ?ʤ J UB, _ |  *(  $ *< % / 0x   | p %,% %0q8qI4Yphtc %;Ɛlð_h_M %L' 6EN^Nf.Hpc~I %P # )|b@ pYl*9 %TVfl^\l${ %Xs |fh@CL((b4 %\<,0G_hR^ zDiu %`|V#@ |l %hb0c ` d_&ˠ64? %H T _B$ks5PPR4r|ʐD πD" %*,4$=KihYgvq?vhU\$$ % * *v8#x/L'4cCHQӘ`m:l:\p4 +:1D8% g$ -d>HXQ<[dgr} %EJdH,pF&1T=BH %[Z0gr %}Uqxu dxR ȤH)785 4BNYgh| % |  VhD@ ؼ QpɈ(4l`BT^r(z % a %5@KU4 SH! 1?s$U@drWT4 9@(# Lմ  #&,4?K @]dg & r &|^$_/l<u ugP (T&0<YJ|WӔb{(m }4zoH5xl@bp &(ׄ '9$4E T )_ <ql{0+ Rx htXh $d`# z4 (G ( Y ($dHq{\',D=9 H1< \#H0H<FJp[Kc'\m@}]0| (0X ((K (0 #2K4V)gvIx (H 0+ x (L  T  *L 7 ?L N \it i8 zLX (P (T b     *(  !=D!!#à!4`!AI!RA4!]!f!v 0!|!!QP!!L! ! i! (X!"X" (\"0"# N0"/ (`"8N">s"G"Q (d"\l"is"0"s"B"1" 0" J"d">"" ###+T#5 #A#M (#Y#c0#o#z v##G#<#:@## j#c#0`#K$t$$!?$:=d$R<$k<$;$;$;<$$ $$$%#% 18%l%,SX%;<%Ft%Q%Zd%h (%r%~+0% p%XH%D%% (% V(% (%l&&BH&) (&8&N<&\&i &{B&&&& >& ~0&~&`&q& (' )''%u`'1>'= M'N )'XrD'lt'h'҄'' ' *''TT'' ڨ')x( =((!(9(B *(M *(`D(q/p(/X(0((8( ( +,(pL((( +0)4))+